Loading...
Street Network Guide Randolph County Street Network Revised: 4/13/2020 1 Preface This book is one of the many benefits reaped from Randolph County's E911 Project. It contains detailed maps of the roads and streets within Randolph County. Incorporated city limit lines, streams, and generalized address ranges are also indicated on the maps. The address ranges are used to provide a general flow of addresses along each road. The address indicated may not exist as a house or building on the road, but is an indication of acceptable addresses within that area of the road. The rural addressing process was a very extensive and cooperative effort between numerous citizens, agencies, and organizations. It would be impossible to list everyone that has helped Randolph County implement a street addressing system. However, special thanks should be expressed for all the assistance provided by: United States Postal Service, all the utility companies (telephone, power, gas, cable television, etc.), all the towns and cities, the fire departments and, most importantly, our citizens. This book was produced by: Randolph County 725 McDowell Road Asheboro, NC 27203 DISCLAIMER: This book was prepared by Randolph County, NC for the County's internal use. Randolph County, its agents and employees make no warranty as to the correctness or accuracy of the information set forth in this book, whether expressed or implied, in fact or in law, including without limitation the implied warranties of merchantability and fitness for a particular purpose. Randolph County Street Network Directory Table of Contents I. Preface and Disclaimer II. Table of Contents III. Street Network Directory Instructions IV. Addressing Scheme V. Maps (Tabs A through H) VI. Appendix a. Road Name Index b. City Street Index c. Mobile Home Parks, Business Parks and Apartment Index d. State Road Number Index i. State Road Number Index sorted by road name ii. State Road Number Index sorted by road number e. Road Identification Index f. Reserved Road Name Index g. Official Road Name List Revised: 4/13/2020 1 NETWORK DIRECTORY INSTRUCTIONS The Network Directory is divided into several sections. Following are explanations of how to use each. Explanation of Map Page: This portion includes a sample map page. Listed below are explanations of the various page segments and their use. Page Overlap Area: Area beyond the map page for reference. Roads and addresses in this area are indexed on adjoining pages. Map Page: This is the main map being viewed. Roads within this are indexed in Appendix A and B. Direction/Scale: Directional star showing North, South, East and West. Map scale is shown in feet per inch. Disclaimer: Please read carefully. Randolph County Vicinity Index: Grid of entire County with page presently being viewed shaded to indicate its relationship within Randolph County. Adjoining Page Index: Chart showing close proximity grids. This is helpful to follow flow of roads from one map page to the next. Date: Indicates date of last addition, revision or deletion to this page. Page: Map page number is shown here. The page number is based upon a grid system with A-H moving south to north and 1-8 moving west to east. The Enlargement Reference and Page Reference Grid further explain numbering system. Enlargement Reference: A1 – shows the largest grid area, covering approximately four miles by four miles. A1a – A1d – A through D is A1 broken down into quarters, showing a more congested area, approximately two miles by two miles. A1e – A1t – E through T is A1 broken down into 16 squares, indicating the most congested areas, approximately one mile by one mile. Revised: 4/13/2020 2 Refer to the Page Reference Grid for a complete visual of how page number are determined. Legend: Explains graphically what the symbols on the map represent. Additional information regarding roads is as follows: Public Road – Indicates city roads and state roads, their names, road numbers and the beginning addresses between intersections. Private Road – Indicates private road names and beginning addresses. Page Reference Grid: This is a grid showing how the County is divided into individual maps and identifies where major roads in the County are located. Each page number is a combination of letters to the left and numbers along the bottom of the grid. If the solid line grids are divided into grids made up of dashed. The little letters in the dashed grid becomes a part of the map page number. The pages of the book are grouped alphabetically and can be referenced by the section tabs. This grid shows how the County is divided into map pages and as an example, to find the roads that surround the intersection of US Hwy 311 and US Hwy 220 BYP, look at the grid and find the specific location. For this example it is F4p. Turn to map page F4p under the A through H tabs section. This page shows that intersection and the surrounding roads in more detail. Map Tabs A through H: These tabs divide the map pages by alphabetic grid for easier reference. Appendix A: This is an alphabetical listing of all State, private and city roads with address ranges and the map page numbers on which they are located. To use: Locate the road name you are searching for, then find the map page number. Go to tab A through H and located the page which contains the road name. Appendix B: This is an alphabetical multi-city list. The city name is followed by an alphabetized listing of all roads within that city’s jurisdiction. These listing include address ranges and reference map page numbers. To locate Church St, Ramseur: Revised: 4/13/2020 3 #1 Locate Ramseur City Street Index and then Church St. #2 Listed as Church St 1300 - 1360 E7r. #3 Refer to map tab E then to map page E7r to visually review location of that street and surrounding area. Appendix C: Index includes list of complexes (mobile home parks, business parks and apartments) in alphabetical order and the address for each complex. Complexes in all municipalities within Randolph County are included with the exception of the City of Asheboro. To locate Level Cross Industrial Park: #1 Locate alphabetically Level Cross Industrial Park. #2 Address is listed as 10553 Randleman Rd. #3 Locate road name in County road index. (Appendix A) Road is listed as being on map page H5c. #4 Refer to map tab H then to map page H5c to visually review location of complex. Appendix D: If only a State road number is known, you can quickly, by numerical sequence, identify road names that are located along the State road number. It is possible for several different road names to be assigned to various segments of the same State road number. This appendix has a list of State roads alphabetized by the road name (Appendix DII) and another appendix (Appendix DI) is sorted by State road number. To locate a State road number: #1 Locate State road number numerically on the State Road Index. #2 Look up road name on the County Road Index. (Appendix A) #3 After finding the road name on the index, turn to the A through H tabs and locate page on which the State road is found to view road and surrounding roads. Appendix E: This listing contains all roads in the County sorted alphabetically by the road name. The appendix also includes the road identification number, road name, the ZIP code and whether the road is city, private, State road, NC Highway, Interstate Highway or Out of County road and it also includes the road segment length in feet. Addressing Scheme A computer-generated grid system was used as the basis for assigning addresses in Randolph County. Base lines selected for this system are US Hwy 220 Business from north to south and US Hwy 64 from east to west. Every road in the County has been designated either a north-south road or an east-west road. Beginning numbers were assigned to each road in the County based on their relationship to the base lines. The computer then assigned a number for each 20 feet of road frontage. The numbers ascend away from the base lines with even numbers on the right and odd numbers on the left. Block numbers automatically change at each intersection with another public road and every 1,000 feet if there is no break in the road. Note: This addressing scheme applies to Randolph County only. Each municipality within the County has responsibility for its own addressing scheme. Randolph County assisted any town or city that requested use of our addressing resources, but each city determined and adopted an addressing scheme suitable for that city's needs. WARNING! This document may contain errors. No warrant of accuracy fitness for a specific use is expressed or implied. B e a v e rd a m CreekReeves Spring BranchSpringBranch NannyBranchBigCreek Glady F orkCrowCreek Wallace Branch S N C H W Y 1 0 9 C H APELHI LLCHURCHRD 109 NCOGGINS MINE RDSCHAPELHILLC H URCHRDSCHAPELHILLCHURCHRD(S1105)(O9999)(S1179)(S1196) (S1263)(S1185)(S1181)(N 109)(S1 1 0 3 ) (S 1102)(S1181)(S1101)(S1100)(8 302 )(5353)(6600)(598 7 )(7700)(7784)(6884)(6468) (7 226)(1365)(8400)(6200) (8100)(6600)(7940)(6900)(7400 ) (8700)(6300) (6705)(7400)(7600)(7200)(7794)(8062) (6500)(8600)(7200)CHARLESMTNRD BU RNEYMILLR DCROWCREEKRD KIDDSMT N RD DEERTRAI LD R NEW HOPE RDHEARTLEAFTRL SHAW REEDER RD CRO W CREEKRDEXTSCHAPELHILLCHURCHRDLOU CRANFORD R D W ILKESSNIDERRDG R AHA MDAVISRDEX T NC HWY 109VOLUNTEERRESCUE RD HOGAN FARM TRLNICHOLSCRAN FOR D R DCHECKMARK RDCHAPELHILLC H URC H R D BELLSGROVERD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A1 B1 A2 B2 A1 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet N a rrows Bran c h U w ha r rieR iv erLak e s Creek MillCreekNanny BranchPois onFo rk LaniersCreek Dunco m b eCreekW a lkersCreek OPHIR RDG R ISSOMRD THAYER RD ( S 1108 ) (S1105)(S1107)(S1104)(S1181)(S 1 1 4 3 ) (S1106) (S1179)(S1107)(7600) (4200) (6495)(8869)(5800)(6505)(7700)(5597) (7400)(8522)(4685)(6295)(4 8 3 4 )(4513)(6708) (5078)(7900)(7784)(5686)(5987)(7794)(6200)(6500) (7100) (5100)(4 4 00)(6909)(5353) (6 5 00 ) CHARLES MTN RD EAGLE CHASE RD KID DS MTNRDBURNEYMILLRD PISGAHCOVEREDBRIDGERDLANIER HILL RDHOPKINSDRNEWHOPERD HILLHARDISTERRD KINGMTNRDDEERF ORESTLN LASSITER MILL RDDEER TRAIL DR LOU CRANFORD R D HIG H PIN E CHURCHRD ELEAZERCHURCHRDEAG L ESFIEL D RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A2 B2 A3A1 B1 B3 A2 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Walk ers C r eekWest ForkLittleRiver Poi sonFo r k BarnesCreekSouthProngHannahsCreek CALLICUTT RDHURLEYFARMRDLOVEJOYRD(S1109)(S1187) (S1113) (S1115)(S1112)(S1114) ( S 1 110)(S1 1 0 8 ) (S11 1 4 )(S1143)(S1111)(S1112)(6663)(6784)(5400)(5360)(5631 )(5190)(4200) (3656) (40 0 0)(8869)(4400)(6527)(6300)(6478)(3913) (3600) (67 9 4 )(9016)(3400)(6134)(2400) (6500)(5514)(5800)(6600)(3 0 0 0 )(8522) (7800)(8127)(7026)(6400)(6100)(6100)(6691)(6909)(6026)(6700)(7 2 0 0 )(5143 )(5413)(6295)(5024)(5700)LA NIE R R DRANDALLHURLEYRDMTLEBANONRDPISGAHRDSTRIEBYCHURCHRDEXTTREEHOUSELNEAGLECHASE RDHARVELLRD B IG LE AF R D PISGAHCOVEREDBRIDGERDE A GLESFIELD RD LUTHERHURLEYRDPONDSI D E DRBROWNLOWLN A B N E R R D PISGAH CHURCHRD HIGHPINECHURCHRDSTRIEBYCHURCHRDWOODS A GE DRCOX MILL RDEVENINGSHADERDSCOTTMCDOWELLDRKINGMTNRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A3 B3 A4A2 B2 B4 A3 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet R e ed CreekKingsCreek Little Riv e r BetsyCreekRockyCreekW agnersBranchWestForkLittleR iverRe e dy Creek WesleyDea n BranchBLACK A NKLE R D SMITH FARM RD DEERELN134NBETSYCREEKDRROCKYBRANCHDRETHER RD(S1188)(S1225)(S1127)(S1114)(S1123) (S1 1 0 9 )(S1125)(S11 1 3 )(N 134)(S1115)(S1117)(S1119 ) (S 1 1 18)(S1122)(S1115)(N134)(S1121)(S1127)(6600)( 6 1 3 2 ) (507 3 )(5561)(820 ) (2211)(4905)(4535)(5000)(2000) (1600) (6100)(5707)(5900)(4898)(2500) (5631 )(5200)(6223)(5400)(700)(5390)(2100)(6300)(6610)(7000)(2700) (1700) (1700)(2400)(800)(1400)(6200)(5800)(2300)(2788) (1200)(1000)(1720)(1900)(6000)(4800)(5 8 1 1)(3000)(5300)(5100 ) (2100)OLDTROYRDPISGAHCOVEREDBRIDGERDNC HWY 134NEWHOPECHURCHRDKINGVIEWRDMILLIE LNBURNEYRD FRANKRD ETHAN SPRINGS RD FRANKIE TRLAPPLE TREE RD COXMILLRDPISGAH RD M A PLE SPRINGSRD PISGAHCHURCHRD LITTLERIVERRDTERESAWAYREEDERRDEXTWHITEPINES LN BOONEFA RM R D CENT E R C RO SSC H U RCH RD BEANECTRYRDBET HEL LUC AS R D REEDERRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A4A3 B4B3 A5 B5c A5j A5f A4 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet LambertCreek Asheworth B ran ch Bear Creek King sCreekWes leyDe a nBranchWagnersBranch Little R i v e r U P P E R RD CAG L E R D KENNEDYLN73-74 S73-74 NUS220ALTNGAP RDKIN G RDASBURY RD Seagrove Seagrove Seagrove Seagrove(S1129)(S12 5 9 )(S2847)(S2843)(S1002)(S1255)(N 705) (S 2 8 50)(S2855)(S2848)(S2856)(S2858) (S2857) (S1127)(S2846)(S2860) (S1124)(S 1 1 1 9 ) (S1123)(U 220ALT)(I73 /74 )(S2854)(S1195)(S2853)(S112 5 ) (S2861) (N 705 )(S2859)(1154)(5329)(1825) (8 0 0 )(5600)(639)(1202)(7700)(549)(6046)( 8 900 )(9100)(700) (8 8 0 0 )(6700)(212 1 )(600)(8685)(7906)(6600)(200 0 )(600)(200)(5875)(400)(9174)(6000)(820) (500)(4898)(2 62)(691)(4900)(5200)(570 4 )(1629)(1100)(7 4 0 0 )(5700)(5100)( 0 )(800)(500 ) (163) (1000)(674) (6 0 3 4) (5073)(9319)(100)(881) (663) ( 4 027 ) ( 4 030 )(1244)(42 8 0 ) ( 427 5 )(5001)(42 2 7 ) ( 4 228 )(220)(300)(4880)(4909)(6223)(900)(1300 ) (5900)(4322)(43 19 ) E M A I N S T KIN G R D SEAGROVEPLANKRDEMMANUEL CHURCH RD SPRING S T US H W Y 2 2 0 SCALLIE DR RID G ERDFORKCREEKMILLRDW MAIN ST E KING AVE G A RN ERSTKING VIEW R D USHWY220SN BROAD STGLENNSTRICHLAND PARK D R CLYDE KING RD O L DPLA N K R D LITTLE R IV ER R D GREENST WAYMON STWR IGHTSTHINESLEYR DNORTH STCRASTO NDRN C H W Y 7 0 5 M C C R A R Y CTR Y LNAUMANSTW KING AVE SUSAND RGARNERMASHBURNDR LUCKDR BURNEYRD OLD MAPLE SPRINGS RDEDGEWOOD VIEW DR EAST AVE H O YLEDR FERNANDEZLOOPTERESA W A Y OLD US 220 HWY HILL ST LAWRENCE FARM RDYO WDRSEAGROVEPLAN K RD E XTWESTEDGEWOODCIR SCO TTRD BOYD DRBOONESTSEAGROVEPARKVIEWDR SOUTHSTSOU THROCKSTWALKER STLEATHER R D BOROUGHAVE FARLOW CORNERRD MAPLESPRINGSRDR ALPH LA W RENCE R D HOYT DRCANDLEBROOK DRWEHUNTRDBOON EFA R M R D POTTERSWAY RD AUMAN FARM R D S BROAD STMORNINGVIEW RD HIGHKNOB TRL IN T ERS TA T E HWY 73 /7 4 GRAVESCTRYRDWESTWOOD DR NEEDHAMSTRL CAGLELOOPRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A5 A4 A6 B6B4B5B5c A5j A5f A5 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Wesley Dean BranchKings C r e e k AsheworthB ranchWagnersBranc h Seagrove Seagrove(S2847)(N 705)(S1119) (S2848) (S2850) (S1125) (S1127) (S1127) (U 2 2 0 A L T ) (S111 9 ) (R 73/74) (S1124) (S1259) (S1123)(S1122)(I7 3 / 7 4 )(S1195)(7869)(5329)(639)(549)(5700)(200) (7800)(600)(100)(400)(7906)(300) (100) (5704) (1200) (500) (100 0 ) (820)(4898)(262 )(674) (7 4 0 0 ) (1000)(5100)(0 ) (163) (700) (5073)(4800)(42 8 0 ) (42 7 5 ) ( 4 0 27 ) ( 4 030 ) (42 2 7 ) ( 422 8 )(220)(300) E KING AVEN BROAD ST SPRIN G S T U S H W Y 2 2 0 S RICHLA ND PAR K D R W M AIN ST KINGVIEW RD GARNER S T GREENST L IT T L E R IV E R R D WAYMON STYOW DRAUMANSTW KING AVE OLD MAPLE SPRINGS RDEDGEWOOD VIEW DR BENNETT FARM RD SEAGROVEPLA NK R D EX T PARK STBURNEYRD WESTEDGEWOOD CIR MAPLESPRINGSRD BOROUGH AVE LITTLE R I V E R R D CANDLEBROOKDRTERESA WAYREEDERRDINT E R STAT E HWY 73 /74 IN T ER S TA TE HW Y 7 3 / 7 4 WESTWOOD DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A4 A5 B4 B5c A5a A5j A5f B5 A5 A5k A5a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Wagners Branch Seagrove Seagrove(S2847)(U 220ALT) (S 2 8 5 0 ) (S1128) (S2848) (S1127 )(S2846)(S1124) (U 2 2 0 A L T ) (5500 ) (72 0 0 )(7869)(5184)(5400)(200)( 7 00 )(7700) (100)(400)(7800)(600) (50 0 )(7906)(100) (200) (300)(4900)(5200)(163) (7 4 0 0 )SEAGROVEPLANKRDU S HWY 2 2 0 S N BROAD ST G A R N ERSTOLD P LANK RD EDGEWOOD VIEW DR WALKERSTHOYLEDR BURNE Y R D SEAGR O VE P L A NK RDEXTWEST EDGEWOOD CIR BENNETT FARM RD SEAGROVEPARKVIEW D R BOROUGH AVE ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A5f B5c A5a A5 A5j B5 A5k A5f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Wesley Dean BranchWagners B ra nc h AsheworthBranc h Seagrove Seagrove (U 220ALT)(S 1 1 2 5 )(N 705)(N705)(S1255)(U 220ALT) (I73 / 7 4 )(R73/74)(S1195) (130) (5 0 0 )(8685)(5875)(5 7 0 4 ) (101)(549) (400)(300)(500)(200)(100) (4 2 8 0 )(200)(400)(200) (5 0 0 ) (42 7 5 ) (300)(0)(3 0 0 )(262) (300) (220)(100)EMAINST US HWY 220 SSOUTHROCK STSPRIN G S T MAP L E S P R I N G S R D LUCK DR RIDGE RDW MAIN ST E KING AVE LITTLER IV E R R D GREEN ST O L D P L A N K R D WAYMON STWRIGHT STNORTH STAUMAN STW KING AVE N BROAD STOLD MAPLE SPRINGS RDHILL ST EAST AVEWALKER STIN TER S TA TE HW Y 7 3 / 7 4 PARK STYOW DRSOUTHSTHOYTDR WESTWOOD DR S BROAD ST² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A5 A5j A5a A5f A5k A5 A5j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet LambertCreek Bear C reekSeagrove (N 7 0 5 )(S2855)(S2853)(100)(7 0 0 ) (7 2 0 ) (8 0 0 )(200)(9 0 0 )(300)(400) (5 0 0 ) (6 0 0 ) (77 0 )(300)(163)(100)(6 6 3 )(5700)O L D P L A N K R D RIDGERDE M A I N S T GLENNSTHINESLEYRD NC H W Y70 5 LUCKDR HILL ST HOYT DR FERNANDEZ L OOPBOYD DRBOONE STHIGHKNOBT RL² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A5A5kA5j A5f A5k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Ric h a r d s o n C r e e k Reed yCreekB e arCreek Meadow B ranch (Meadow C r e ek )LittleCreek La mbertCreek Fork Creek U P P ER R D YOWRDS NC705 H W Y M C K A Y R D KENNEDYLNNATHANLNM E A D O W SPRINGSRDC H R IS C O R D ECABINTRLREEDER RD (S2 8 6 6 )(S2863)(S2 868 )(S 2 8 6 2 )(S2843)(N705)(S2849)(S2866) (S2870)(S1002)(S2864)(S2863)(S2869)(1060)(2660) (346 8 )(6200)(3640) (200 0 ) (100)(1825)(3200)(6903) (5606) (6 7 0 0 )(21 3 9 ) (710 4 )(6600)( 5 700)(7579)(1629)(2500)(7600)(5813)(1900)(2900)( 7 1 4 0)(5970)(6533)(31 00)(2921) (2966)(2700)(2435) (2200)(6160)(6700)(2898)(212 1 )(5600)(3300)(1500) (2300) (3200) (1700) (2749)(6200)(1100)(2400) (2100)(6900)(6300) B R O W ER M IL L R D TRINITYCHURCHRD SUGG TEAGUE RDNC HW Y 7 0 5 FORKCREEKMILL R D SPIVEYSCORNERRD UNIONGROVECHURCHRDNEEDHAMSTRL LAWRENCE FARM RDPOTTERYRD MEADOWB R A N C H R DLITT LE BROOKRDH US SEYWIL LIA MS R D MUSTANGTRLRICHARD SONLNRALPHLAWRENCERDSUGG DRBECKFARMRDTEAGUE FARM RDCLYDEKINGRDBACHELORCREEKRD ROLLINHILLSR DEAST FORK DR NEWC E N T E R C HUR CHRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A6 A7 B6 A5 B7B5 A6 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Reedy C reekMeadowBranch(M eado w C re e k )Fork Creek CEDAR HILLRDNEEDHAMGROVERDJUGTOWNRD O D E L L R D RANCI E R DFLETCHER LNFRANKLINRDYOWRD (S1003)(S2872)(S2874)(S2873)(S2873)(S 2866)(S1002)(S2867)(S28 7 0 ) (S1002) (S1003 ) (S2871) (S 2 8 8 7 ) (4400 ) (5100)(7800)(5273)(6700)(5300)(5222)(7929)(6200)(7205)(7100)(4 385)(4100)(7400)(6324)(3300)(7136)(6925)(3716) (4880) (5 0 0 0 ) (6100) (5100) (3889)(6700)(7 3 0 0 ) (3640) (8400)(7000)(4747) (4200)(8200)(3200)(5200) (7 5 0 0 ) (5620) ( 7 200 )(7700)(94 0 0 )(7900)(3468)(7600)(6500) (8 7 0 0)(3918)(669 0 )(8727) LITTLE BROOK R D FORKCREEKMILLRD E R E C T R D SANDERS RD RIVERSI DE R D SEARCYRD EXT WADDELLSFERRYRD G A TLIN CTRYDR JUGTOWNRDSUGGTEAGUERDBENNETTRDSADIERDSADIERD ELBERTDAVISRDTRINITYCHURCHRD KISERRDOSSI EHAYESRDW AC R A V E N R D B ENJAMINRD SEARCYRD BROWER M IL L R DBECKFARMRD ANTIOCHCHURCHRDTEAGUEFAR MRD LI L LI E L NH U SSEYCTRYTRLMANESSRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A7 B7 A8A6 B8B6 A7 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet F la tCreekFork Creek Deep River CHATHAM STLEE STKIDD R D E BONLEE ST E CARTHAGE ST N C 2 2/4 2 H WY ODELL R D SAND BARLNCOUNTRYRIVERLNW A S HINGTONST HAPPYACRESDR JERRY FRYE R D PUR V I S F A R M R D BERNARDPURVI S R DBRAD Y FARMRDBEULAHCHURCHRD CHARLIEGARNERRDCED ARCREEKLN CAVI NESS T OWNRDNHOWARDMILLRDBERN A R D P UR VIS R D GIBSON R D (S1002) (S2936)(S2873)(S2880) (S2874)(S2877)(S 2 887)(S2879 )(S2876)(S2877) (S100 2)(S2875)(S 2886)(8900)(7900)(6682)(8737)(7800)(5000) (6733)(6912)(8800)(8888) (5800) (8 4 0 0 ) (5273) (677 0)(7600)(8200)(6515) (5222)(6 5 00 )(5500)(7602)(7100)(6900)(7 600 )(7194)(6400) (8300) (8500) (8 4 00 )(7181)(7700)(7400)(7200)(7945)(5375)(7771)(7804)(6500)BENNETTRD R I VE RSIDERDHOWARDMILLRDN U B Y P U R V I S R D WADDELLS FERRY RD SEARCYRDSE A RC YRDEXT DUSTY TRAIL RDCHEEK PURVIS TRLCAVINESSRDWADDELLSFERRYRDEXT F L ATCREEKRDPLEASANTGROVECHURCHRDSANDERS RD DEWITTCT RYLNJABOHUSSEYRD S H O R T C U T R D SIDECHURCHRDAN TIOCHCHU RC H R D C U R TIS P OWE R S R D HUSSEYCTRYTRLJABOHUSSEYRDEXT ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR A8 B8 A7 B7 A8 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Seco n d C r e e k SandBra n c h Laniers CreekSouthForkSecondCreek TwomileBranch JIMELLIOTT RD SKEEN RDNC HWY 49CRANFORDRD HANDY R D E NC H W Y 4 7 WHITSKEENRDPIEDMONTSCHOOLRD(N 49S)(N 49S)(S1102)( S 1 3 0 4) (N 4 7 ) (S1212)(S1184)(S1181)(S1143)(S1185)(S 1 177) (S1178) (S1183) (S 1 1 8 2 ) (S1103)(S1262)( S 1181)(7145) (6800)(10100)(6100)(7800)(7800)(7400)(9000)(7900)(10000)(4745)(8600) (7165) (7300) (5980)(7600)(8000)(5300)(8400)(4 8 9 5 ) (6300)(4300)(7200)(8200)(9800)(4793)(6390)(670 5 )(9500)(6274) (69 1 4 )(6400)(7530)(8684) (74 00)(6100)(7900) (6400)(9100)(5700)(4900)(9400)(5 4 0 0 ) (6000) (6600) (5 50 0) (69 0 0 ) (6100 ) NCHWY47 VOLUNTEERRESCUERD NCHW Y49SJ OHNSONFARMRDIRISHMEADOWTRLHANDY RDJOELOFLINTRLCHARLES MTN RDLANIER HILL RD GRAVEL HILL RD N EW H O P E R D S A L E MC H URCH RDVALLEYFARMRD SAGEBRUSHTRLSCARLETO A K DRRO S C O E R D SURRATTCTRYRDHIGH PINECHURCHRD WILKESSNIDERRDHUNTRD BOMBAYSCHOOLRD C O NELSO N R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B1 C1 B2 A1 C2 A2 B1 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Robbins Bra n c h BettyMcGeesCreek SandBranch Second Creek Tw omile C re e kL a n iers Creek H a nnahs Creek NannyBranchMill C r e e k SilverR un CreekTwo mileBranchUw ha rr ie River (S1107)(S1 1 4 3 )(S1 1 8 6) (S1180) (S1177) (S117 4 )(S 1 1 81)(S1179)(S1176)(S1107)(S 1 1 4 3 )(S1175)(4793 ) (91 0 0 ) (4735 ) (42 0 0)(36 4 7)(5800)(5571) (4356 )(4572)(4400)(7420)(4900)(4800)(94 0 0 ) (9129)(3 8 1 5)(5113)(5980) (4100)(5400) (4523) (6500)(6043)(4000)(6100 )(5100)(3957)(5100)(850 0 )(5448)(5508)(7700)(4273)NEW HOPE RDLASSITERMILLRDHIGHPINECHURCHRD MOONLIGHT M E A D O W R D BRIG HT STARLN LA N I ER HILLRD SA NDALW OOD DR WIL LOWGR O VET R LBURRELL ALLEN RDOLD U W H ARRIE RD THOR N BUR G FARM TRLHUNT RD P E B BLE R DGWA Y NICKME ADO W RDLOUCRANFORDRDBLACK MTNRD OAK GROVE CHURCH RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B2 C2 B1 B3 A2 C1 A3A1 C3c B2 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet BettyMcGeesCreekR eedyCreekNorthProngHannahsCreekHannahsCreek WestFork L ittle R iverSouth P r o ngHannahs Cr e e k SouthProngLittleRiverSilverRunCreek R obb insB ra n ch(S1 1 12 )(S1143)(S1143)(S1248) (S1113) (1845)(5100)(5413)(5000)(502 4)(2310)(3481)(4842)(239 9)(2500)(5360)(4300)(4437)(3274)(5208)(2100)(4493)(2400) (1900)(4800)(3300) (1700) (1900)(4600)(2700) (3200)(3571)MEADO W L A N D S D R PISGAHCOVEREDBRIDGERDLANIERRDHIGH PINE CHURCH RDM TLEBAN ONRD FORESTHILLSDR STRIEBYCHURCH RDEXTRID G EBACKRDPIS G AHCHURCHRD HONEYLOCUS T RD R H DR CED AR ROCKMTNRD FIDDLER S CREEKRD V ONCAN N O N F A R M RD PANTHERMTNRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B3B2 A3 B4 C2 A2 A4 C3c C4cC3d B3 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Bell BranchReedyCreek Reed CreekLittleRiver SouthPron g Little River R ockyCreekB ig Bran ch(S1113)(S2963)(S1215) (S2985) (S1239)(S1114)(N159) (S2964) (S 2 8 4 3 )(S1121)(R 73/ 7 4 )(S 1136)(N134)(S1132)( S 1256 ) ( U 2 2 0 A L T )(S1121)(S1133)(S11 43) ( S1114 )(N 134)(I73/74) (5 1 4 3 )(1160)(250)(3674)(1 7 0 0 )(3274)(3710)(6200)(4058)(1758) (2400) (1535)(4700)(259)(700)(3547)(3594)(56 0 0 ) (5 0 0 0 )(4138)(275)(1 575)(3226)(100) (3620) (308) (1108)(157)(4800)(4842)(4200)(800) (2100)(3800)(4800)(300)(164) (364) (130 0)(3420)(500) (1500)(4045)(1409)(3750)(2 9 0 0 )(3900)(4054)(1400)(4500)(161 8) (54 0 0 )(5800)(3838)(1286)(3 94 2)(4682)(6000) (821) (5150) (1900) (288) (4007 ) (2535) (0) (502)(3000)(1 2 9 1 )(3012)(32 0 0 )(2600)(1845)(902)(1437) (3610) (3500 )(4905)(4 4 4 1 )(4200)(39 4 6 ) (3 9 5 7 )(3710)(4535)(3 7 00)(2500)(3400)( 5 000)(3000)(4000)(4027)(3993)(3749)(4030)(3742)FOUST DR H APPY H OLLO W R D SAN D T R A P L N NASSAU TRLU S HW Y 2 2 0 S BENSON FOX DRFOGGYMTNRDGREENVIEWDRMONTEREY RDEDNA S T MIDWAYACRESRD EAST DRCOPPLES RD EXT NEWHOPECHURCHRDCE D A R R O C K M TN R D H IGHPINECHURCHRDZOOPKW YRIVER CTMEADOWLANDSDR PISGAH CHURCHRD HO WARDAUMANRD FOX DRNCHWY134MARTIN HILL AVE RIVERESTATESDRSPANISH LN RAY DR M OUNTAINCREEKRDLEWIS CTRY DR VANCROFT STCOUNTRYSIDEACRESDR BRANTLEY DR HO W ARD A UM AN RD EXT LISBON RD FOXBURROW R D BUCKFOR D R DPISGAHCOVEREDBRIDGERD QUAILROOSTDRFORESTHILLSDR MER E D IT H C T R Y R D DRUM ST S TOUTFARMRD ROSEA VEMONTCLAIRCT RIVERRUN DR RICE D RFRANKLAMB DRHONEY LOCUSTR D WALNUT DR OAKTRE E RDHICKORY DR BOYLES DR RAINBOW LOOPCLOVERF I ELD R D F U L T O N RDWHITAKERRDWINDRIVERRD INTERSTATE HWY 73/74WILLIAMSFARMRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B4B3 A4A3 C5cC4c B5c B5a C3d B4b A5j C4t A5f C4s B4 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Big B r a nchRe e d Creek (S2920)(S1215)(S29 63) (S2985) (S1217) (S1207) (S28 4 2 ) (S1257) (S1247) (S1256)(S1216) (S 2 8 4 3 ) (U 2 2 0 A L T ) (S2964) (S2962) (N 15 9 )(S1121)( R 7 3 / 7 4 )(S2914)(S1 1 3 6 )(S1132)(N 134)(S125 6 ) (U 2 2 0 A L T ) (I7 3/74)(N 134)(I73/74)(500)(5 1 4 3 ) (4 0 2 7 )(3674)(3710)(6200) (3 7 0 0 ) ( 5 1 0 0 )(3654)(800)(259)(3035)(700)(3547)(3594)(5 0 0 0 )(900) (275)(194)(3750)(3226)(164)(364)(157) (308)(4900)(4800)(800)(3800)(300)(3420)(100) (500) (902)(5800)(2900)(3155)(3100)(54 0 0 ) (288) (2535) (600 0 ) (5 1 5 0) (0)(3400)(3000)(3012)(3 2 0 0 )(3610 )(2600)(3500 ) (4 4 4 1 ) (3946) ( 3 9 5 7 )(3400)(3749)(3742)GREENVIEW DRUSHWY220SEAST DRMONTEREY RDNCHWY134INTERSTATE HWY 73/74NEWHOPECHURCHRDZOOPKWY WILLIA MS FAR MR DFOX DRMARTIN HILL AVECOUNTRYSIDE CTSPANISH LN LEW IS CTRY DR VANCROFT STCOUNTRYSIDEACRESDR BRANTLEY DR LISBON RD NASSAU T RLMIDWAY ACRESRDEDNA ST FOGGYMTNRD M E R E DITHC TR Y R D DRUM ST S T OUTFARMRD ROSE AVE MONTCLAIRCTH A P P Y H O L L O W R D FULTONRDWALNUT DR HICKORY DR RAINBOW LOOPW HITAKERRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B4 B4b B5a C4c C5c B5c C4tC4s B4b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet SouthProngRichlandCreekBatchelor Creek Panther Creek F ork Creek Little Creek AsheboroAsheboro Asheboro (U 2 2 0 A L T )(S2831)(S1129)(S2847)(S2837)(S2849)(S2853)(S28 3 4 )(S2846)(S2910)(S2845) (S2843)(S2 835)(S2845)(S2843)(S2 8 4 9 ) (6 8 0 0 )(4628)(3200)(7 1 0 0 ) (6100)(7300)(170 0 )(4880)(4900)(4500)(1 3 0 0 )(4600)(4300)(600) (1000)(7 2 0 0 )(4909)(4319)(5312)(2854)(3800)(1002)(3100)(460 0) (5000) (4 1 0 0 )(4500)(4700)(7400) (100)(4900) (408 8) (1500)(5500)(4700)(6400)(5600) (3 6 0 0 ) US H W Y 2 2 0 S FAIRVIEW FARMRDOLD C O X R D OSBORNMILLRD OLDNCHWY13 CLYD E K I N G R D PANTHER CREEK RD SEAGROVE PLANK RDNEEDH AMSTRLRICHLAND P ARK DR ROSS HARRISRD LOWDERMILKRDANGELFIRE TRLRID G E R DMORANDRLIONS REST RDTIGERFLOWER RD BACHELORCREEKRDARCHIENEWSOMRDOAKVIEWLNHA P P Y HOLLOWRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B6B5 A6 C5 A5 C5c C6c B5c B5a A4 B4 C6d B4b B6b A5j C4t A5f B5 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet South Pron g Ric hlandCreek Batchel or Cre ek Ki n g s C r e e k Asheboro (S120 9 ) (S2 96 1 ) (S1207) (S2964) (U 220ALT)(S2 8 35)(S2920) (S2962)(N 159)(S2837)(S 2 8 4 3 )(S2 939) (S2843)(S2836)(S2835) (5 7 13 )(5253)(3 4 0 4)(3500)(5900 ) (54 0 0 ) (400) (15 7 ) (3 8 0 0 ) ( 3600 ) (164) ( 5800 ) (288)(100)(5600)(1500)(586) (5600)(1 3 0 0 )(5800)(3700) (200) (3 0 0 0 )(2850)(2535)(5359)(2700)(3 2 0 0) (3875)(2854)(3400) (1002) (4088)(3100)(3374) (600) U S H WY 2 2 0 SH AP P Y H OLLOW RD EASTDR ZOOPKWYEDNA ST W OO D MINT RD VANCROFT STFO UST DR RAY DRGENTRY ACRE S R DBENSON FOX DR WALNUT DR AUMAN CLAY RD ROSS HARRISRD GEFFEN LN MIDWAY ACRES RDHICKORY DRLIONS REST RDTIGERFLOWERRD ARCHIENEWSOMRDHAPPYLN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B5 B5a C5c B5c B4b C5 B4 C4t B5a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet KingsCreekForkCreekBatche lo r C reek(S2847)(S2916)(S 3 003) (S1131)(U220ALT)(S1129) (U 2 2 0 A L T )(S2845)(S2846)(S1130)(S2910) (S 2 8 4 3 ) (S 2 8 4 5 )(I73/74)(59 0 0 ) (6381 ) ( 3 700 ) (6700) (200) (7 1 0 0 ) (5000) (6398)(7300)(6067 ) (4900)(250)( 5 953 )(4900)(4300)(6468) (7 2 0 0 )(6200)(100)(6 8 0 0 )(6400)(4500)(100) (4 0 8 8 ) (7400)(4030)(4027)US HWY 220 SGEN T R Y A CR E S RD CLYDEKINGRD BOBBY MORAN DR BULLINS LN OLDNCHW Y13COPPL ESRDEXT BENSON FOX DR SEAGROVE PLANK RDRICHLAND PARK DRLOW DERMILKRDLASSITER LN COPPLES RD EMMAN UE L C H U R C H R D JOE FARLOW RD SCOTTFARMRDOAK VIEW LN HAPPYHOLL OWRDINTERSTATE HWY 73/74 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B5 B5cB4 B5a A4 A5 B4b A5fA5a B5c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet RichlandCreek Panther Creek BatchelorCreek LittleCree k For k C r e e k RichardsonCreek (S2907)(S2900)(S3145)(S2906)(S2849)(S2 8 4 3 ) (S2904) (S2 8 9 9 )(S2905)(S 28 4 5 )(S2896)(S2903)(S1002) (S28 9 8 ) (S29 0 3 )(S2909)(S2 8 4 9 ) (S2902)(5600)(5764) (6000)(6208)(4000)(590 0 )(4900)(4600)(3660)(5 5 2 8 )(3200)(3100)(5500)(4166) (48 0 0 )(3500)(5600)(4400)(5200)(3300) (3500)(5100)(3700)(2900)(4399)(4900)(5900)(4600)(5700)(3800) (5000) (6100)(4300)(4700)(3 6 0 0 )(4818)OSBORNMILLRDPICKETTSMILLRDLITTLEBEANESTORERDCASSADYRD O LD N C H W Y 13LILLIANTRLFARMSTE A D RDFORKCREEKMILLRDGERTRUDELOOPRDBACHELORCREEKRDP I NE YRI DGE CHURC HR D CLYDE KINGRDO LD BACHELORCREEKRD OLD M O F FI TTRDWOODFERNRDLEACHMEADOWRD PLEASANTHILLRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B6 B7 A6 B5 C7 A7 C5 A5 C6c C6d B6b B6 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Richland C r e e k BatchelorCreek (S2900)(S2898) (S3145) ( S 290 7 )(S2906)(S2903)(S2899)(S2904)(S2905)(S2900)(S2903)(S2909)(5600)(4000)(4672)(4818)(6000)(5500)(5900)(6 1 0 0 )(5000)(4900)(48 0 0 ) (3100)(2900)(5700)(4166) (3500)(5200)(3300)(2900 )(5100)(4399)(4600)(4300) OSBORNMILLRD LITTLEBEANESTORERDGE RTR UDE LOOPRDEXT PLEASANT HILL RDFARMSTEADRD CASSADYRD PIN E Y R IDGE CHURCH RD GERTRUDELOOPRD OL D M O F F I T T R D OLDBACHELORCREEKRD L E A C H M E A D O W RD WOODFERN RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B6 B7 B6b C6d C7C6c B6b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet De ep River TibbsRun Bru sh Creek Batche l o r C r e e k RichlandCreek (S2888)(S2873)(S2 887)(S2900)(S2 8 8 7 ) (S1002)(S1003)(S 2 8 7 3) (S2899)(S2896)(S1003)(S2890) (S2895) (S2891)(S2889)(6485)(6200)(5100) (500 0 )(5813)(5300)(5606 ) (5764)(6600)(5703 )(4399)(4100) (5 700)(3660)(4385)(5900)(5528) (5868 )(66 9 0 )(4400)(5203)(41 0 0 )(5900)(5 6 0 0 )(7000)(4000)(6700)(6709)(5500)( 5 7 0 0 ) (3500)(6100)(6188)(4400)(6387)(4300)(5000)(3900)(4251)(5200)(5391)(5800)(5300)(4708)(7205)(5978)(4500) (4400) (4300)RIVERSIDE RDANTI OC HC H URCHRDSUGG TEAGUE RDSEARCY RD F ARMSTEADR DERECTRDSEARCYRDEX TPICKETTSMILLRDLITTLEBEANESTORERDMACCRISCOERDLILLIANTRLSADIERD MO F F I T T M I L L R D A S B ILLLN HAYES FARM RDRO BER TMACONRD OLDMOFFITTRD MARLEYFARMRDP O LLYFIELDRD JOELJESSUPRD BE N TR ID G E R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B7 C7 B8 A7 C8 B6 A8A6 C6d B6b B7 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Rich lan d C r eek B ru sh C reek De e p R i v e r Flat C re ek BENNETT SILER CITY RDLANE ST LEE STCHATHAM STRANDOLPH STBUFFALO ST E E CARTHAGE ST W RALEIGH ST BUFFALOSTW LIBERTYSTE LEWIS BROWN RD N C 2 2/4 2 H WY VANCESTHIGHFORTYRD RONNIE BROWNRD GLO V E R S C H U RC H RD VA U G HNBRAYRD PECAN TRLHICKSL N PEACHTREE RD(S2693) (S2648) (S2876 ) (N 2 2 / 4 2 )(S2886)(S2893)(S2647)(S2883)(N 2 2 / 4 2 )(S289 2) (S 2 6 4 5 )(S2643)(S2646)(S2882) (S2884 ) (S2881) (S2885) (0)(7200)( 8 7 2 7 )(6692)(5300 )(7 8 0 0 ) (6200) (8 6 0 0 ) (6 7 0 0 )(5700)(5200)(7059)(6900)(71 0 0) (76 0 0 ) (6300) (5698) (6798) (5 9 0 0 )(7 3 0 0 ) (8 3 0 0)(6800) (6 2 0 0 )(4200)(6500)(4200)(5400)(5300)(5500) (7900)(5900)(6000)(5000)(6700)(6600)(6400)(6100)(6300)FLATCREEKRDBRUSH CREEK RDNCHWY2242 SEAR CYRDEXT ROBERTMACON R D CARLBRADYRDJOE BR A NS ON RD JOSERD PLEASANTGROVECHURCHRDLOGCABINRDSAMLEONARDR D CHILTON RD BILLY BRADYRD FLIPPINRD CLIPWOOD RD L E WI S B R O WNR D COUNTRYFARMRDCLINTCA VINESSRD COUNTRYLO OP RD CARL COX RD J IM MYCOXR D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B8 C8 B7 A8 C7 A7 B8 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Twomile Branch Tom s Cree k S ou thF orkSecond CreekSou thForkJackson C reekSec ond Creek FARMER RD EBELCHURCH RD CANAANCHU R C HRDWA R D R D BIGCOUNTRY LN NNANCERDM &HDRN AN C E R D JOHNSONRDSEXTON RDE N C HWY 4 7 (S1307)(N 49S)(S1303)(S1358)(S1306)(S1302)(S1 0 0 1 ) (S1 3 0 4 )(S1301)(S1001)(2 5 2 4 ) (7072)(2400)(65 0 0 ) (4 8 9 5 )(3900)(7200)(7000)(6610) (5942)(7200)(7400)(6200)(6900) (6420)(3792)(6729)(4000)(6400)(6815)(4793)(53 0 0 ) (6 6 0 0 ) (6100) (73 0 0 ) (7000 ) (6100) (5400) (42 1 5 )(3000)(4300)(7290)CAN AAN C HURCH R DPIERCE MEADOW RDBESCHER CHAPEL RDFARMERDENTONRD SAL E MC HURCHRDIRISHMEADOWTRLSANDSTONE TRLFARMERDENTONRDNC HWY 49 SBRANTLEYGORDONRD M ARTHADROLD TREERDHIDDENSPRINGSRD RICHEYRDSAGEBRUSH TRLGARNERLNVALLEYFARMRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C1 C2 B1 D1 B2 D2 C1 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Toms C ree k Twom ile B ra n c h S e c ondCreek JacksonCre ekBettyMcGee sCreekUwharrieRi v e r Taylors CreekCar aw ay Creek(S1369)(S1371)(N 49S)(S1375)(S1169)( S 1 3 1 4 ) (S1170) (S1 1 6 6)(S1305)(S1303)(S1175)(S1 1 7 1 )(S1312)(S1173)(S1260) (S 1 1 7 4 )(S1168)(S 1 1 7 2 ) (N 49S) (S 1 001) (S1193)(S1107)(S1193)(5219) (52 0 0 ) (4500)(4213)(6400)(3004)(6500)(6299)(6 20 0 ) (5675) (5100)(3800)(5 0 96)(6600)(6800)(5900)(7000)(7200)(5912)(2900)(4297) (44 9 3 ) (5000) (3500) ( 43 5 6 ) (24 0 7 ) (5 7 9 0) (3543)(4310)(5600)(5300)(5400 )(4273)(3900)(4000) (4300)(2403)(483 4 )(3600)(3900) (4 6 0 0 )(3000)(3100 )(4700) ( 4 000) (5300) (3405) (5293)(3647)(6100) NC HWY 49SFARMERCT BR A N TLEYG O R D ON RD OAKGROVECHURCHRDLARKDRDUNBARBRIDGERD WAYNICKMEADOWRD MECHANIC RDOLDNCHWY49FARMER DENTO N R D HIGHLANDSLNTROTTERRDHARRISFAMILYLN JACKSONC R E E K R D BIGCTRYDR F IREFIGHTERRD WI L L OWGROVET RL FA L L I N G O A K R D OLDPLACERDLASSITERMILLRDGALLIMOREDAIRY RDTOMSCREEKRDDUNBARBRID GE RD BINGHAMLOFLINRDGRA N G E H ALL R DCROSSCREEKRDSWEETWATERTRL LASSITER MILL RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C2C1 B2 D2 B1 B3 D1 C3c C3a D3c C2 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Taylors Cree kAsheboro (S1 3 7 9)(S1170)(S1167)(S1380) (S1378)(S1399)(S1368)(N 49S)(S1107)(S1107)(N 49S) (S1163)(2044)(1916)(2530)(1875)(2800)(2400)(1700)(1847)(4100 ) (1941)(2600) (2624 )(1932)(2300) (3 2 0 0)(3000)(3041) (3500)(2500)(2700) (4200)(1900)(2214)(3434) (17 0 2 )(2400)(3 7 0 0 )(4000)(2700)(1600)(2900) (34 7 0 ) STONE BRI D G E R D TAYL OR S CREEKDRGRADY WILLIAMS DRWOODL ANECTOAK HOLLOW DR STABLEBROOK RDMARIGOLDLNYESTEROAKSCTTOTHILLFARMRD SHAW ST GRA NI T E R D G LASSITERMILLRDCREEKRIDGE DR MECHANIC RD BESSIEBELLRDSCIE NCE HILL R D TURNINGOAKSTRLNC HWY 49 S ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C2 C3a C3c D3c C3b D2 C3d D3d C3a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet B ettyMcGees Creek Taylors C r e e k Asheboro Asheboro (S1251)(S3304) (S1268)(S1373)(S1 1 4 2 )(S1261)(S1367 )(N 49S)(N 49S) (S1197 )(S1163)(S1199)(S1231)(S 1 1 6 3)(S1162)(2352)(2100)(1789)(19 0 0 )(2313)(2270) (1 5 5 9 ) (1800) (2 7 3 0 ) (1700) (2300)(2100)(1400)(2624)(1529)(1385)(1900) ( 22 00)(1412)( 2 6 4 0)(1460)(2429)(1989)(1749) (1500)(2900) (2600)(2400)(1200)( 1 5 0 0 )(1700) (1 4 2 1 )(2639)(2044)(2 0 0 0 ) (2200) (2 0 0 0 )(2532)(2402)(2095)(2139)(1300)(16 0 0 )(2225)S TONEBRIDGE RD SYLVAN WOOD S D R FARMW O O D L N SCALEYBARKLNFOX RIDGE R D DANNY BELL RDWIST E R I A L NBETTYMCGEE DRMCDANIELDRLAURELWOOD PL HO P E WELL F RIE N D S RD C R A V E N LN STABLEBROOKRD BRANCHWOOD DRDEERHO R N CTLESLIESTWOOD B L U F F T R L L U CYLNRICHARDS CIR HANN A H D R LUTHER C T R YL N TOTHILLFARMRDI DLEBROOKTRLNC HWY 4 9 S OAK HOLLOW DR UNI ONCHURCHRDBADIN LN A L L EN C T PILOTSVIEWRD DOUL MTN RDWALKER RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C3bC3a C3d D3d C3c C4c D3c C4i D4c C4e C3b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet B et ty M cG eesCreekAsheboro Asheboro Asheboro Asheboro Asheboro (S1163) ( S 1 1 0 7 ) (3 4 6 4 )(2044)(2377)(2800)(2500)(2 6 4 3 )(2562) (2 458)(3274) (2300) (3190)(2530)(2400)(34 7 0 )(3335)(3647)(3213) (3 0 00 ) TOT HILL FA R MR D STONEBRIDGERDDEERRIDGERDTOT HILL T R L HOMEPLACE TRL HIGHME AD OWDRJOH NSRIDGEDRMAPLEHILLCTSTABLE BROOK RDLASSITER MILL RDWHALETAILRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C2 B3 C3c C3a C3d B2 C3b C3c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Be tt yM cG e esCreekSouth P ron g Lit tleRiver ScottBranchTalbottsBranchAsheboro (S1270)(S 1 2 3 4 )(S1199)(S1233)(S1235)(S 1 1 4 2 )(S1162)(S1163)(2044)(25 8 4 )(2100) (1578) (2500) (1570 )(2800)( 1 7 0 3 ) (3152) (1 5 5 5 )(2400)(2117) (2300)(2900)(3190)(2643)(2 2 0 0 ) (1900 )(2139)(2700)(2532)(2527)(1900)(2400) (23 0 0 ) (242 9 )(2600)(2225)(2955)(2427)(1600)STONEBRI DGERDSTO N E W A L L C T WIS T E R I A L N H O PE W ELLFRIENDSRD SUNBURST R DHOMEPLACE TRL BETTY MCGEE DRWILLIAM DR TOTHILLTRLSTONEBRIDG E R DTOT HI LL FARM R D WES T WOODAVEHIGHMEADOWDRDOUL MTN RDSCOTT MTN RDSCOTT MTN R D EXTDANNYBELLRDFOXRID G E RD G R AY OWLRDHIGHMEADOWDR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR B3 C3dC3c C4c C3b B4 C3a C4i C3d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Littl e R i v e r S o uthProngLitt le Ri verScottBranchBellBranch(S1234) (S1235) (S1250) (S1138) (S1220)(S1144)( S 1 1 4 2) ( S 1141)(S 1 1 4 0 )(S1114)(S1143)(S1142)(2381)(2100) (2007) (1578) (1600)(1555) (157 0 )(1462)(2 2 0 0 )(2400)(2000)(2300)(1300) (16 4 2 ) (1900)(2633)(1900 ) (1696)(2300)(999)(2800)(2500)(948) (202 8 )(2700)(1100)(2600)(1703) (1849)(1875)(1 7 7 5 )(2400)(3000)(14 0 0 )(1900)(2867)(2500)(800)GRAY OWL RD HOPEWELLFRIENDSRD MACKRDBAILE Y R D SUNBURST R D ASHBROOK VIEW LN WE STWOODAVESCOTT MTN RD FOREST OAKS DR STALLI ON TRLSPRING VILLAGE DR OAKDALE DR DAWSON MILLER RD PISGAHCOVEREDBRIDGERDSPRING DR PARKERDR CALLIC U T T HENLEYRD NATHANS TRLWESTGATE RDPEARLLNHIGHPINECHURCHRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4c B4 C3d B3 C3b C4i B4b C4j C4s C4k C4o C4c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Taylors Creek(N 49S)(R 6 4 ) (S1226) (S1227)(S1236)(S1228 ) (S1162)(S1214)(S1210)(S1242) (S1160) (S1249) (U 6 4B Y P )(S1160)(S1 2 6 4 )(1700) (1700) (1180 ) (1272 ) (1383 ) (1500 )(1529)(700)( 0)(1337)(1250)(1400)(1032 )(1800)(912)(1100)(1208) (120 0 ) (1192) ( 34 2 0 ) ( 3 4 1 5 )(1317)(1362)(1300)NC HWY 4 9 S ASHWORTH VIEW DR SCALEYBARK LN BRILES DRSPANISH DRLESLIESTUS HW Y 6 4 JAECO CAUDILL DRCORTEZ RDBONITA LNBRANCHWOODDRWALKER CIRDANNY B E L L R DSHERIDAN DRBONITA STBILLY WALKER RDMURIELLN A UT UMN W O O D LN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4e C3b C4i C4f D4c C4j D4rD3d C4e Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Lit tl e River(S1238)(S1200)(S1252)(S 1 2 6 9 )(S120 5 ) (S1206) (S1201) (S1237) (S1258) (S1203)(S1144)(U 6 4 B YP )(741)(1193)(700)(857)(900)(850)(1300)(800) (693) (1131) (1000) (900) (1002) (1100) (900)(1400)(584)(1000)(3 4 2 0 ) ( 34 1 5 )SOURWOOD DRLUDLUM LNOAKWOOD ACRE S R D ASHWORTH VIEW DRJAECO CAUDILL DRSOUTHMONT HEIGHTS AVEMACK RDCAROWOOD D R FAIR W O O D T R L MONTLEYVIEWDR CANNON HEIGHTS DR REDWOOD DR GREENLEAF ACR E S D R SKYCREST CTRY RDUS HW Y 6 4 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4f C4j D4r C4gC4e C4i C4k D4sD4c C4f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet L it tle R iver Asheboro Asheboro Asheboro (S1274)(S1150)(S 1 1 9 1)(S1230)(S12 0 5 )(I73/74)(R 73/74)(S1202)(S1203)(S1274)(S1149) (S 1 2 4 4 )(I73/74)(900)(800)(0)(1000)(720) (750)(527)(615) (693)(541)(3278)(3271)(584) (1000)(396)(967)(1200)(100)(300)(700)(3417)(3416)SOUTHMONT DRMCDOWELL RD OLDSTATEHWYI ND UST RIAL P ARKAVEROYALSHIRE LNARMADILLO DRSKYCREST CTRY RDFAIR W O O D T R L VETERANSLOOPRD INTERSTATEHWY73/74RIS ING V IEW WAYDOT DRNEWCENT U R Y D R ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4gC4f C4k D4s C4h C4lC4j D4tD4r C4g Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet VestalCreekAsheboro Asheboro Asheboro Asheboro (S2814)(U 220BUS)(S2928)(S2952)(S2948)(S2820)(S2949)(S1274)(S2817) (S2913) (S2819)(S2818)(S2816)(S2951) (S2950)(U 220BUS )(S1148)(S2815)(500)(1200)(400)(2500)(967)(2900)(1100)(693) (3200) (500)(1000)(741)(600)(236) (600) (200)(800)(300) (400) (507)(898)(900)(1000)(893)(100)(3000)(2700)(300)(3248)(1106)(605)(1 0 0 )APRIL LNMCDERMOTT STJIM LEWALLEN R D LINDALE DRDOT DR AUMAN AVE HAWTHORNE DR LEGEND DR S FAYETTEVILLE STSOUTHMONT DRUS HWY 220 BUS SHAYES DRCLEARVIEW DR MO RTONAVEWOODCREST DRCROOMCREST RD BRAY BLVDCRESTVIEWCHURCHRDANTHONY CTHOWARD AVEOLDSTATEHWYMCDOWELL RD KIMBERLY DR O A K H U R S T R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4h C4l D4t C4g C5e C5iC4k D4s D5q C4h Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet (S1144)(S1245)(S1222) (S1254)(S1214)(S1246)(S1223) (S116 2 )(1529)(2200)(1700)(2300)(1152)(1900)(1848)(1100)(1155)(1728)(1300) (119 5)(1337)(2225)(1700)(1200)(1400) (1 5 2 6 ) (180 0 ) THOROUGHBREDRDLESLIE STMACK RDCRAVEN LN STALLION TRLHORSECANYONRDPALOMINODRARABIAN DRDANNY BELL RDBRILESDRAPPALO O SA TRL DANNY B E L L R D SYLVANWOODSDR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4i C4c C3b C4j C4e C4f C3d C4i Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet LittleR iv e r(S1222)(S1144)(S1 2 5 4 )(S1246)(S1211)(S 1 1 4 1 ) (S1162)(S1144)(S1145) (U 64BYP)(2149)(11 5 2 )(1700)(2300)(18 49) (2046) (1100) (1 8 0 0 )(1200)(741)(2200)(1 7 18)(1618)(1 7 0 6 ) (834)(1400)(1900)(2300) (34 15) (3 42 0) MACK RD ARABIAN DR THOROUGHBREDRD STALLION TRLCALLICUTTHENLEYRD SOUTHMONTSCHOOLRDELEANOR ANNE LNVALLEYGROVERDLUDLUM LN S TARGAZERDRDANNY B EL L R D USHWY64 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4j C4c C4i C4f C4k C4gC4e C4o C4j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet L ittleRiver(S2841)(I73/74)(S1274)(U 220BUS)(S1273)(S1202)(U64BYP) (S1145 ) (U 64BYP) (S1147) (S1146)(I73/74)(R73/74)(R 64 ) (S1145)(4400)(3417) (3416)(4200)(1 685)(200)(1270)(2000) (3499)(1200)(3496)(3530)(3900)(3442) (3441)(3415)(3523)(1500)(344 6 )(4214)(1400)(1379) (3420)(1615)(3443)(3440) (3445 ) (3439) (2046) (3444)(3509)(264)(3508)(3472) (100) (3471 )(1000)(0) (1600)US HWY 220 BUS SINTERSTATE HWY 73/74 DRAGO NF LYLN LEOCRANFORDRD VIRGIL HILL RD BILLYCRANFORDLNSOUTHMO N T SCH O O L R D SOUTHMONTDRUS HWY 64 US HWY 64 ROBERT WAY RISINGVIEWWAYGOODLUCKRDBELL SIMMONS RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4k C4lC4j C4g C4o C4f C4c C4h C4p C4k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet VestalCreek Asheboro (S114 5 ) (S2946) (S 1148 ) (S2943) (S2983)(S2987)(U 220BUS)(S2945)(S2930)(S1147)(S2944)(S1146) (S2821)(S2926)(S3009)(S2984)(S2977)(S2982)(U 220BUS)(S2820) (U 6 4 B Y P ) (264) (100)(3248)(3600)(307)(3700)(1661)(1270)(3402)(1600)(4214)(400)(3800)(1470)(1685)(500)(1705)(248)(3500)(1400)(1547)(200) (365) (100)(1791)(150)(1691)(400)(600)(1400)(188 4 )(1600)(50 2 )(1500)(383)(3900)(100) (344 6 ) (344 5 ) VIRGILHILL RD LEOCRANFORDRD SOUTH M O N T S C H O O L R D US HWY 220 BUS SMCCRANFORD RD SLATE AVE MANORVIEW RDBILLYCRANFORDLNSP R I N G D A L E D R CEDARGROVERDGREEN MTN DRROCWOODDR CEDAR GROVE DROLD STA TE HWY PAIGE CT DRAGONFLY LNCRESTVIEW CHURC H R D CEDAR GROVE DR EXTPASTUREVIEWRDWOODALE DRBELL SIMMONS RD HILLARY CT IVEYDALE D R OAKHURST RD US H W Y 6 4 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4l C5iC4k C4p C4h C5c C4g C5e C4o C4l Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet (U 220ALT)(S2996) (S1139) (S2840)(S2841)(S1219) (S 2 8 3 9 )(U 220BUS)(S1114)(U 220BUS)(I73/74)(4214)(4640)(4800)(4600)( 3037 )(4900)(20 0 ) (1875) (19 0 0 )(4645)(1696)(2000)(3 3 5 6 )(4400)(2100)(1615)(5000)(2300) (100)(3530)(3523)USHWY220BUSSDONNA RD DINAH RD EXT S T A L E Y S FA RM R D BONDURANTRD NATHANS TRL PEARLLN PAINTER RD ASHBROOKVIEW LN L EOCRANFORDRDDINAH RD PISGAH CO V E R E D B R I D G E R D OLDDEPOTDRGOOD LUCK RDCOY STELLA TRL INTERSTATE HWY 73/74INTERSTATE HWY 73/74² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4o C4c C4s C4k C4p C4lC4j C4t C4o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Nor th ProngRichlandCre e k(FarlowsLake)(S3010)(S2 9 88)(S2840)(S2987)(S2981) (S2996)(S2840)(S2839 ) (S284 1 ) (S2 8 3 9 ) (510) ( 3 3 5 6 )(1823)(518)(2948)(1556)(2141) (300)(1705)(8 1 3 )(2091)(600) (200)(691)(3037)(100)(213 0 ) (220)TALL PINE ST OLD DEPOT DR STAL EYS FARM RDPASTUREVIEWRDS TALEY S FARM RD FOOTHILLSDRT O P A Z DR ALEXANDERCT PAINTER RD KILOWATT DRULAHCT DONNA RD LEO CRANFORD RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4p C5c C4l C4t C4o C5i C4s C4k C4p Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Big B ranch (S1140) (S 1 2 4 0 ) (U 220A LT )(S1114)(R 73/74) (N 1 3 4) (S1138) (I7 3 / 7 4 )(U 220BUS)(I 7 3 / 7 4 ) (S113 8 )(122)(100)(5525)(200)(5500)(100)(138)(210 0) (2028)(2337)(5000)(2231)(300)(2300) (4200 )(2600)(0) (2600) (687)(2302)(3 6 7 8 ) (3 6 7 3 )(5220)( 3 5 2 3)(3 5 3 0) ( 3 6 6 )DAWSONMI LLERRDUS HWY 220 SUS HWY 220 BUS SPINEWOOD RD LESTER RUSSELL DR BAILEY R D SHADYWILLIAMSDRCOLE MTN RDR O L A N D L NPISGAHCOVEREDBRIDGERD NC HWY 134 IN T E R S T A T E HW Y 7 3 / 7 4 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4s C4c B4b C4t C4o B4 C4p C4s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet NorthProng Ri c h la n d C reek(FarlowsLake)(U220BUS)(S2965) (S2962) (N134)(S2963)(R73/74) (I 7 3 / 7 4 )(S2842)(U 220A LT) (S2839) (S2958)(700)(4 3 7 1 ) (410 0 )(5220)(699)(557) (3 5 3 ) (4 4 4 1 ) (3 6 7 8 )(500)(396)(3 6 7 3 )(2600)(400) ( 7 4 0) (2535) (2600 )(500)(3 7 4 9 )(2597)(2496)(587)( 0 ) (364 ) (3 7 4 2 ) (100)(550)(42 0 0) (3037) (200)GREENVIEW DRU S HW Y 2 2 0 S B R A S S I E C T NASSAU TRLUSHWY220BUSSPIN E W O O D R D BIRDIEPL IN T E R S T A T E HW Y 7 3 / 7 4 LILAC LNP IN E W O O D F O R E S T D R HICKORY DR N C HWY 134SANDTRAP LNWEDGEPLNAS S A U T R L LESTERRUSSELLDR STALEYS FARM RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C4t C5c B4b C4s C4p B5a C4o C4t Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet RichlandCreek PantherCr eekSouthProngRichlandCreekNorthProngRichlandCreek(FarlowsLake)Tantraug h Branch SquirrelCreekVestalCreek Asheboro Asheboro Asheboro (S2997)(S3011)(S9999)(S2993) (S2726) (R64)(S284 5 )(S2830)(S2931)(S2828)(N 1 5 9 ) (N 4 2 S )(S 2 8 3 3 )(N 159)(S2832)(N 42S )(S2824)(S2 8 3 4 )(S3006)(S2954)(N 159EXT)(S2831)(S28 3 7)(S2660)(S9998)(S2834)(U64BYP)(3800)(2516)(1130) (1850)(1640) (280 0 ) (990)(1458)(4300)(2 3 0 0 )(1504)(3526) (3571 ) (1403)(5000)(1650)(1100)(1450) (380 6)(2544)(1937 )(2329)(3861 ) (16 8 6)(2206)(3617)(1400) (1600) (2840) (2947)(2400) (2100)(3100)(2900 )(1200)(4100)(1303)(3698 ) (130 0 ) ( 2 60 0)(127 6)(1300) (2400) (1252)(4600)(2040)(1500) (30 0 0 )(1000)(1925)(1377)(2600)(2529)(2723)(3300 ) (3 3 8 3 ) (2285) (1922) (1 9 0 0 ) (2400) (3 1 0 0 )(3444)(25 0 0) (170 0 )(4605)(1700)(3611) ( 1 4 2 0)(1385)(3935)(19 89)(3632)(0) (1800 )(2700)(2572) (3200)(1700)(2800)(2100)(2300)(3461)(3468)OLDCOXRDZOO PKWY AVANTIDRROLLS LN OLDHUMBLEMILLRDPORSCHEWAYFERRAR ID RINDEPENDENCE AVECORVETTEAVE DEER RUN LNZOOPKWYSUNB E A M C T WOO DHAV EN D R FREEDOMTRL NC HWY 42 S TWINCREEKRD PINE HILL RDSTALEY FAMILY PLH AYFIELD DRODATTRLBETHELFRIENDSRD EAGLEPAS SRDWILDLIFEWAYSO UTH W O O D DRLEE VALLE YRDSPOONSCHAPELRD LINNIECT FAIRVIEWFARM RDP A N T H E R C R EEK RD WILLOWDOWNSCT EAGL E OAKSLNO L D NC HW Y 13 TWINCRYSTAL T R L LED W E L L R D FAITHMEADOWSLN JONESCT RYTR LCO PPERHEAD RD B B TRL WA L DENRDTALMER WRIGHTRDMILESMOFFITTRD L ATHAMHARVELLRD WOODELLCTRY RD TIMBERW OLFTRL CANE MILL RDLEWISTHOMASRD LIONSRESTRDZOOCONNECTORUSHWY64² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C5 B6B5 C6cC5c C6a B5a D6cD5d C6d C6b B4b B6b D6d C5iC4l C5j C5f C4t C5 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet SouthProngR ich la ndCreekNorthProngRichlandCreek(FarlowsLake)Asheboro(S2962) (S 2 9 7 1 ) (S2 9 3 7 )(S 2 9 7 5 )(S2834)(S3006)(S2837)(N 159EXT)(N 159)(S2 9 5 4 ) (S2967 )(S9998)(S2839)(4600)( 21 0 1 )(676)(1800)(2200)(2535)(600)( 2 002 )(2329)(4400)(587)(5253)(586)(2000)(1900)(2600)(900) (748)(2300)(622)(5000)(24 0 0 ) (3935)(2700)(0)(4605)(1 9 89) (21 0 0 )(1700)(2130)ZOOPKW YRIDGECREST LNNORTH LAKE DR STALEYSFARMRDTAR HEEL TRLDEER RUN LNZOOPKWYHICKORY DR EAGLEPASSRDPINEWOOD FORESTDR GEFFEN LNFARLOWL A KE C T SOUTH LAK E D R LED W E L L R D MOUNTAIN LAUREL LNS O U T H C R EEK CT OLDCOXRDCOOPE R RD TIMBER W OLF TRL LIONS REST RDLEWIS THOMAS RDZOO CONNECTOR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C5 C5c B5a B5 C4l C5i B4b C5j C4t C4p C5c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet TantraughBranchVestalCreek Asheboro Asheboro Asheboro (U 64BYP)(S2820)(S2834)(S3011)(N 1 5 9 )(S2820)(2600)(3468)(3461) (2 7 0 0 )(600)(2300)(1200 ) (33 0 0 ) ( 6 3 6)(773)(3100)(800)(1300)(2 8 0 0 )(858)Z O O P K W Y US HWY 6 4CRESTVIEWCHURCHRDOLDCOXRD H ILLT O P CHURCHRDROCKCLI FF TER STALEYFAMILYPL² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C5e C5i C5fC4h D5q C4l C5j D4t D5r C5e Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Tantraugh Br anchVestalCreek Asheboro (S2824)(N159) (S2931) (S2 8 3 4 )(S2824)(U64BYP)(1100)(1251)(1400 ) (130 0 ) (1500) (33 0 0 ) (1200)(1303)(1252)(1000)(1385)(1420)(3468)(3461)PINE HILL RDOL D C O X R D LEE VALLEY RD BB TRL ZO O PK W Y EAGLEOAKSLNCOPPERHEAD RD WALDEN RDUSHWY64² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C5 C5f C5j D5r C5e C5i D5dD5q C5f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet NorthProng R ichla nd C re ek (F a rlo w s L a k e )T a n t rau gh B r a n c h (S2994) ( S28 3 9 )(S2984)(S2944)(S2972)(S 2 94 3)(S2973)(S2839)(S3007)(R 64)(U64BYP)(R 6 4 )(U 64BYP) (1070) (1377) (884)(901) (876)(600)(500)(1300)(1 4 5 0 ) (20 0 2 )(502)(1500)(1 7 69) (990)(726)(1525)(1826)(1504)(1902)(600 )(3459)(1680)(3445)(1 6 1 4 )(1530)(3468) (800) (0)(3446)(346 2 )(0)(3461) FREEDOM S T A T E S T INDEPENDENCE AVE FREEDOM TRL LIBERTY CIR NORTHLAKEDRROCWOODDR STALEYFAMILYPLSTALEYS FARM R D HILLARY CTLIBERTY CIR EXTSONORA DRSPRINGDALEDRN ORTHLAKEDRINDIANWELLSLOOPRIDGECREST LNREDWOLFLNUSHW Y64DUS T Y P A T H D R ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C5i C5c C4l C5j C5e C5fC4h C4p C5i Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet SouthProngRichlandCreekNorth P ron g R ich la ndC reek(Farlow s Lake) Tantra ug h Branch Ric hland Creek Asheboro (S2995) (S28 3 9 )(S2824)(S9999)(S2978)(S2990)(R 64 ) (S2989) (N 159)(S2976)(S2993) (S300 6 ) (S3002) (S2834) (S 9 9 9 8 ) ( S2834 )(2300)(3461) (1377) (1070)(3468) (1458) (1450) (1154) (1553 ) (3526 )(1420)(3571) (1403)(1650)(3 8 0 6 )(3861)(1724)(1 6 8 6 ) (0)(3617)(1200) (3935 ) (1600)(3300) (3698 ) (1300) (1385) (17 0 0 ) (1800 )OLD COX RDINDEPENDENCE AVE US HWY 6 4 STALEYS FARM RD ZOOPKWY PINE HILL RDTWIN CREEKRD WILDLIFEWAYNORTHPOINTEDRSO U T H W O O D D RAUTUMN LN WILLOWDOWNSCT FAITH M E A D O W S L N OLD COX RDZ O O C O N N E C T O R ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C5C5j C5c C5i C5fC5e C5j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Ri c h la ndC r e ek SquirrelCreek (S2832)(S2997)(S2845)(S2727) (S2726) (S26 0 6 )(S2614)(N 42 S )(S2614)(N 42S) (S2606) (S 2 6 6 0 )(2900)(2800)(2800)(2544) ( 3 6 2 1) (2713)(1937)(2500) (2840) (3000)(1909)(3207) (2400) (3 6 7 9 ) (2900 )(2 6 00) (3182) (2947) (2600) (4300) (3 3 8 3 )(3000)(3 9 6 0)(2400)(31 0 0 )(3300)(3611) (31 4 3 ) (2100) (2572)STREAM WATCH TRLNC H W Y 4 2 S WOODHAVE N D R VIRGINIA ACRES DR FAIRVIEW FARM RDCORDIE DR GRANTVILLELNHAYFIELD DRODATTRL BETH E L F R I E N D S R D OLDNCHWY13SQUIRRELCREEKRDDORIS ACRES STLINNIECT JANICE ACRES ST SPOONSCHAPELRD FAIRVIEWFARMRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C5 C6a C6c D6c C6b C6d D5d D6d C6a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet S a n d y R u n Tib b s Run(S2908)(S2614)( S 2 6 5 9 ) (N 42S)(S2656)( S2674 ) (4070 )(2740) (2764)(2687)(3000)(30 0 0 )(2400)(4635) (4900) (29 1 8 )(2106)(4300)(4523)(4300)(2777)ELBERTBRADY RD PIL OT MOUNTAI NRDEARLBROWNRDWAYNE RDMANESSCOBLEDRCL AYT ONTHOMASDRGRANTVILLELNNCHWY42SPILOT CTHINSHAW TOW N RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C7 C6bC6a C6d D6d D7 C6c D6c C6b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet RichlandCreek Panther C reekSquirrelC re e k (S2832)(S2831)(S2909 ) (S2832 ) (S2845) (S2 8 4 5 ) (3 300 )(2900)(3200)(3632)(4600)(2400)(3444)(3700)(4 1 0 0 ) (3000) (2 8 0 0 ) KEMP MILL R D FAIRVIEWFARMRDSTREAM WATCH TRLFAIRVIEWFARMRDFAIR VIE W FA R MRDOLDNCHWY13JONESCTRYT RL WOODFERN RDCANEMILLRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C5 C6c B6 C6a C6d B5 C6b B6b C6c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet RichlandCreek TibbsRun (S 2 6 5 9 )(S2845)(S2 9 1 1 ) (N42S) (N 42 S ) (S2908)(S2911)(S2903)(3463) (2 9 1 8 )(4200)(4300)(60 0 0 )(3460)(4200) (3 0 0 0)(3700)(3600)(4166)(6210 ) (3300) (401 7) (5 3 0 0 ) (4900) (3 500)(5 6 1 9 ) (3000 ) (3795)(3507)KEM P M I L L R D NC HWY42SHINSHAWTOWNRDMANES S C O BLE D RWINCY RDHILTON TRLTIMBER LE A L N OLDNCHWY13QUENTIN DROSBORN MILL RDPERRYMAN RDWAYNERD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C7 C6dC6c C6b B6b B7B6 C6a C6d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Sandy Run TibbsRun BackBra n c hDeepRiverBroadMouthBranch (N 2 2 / 4 2 ) (S 2 6 0 7 ) (S1 0 0 5)(N22S)(N 42S)(S2640)(S289 5)(S2900)(S2634)(N 42S) (S2974)(S1003)(S2656) (S2873 )(S2691)(S2658)(S2654)(S2712)( S1003 ) (S2653) (S2894) ( S 2 6 5 5 )(7600) (49 7 1 ) (540 0 )(6800)(4017) (610 0 )(3300 ) (8300) ( 5 619 )(4800)(3900)(6150)(8502)(6400) (6416)(6019)(8400)(2500)(3727)(4483) (8800)(4384) (3481 )(6718)(6 0 00)(522 0 )(3974)(3610)(599 6)(3800)(8583 )(4523)(5400) (5900)(3109) (5300) (4812) (4949) (4 1 0 0 ) (6500) (6210 ) (6100) (4 9 0 0 )(4600)(4982)(7200) (4 2 0 0 )(5200)(7928)(6 9 0 0 )(4090)(7612)(4800)(6400)(3900)(5500) (4300 )(2505)(3 377) (3 2 6 0 ) ( 2 30 0 )(4344)(2900)(3000) (3538) (360 0 )(2895)(5000)(2 9 0 0 )OLDCOLERIDGERDNC H W Y 4 2 SNCHWY2242NC HWY 22 SBUFFA L O F O R D R D HINSHAW TOWN RD PERRYMAN R D CONCORDCHURCH RD WINCY R D MORELAND R D HOL L Y S P R I N G R D RIVERHEIG HT SDRJ ASMIN ELNCREEKWOODRDFIELDS COXRDCRAVENBRA N CH R D KEITH DR ERECT RDSOUTHER RD MOFFITT MILL RDLITTLE BEANE STORE RDT IM B E R L E A L N RI VERSIDERDPEACE HAVEN RDMACONFARMRDHOLLYSPRINGSCHURC H R D DEEPRI VERCHURCHRDDOC HAYWORTH RD HERRINGTON CTRY RD T OMMY C OX R D² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C7 C8 B7 D7 B8 D8 C6b C6d B6b D6d C7 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Dee p R i ve r B ru s h C reekLittleBrus hCreekBack Branch LA NE M ILL RD HICKSLNLAMBERT C H APELRD JIMGILLILANDRDB BRAY RDSUNSETHILLS (N22/42) (S1005)(S2641)( S26 40)(S2636)(S2645)(S26 39)(S10 0 5 )(S2634)(S2662 )(S2893)(S2641)(4 3 7 1 ) (540 0 )(6223) (3669)(2889)(6200 ) (522 0 ) (8300)(3800 )(550 0 )(4600)(4 6 96)(6400)(4982)(32 60)(3700)(7400)(4300)(72 0 0 ) (49 0 0 ) (6687)(4200)(3100)(6706)(5 6 8 8 ) (7700)(4000)(2 9 00) (3600) (4 2 0 0 )(3142)NC H W Y 22 4 2RIVER HEIGHTS DRSIMMONSTR L LANES MILLRDDELBERT LNOLD COLERIDGE RD KIDD FARM TRLWA LT B R O WNRDLAMBETHMILLRDCR AVENB R ANC HRDMELLI ERDMANORROCKRD LEWISBROWNRDTROYCAVENESSRDWI LLI EWRI GHT R DLO G C A BIN R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C8C7 B8 D8 B7 D7 C8 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet JacksonCreek South F o rk J a ck s o n Cr ee k BECK RD HUNTERS CHASE CROUSET O W N RD JOHNBECKRDSOLES DRHILLRDGRI F F IN LN CLARAHILLLNDELK RD CID RDLARRYLNROSCOE LN BOSS HOG AVE APPALOOSATRLSAGEBRUSH TRLBOBTAIL LNOLDE FOX TRLROBBINS LN NNANCERDWARD FARM RDTRIP P RDWEDGEW OODDRFOREST RIDGE LNBE R G ERD RLARRY LN (S1307) (S1357)(S1310)(S1314)(S1343)(S1308)(S1351)(S1001)(S1341)(S1338) (S1339) (S1 3 4 0 )(S1342)(S1311)(6 1 0 0 )(3200)(800)(2 8 0 0 ) (7072) (274)(1549)(3 00)(7300) (5900) (6500) (6796)(6815)(840 0 ) (2200 ) (7105)(6900) (1349) (1844)(2300)(1100)(8100)(7360)(1621)(2905)(1796)(6500)(8600)(7700)(900)(1560)(2492)(6800)(5904) (2100) (1400 )(2100)(2400)ROSS WOOD RD FARMERDENTONRD OLD TREE RD JAN DAN DRCHAPELWOOD RD EXTPAUL DRJA C K S O N C R E E K R D BRILES MEADOW RD SUMMEYTOWNRDCREEK HILLS DR WOODSDAI RYRDSOUTH FORK RDBESCHERCHAPELRD LAZYLN TIPTOPRDCHAPELWOODRDPIERCEMEADOWRDHUNTDELKRDLOFLIN H ILL RDTOYESDRJIM P IERCE RD HULINMCDOW ELLRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D1 E1 C1 D2 C2 E2c D1 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet UwharrieRiver Jacks on C reek CarawayCreekAsheboro (S1372) (S3300)(S3301)(S1313)(S1331)(S 1 3 3 9 ) (S1316)(S1 1 9 3 )(S1314)(S1311)(S131 7 )(S1335)(S1314) (S1336) (S 1 3 1 2 )(S1332)(1700)(6800)(4542)(100)(4900)(2400)(2000)(4000)(1294)(4402)(5904) (13 0 0) (5 8 7 7)(400)(900) (4503)(1800)(1400)(4 4 98)(1000)(5900)(4245)(28 0 0 ) (2100) (1 73 1) (16 00) (55 0 0)(5489) (4200) (6500)(4100)(4 953) (5600)(600)(1716)(51 00)(2100)(5 1 1 0 ) (4 5 6 6 )(4310) (1204)(4700) (1119) (2000)(1200)(478) (3400)(200) (2070) (6000)(1520)(2002)(2 4 0 3 ) ( 3 9 8) R O S S WOODRDBESCHERCHAPELRDJACKSONCREEKRD RIDGES MTNTRL HO O VER GRO V ER D GA R R E N T O WNRDVA RNERRDJIMPIERCERD ECHO RDG SUMMITCTPLEASANT UNIONRD L OCUST MTNTRL GALLIMORE DAIRY RDVARNERRD E X T R IVER BLUFFDR BRILES MEADOW R D OVERLOOK DRCL Y DE GR AVESCIR LAKEW A Y R D GOLD EN MEADOWRD GRANITERO CKDR RIDGESMTNRDHEN R Y DELK R D P A R K E R M ILLRDOLDNCHWY49FRITZ F ARMRDRUS H MTN RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D2 C2 D1 E1 C1 E2c E3c C3a E2d D3c D3a D2 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Back Cr eek C a raw ayC reek (S1365)(S 1 330) ( S 1349 )(S1418)(S13 4 7 )(S1328)(S1328)(S1 394)(U64W) (S 1 3 2 6 )(S1331)(S1318)(327 1 ) (4 4 3 )(273)(1100)(3 3 0 0 )(349)(1118) (3465) (2800)(695)(669) (3 1 5 8 ) (897)(3204) (4700)(2996 )(450)(251)(3248)(1200)(44 3 ) (3 1 0 0 ) (4040 )(600) (1 000) (4574) (3200)(485)(402)(313)(709)(353 )(3007)(303)(298)(4454)(809)(200)(350 0 ) (4800) (400)(800)(103)(420 0 )(100)(3306) (600)(411)STUTTSRDGARNER FARMRDSPENCERMEADOWRDS AW YERSVILLERDWEDGEWOODFORESTDRMOORERD WE S T F O R K D R HUNTMASTERTRLJACKSON RD LOWE C T R Y R D WALKER CTRY LNHU N T E R C T WALKERDR US H W Y 6 4 W T R A N QUI L LN GREGORY CTPOPLARFOREST LN PINE L N RUN NIN G CEDAR RD BRO O KSIDECTA STEROIDR D DEERTRA C K R D SAMJACKSONRDRIDGESMTNRD CLUB V I E W D R ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D2 D3a E3c D3c D3b E2d E3d D3d D3a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Back Creek(S1328)(S1389)(U 64 W ) (S1325)(S1383)(S1326)(S1418)(S1326)(S1374)(U 64 W ) (S141 9 )(S1327)(S1420)(S1422) (4200 ) (4 4 3 )(2300)(600)(473)(3007)(327 1 ) (2800) (2900)(695)(23 5 7 )(2 99 6)(200)(330 6 ) (30 0 9)(353 ) ( 7 14 )(2050)(297)(4040 ) (3900 )(200)(3118) (2937) (2500)(100)(3692 ) (3500 )(2197)(2800) (100)(255)(1800) (3000 ) US H W Y 6 4 WSPENCERMEADOWRDSAWYERSVILLE RDWESTCH APEL R D SAUNDERS TRLHARMONY T R LFIRESIDECTBROOKSIDE CTSTUTTS RDSTUTTSRD WALKER CTRY LNBACKCREEKRDHARDWO O D TR L EMERALD R O C K R D T R A NQ UIL LN FORESTLNSTONECTRYLNBAC K CREEKTE R STEPPINGSTONE LN LOWECTRYRD BACKCREEKCHURCHRDPOOLETOWNRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D3b E3d D3a D4a D3d E4cE3c D3c D4c D3b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Taylors Creek Back Creek Cable CreekCara w a y C r eek(S1165)(S1107)(S1366)(S1318)(S1 3 1 9 ) (S1193)(S1348)(S1193) (S1317) (4300) (1 2 8 0 ) (3685)(4003)(3800)(4200)(4100) (3900)(1800)(1700)( 1 0 0 0 )(695)(1600)(1602)(1511) (1400)(1366)(16 80 ) (1201) (3400) (2 0 0 0 )(1398)(4310) (3400)(1200)OLD NC HWY 49 GREENE OAK RDOLDMILLRDMARIGOLDLNR UN NI N GC EDARRDWALKE RCTRYLNLASSITER MILL RDGOPHER WOODS RDKEYAUEE DRMIN LEE DRMOORERDBENLA M BETH R D G O L D E N M EA D O WR D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D2 D3c C3a D3a D3d C2 C3b D3b D3c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Cable Creek TaylorsCreek (S1193)(N 49S) (S1361) (S1 386)(S1362)(S1350)(S1359)(S1326)(S1385)(S136 3)(S1164)(S 1 161)(S1319 ) ( S1 3 2 1 )(S1163)(S1396)(S1320)(S1193) (S1326) (S1360)(1412)(2457) (654 ) (3305)(1072)(220 0 )(1401)(600)(2300)(2400) (3400)(1700)(1027)(2000) (1119)(918)(915)(2480)(695)(2600)(1143)(31 1 8 )(2195)(893)(1500)(659)(973)(1000)(1000)(1201 )(1240)(500)(715)(2 5 0 0 )(1200)(2300)(700)(3000) (2800) (2700) (2050)(2400)RICHARDS CIRSALMONS DROLDNC HWY 49 MOFFITTRD E X T ARROWST ONEDRCABLECREEKRDSAUNDERS TRL NC HWY 49 S OLDF ORESTCTCOUNTRY TRLSTONECREST CTTHORNBURG RDBRANCHWATERRDW ALKERCTRYLNSTUTTSRD CEDARWO O DCTGREENCASTLER D MCDANIEL RDA SH W ORTHRDEXTMOFFITTRDASHWORTH RDBENLA M B ET H RDSTUTTS RD UNI ONCHURCHRDGLADE RD BRUBAK E R L N WINDING W O O D S L N ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D3dD3c C3b D3b D4c C3a D3a D4a C4e D3d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet LongB ra n ch Ut toCedarForkCreek(LakeBu nch)Ce da r Fork Creek Utto Ce d ar Fork Creek Asheboro Asheboro (S1425)(U 64 W )(S1633)(S1423)(S 1 4 2 4 ) (S1 3 2 5) (U 64 B Y P ) (R 6 4 ) (S1004) (S142 2 )(S3120)(S1433)(900) (600) (1506) (1423) (300 0 )(2020)(80 0) (518)(1100)(2400 )(1204)(266)(2 16)(2700 )(2050)(339 8)(1142)(155)(115)(1208) (900) (80 ) (1700)(443)(1 4 5 8 ) (13 00) (1900)(920)(550)(1071)(2 2 0 0 )(500)(1596)(500)(2800)(317) (2300) (267) (33 9 5)(300)(2000) (2500 )(1500) (400)(1010)(6 5 ) (339 4 ) (0 ) (1630) (1800)(630)( 9 7 3 ) (1 0 0 0 )(200)BUNTINGRD SUNSET AVE O T IS R DWESTMINSTERCT ROLLING RD MILBROOKDR ASHEFORDCTSTUTTSRDFRAN KTONCT HENRYPARRISH RDCHAMBERL I NDRTHREE B RDOLDETO W N E P KW YUS H W Y 6 4 W ECHAMBERLINDR USHWY64 GEARRENSTFLOYDDRCARRIAGEWAYRDPOOLETOWNRD OLDLEXINGTONRD MI DDLET ONCIRWE S T C H A P E L R D LITTLELAKESTRLNOAKDALESTMILLER CTR Y D RROADRUNNERDR C HESHI REPLEMERALD R O C K R D C E DA R C R E EKDRABBYLN² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4a E4c D3b E3d D3d E4s D4c D4k D4g D4n D4o D4a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Utt o C e d a r ForkCreekCa ble C re e k TaylorsCreekAsheboro (S1193)(S1236)(S1210)(S1633)(S1350)(S1325) (U 64 B U S ) (S 1 19 3 )(S136 3)(N 49S) (S 1 161)(S3255)(N 49S) (R64) ( S1 3 2 1 ) (U 64BYP ) (S1424)(S1272)(R 64) (S1326) (U 64) (S1322)(S1346)(U 64 W )(S1160)(U64BYP)(1600) (1428)(850)(973)(1287)(1300) (2000 ) ( 6 54 ) (2457)(112)(963)(1459)(1238) (22 0 0 )(2300)(2400)(400)(1400)(1 400) (900) (2480)(1100)(1800) (1440)(1027)(1 6 0 5 ) (2400 )(706)(915)(15 1 1 ) (65 ) (1211) (1208)(902)(2 0 0 0 )(893)(1315)(1200)(341 8 ) (3413)(1000)(100)(800) (500) (0)(1066)(3395)(715)(3415 ) (0)(1500)(1700)(1370) (1100) (2050) (2015 ) (1300) (2016 ) (70 0)(3405)(3398)COUNTRY TRL N C H W Y 4 9SWES TSIDECI ROTIS RDSOURWOOD DRMOFFITTRDUS H W Y 6 4 W MOFFIT T RD E X T O L D N C HW Y 49 W ESTC H APELRD SALMONS DRBILLYWALKERRDTHREE B RDMONROE AVE OLD FA R M E R RDWALKE R CIREMERALDROCKRDSHERIDAN DRE RVINLN RO CKLA NE DR GREENLEAF ACRE S D R OLDF ORESTCTUS H W Y 6 4 W MAYBE RRYLNTHORNBURG RDWILLOW WOODRD FLOYDDR MAURINE DRGREENCASTLER D A SH W ORTHRDEXTUS HWY 64ASHWORTH RDREVELLETRLJAECO CAUDILL DRSTUTTS RD NEELYRDSKEEN VIEW R D JASONHOOVERRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D3d D4a D4c C3b D3b C4f D4r C4e D4n C4g D4s D4k D4o D4c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Cedar Fo rk C r eek HaskettCreekAsheboro Asheboro Asheboro (S1462) (S1797) (S1461)(S3220)(S1479)(S1455)(I73/74)(S 1 0 0 4 )(S1458)(R 73/74)(I73/74)(330)(2444)(2445)(550)(2215)(2250)(1419)(1167)(1009) (1130) (87 6 )(536)(1232) (926) (9 0 0 ) (63 9 ) (1000)(511)(1 40 0 ) (934) (1101) (1200) (1122) (615) (1300)(229)(200)(840)(434)(816)(400)(622)(1100)( 9 2 5 )(500)(1300)(120 0 )(700)(300)(3 0 4 )(600)(1100)(700)(800)(535)(1500)(320)(2391)(1041)(900)(2390)(1000)(5 4 3 ) (1 4 5 8 )(506)(0)(2266)(2269)SOUTHWAY RDTHAYER DRINTERSTATEHWY73/74INTERSTATE HWY 73/74MOUNTAINRDCANNON CT NEELY DR W EST MO N T DRIDLEWOOD DRNROCKRIDGERDCORWITH STW P R E S N E L L S T PARK DR CHAPELGATELN HILLVIEW STWESTMONTCT EDGEWOOD RDCLEVELAND ST N PARKDR WILSON ST HIGHWOOD DR PERRY STN MCCRARY STWESTMO NT C I R OAKMONT DRSPRINGDALE LN LORD RANDOLPH CIR WESTVIEWAVE TROGDON ST CLEVELAND ST JEFFERSON STL E XI N GT ON R D BOSS ONGDRSUNSETDRNEDGEWOODRDWESTOVERTERTIMBA LC TLITTLEGATEDRPIN E S T LINCOLNAVEWESTMONTDRDAVES MTN CTRAILROAD STCLARENDONRDROCKRIDGERDOL D L E X I N G T O N R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4g D4a E4s D4k D4h E4t D4l E4c D4g Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet HaskettCreek Asheboro Asheboro Asheboro Asheboro (S1736)(S1480) (S1488)(U 220BUS)(S1486)(S1489)(S1687)(S1484)(S3262)(I73/74)(U 220BUS)(S1483)(R73/74)(S1479)(421)(472)(339)(500) (522) (501)(509)(334)(1400)(481)(800)(2210)(900)(144) (126)(405)(100)(714)(425)(529)(1012)(211)(329)(301)(238)(908)(906)(332)(200) (700)(200)(106 1 ) (1000)(608)(600)(635)(1023)(400)(819)(426)(330)(700)(2250)(1300)(1008)(644)(200)(400)(424)(622)(223) (300) (300)(1000)(500)(230)(2215)(500)(600)(166) (63 9 ) (100) (900 )(2269)(2266)(1100)(1106)(400)(1100)(0)(1300)(600)WOODCREST RDCITY VIEW ST TRYON STWPRESNELLST WHITE OAK STHEATH ER CTN FAYETTEVILLE STQ U E EN S R D ROSS STCLAY STN CHURCH STCARSONRDFAIRFAXCTVISION DRMCMASTERS ST BETTS ST GREENSBOROSTFAIRFIELD ST NORTHSIDETERFOUST ST N PARK STMT CROSS STPEACHTREE STCASCADEAVEE MILLER ST PLUMMERST PIEDMONT ST CHESTNUT STAMITY RDE PRITCHARD ST E PRESNELL STYORK STHAMLINSTSUMMIT AVECLOVER STBREWERSTENGLEWOOD DRCAROLINA AVE W PRITCHARD ST STERLING ST HAMPTON RD W MILLER ST LIBERTY STINTERSTATE HWY 73/74TAMWORT HRDOAKLANDAVENORTHSIDE TERLITTLEGATEDR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4h E4t D4l D4g D5e D5i E4s E5q D4k D4h Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Ha s kett Creek CedarForkCreek Asheboro (S 1 4 3 2 )(S1437)(S1436)(S1438)(S1446)(S1435) (S1447 )(R 73/74)(N 42N)(S325 5 )(S1 4 3 3 )(S1434)(I73/74)(I73/74)(2391)(2390)(710)(1700)(801)(738)(714)(233)(100)(426)(1500)(1300)(683)(516)(1112)(1179)(221)(145)(1000) (700)(400)(10 2 0 )(100)(106)(142)(500)(1100) (1432) (822)(300)(144 )(126)(320)(817) (1 4 00)(200)(1500)(1 6 0 0 )(1800)(229)(3 00) (400) (700) (800) (3 0 4 ) (804)(0)(800) (900)(1200)(1400) (1 0 0 0 ) (1 10 0 ) (1209) (900)(200)(500)(90 0 ) (100) (1300) (1506)(200)(800)(600)(1200)(2758)(2745)(100)(2445)(2444)W SALISBURY ST L E XI NG T ONRD INTERSTATEHWY73/74HOOVER ST OLD FARMER R D N CHERRY STDIXON AVE RUSSELL STWINSLOW AVE SUNSET AVE SPRING GARDEN STLEWALLEN RDUWHARRIE STS MCCRARY STHAMILTO N S T SUNSET AVE L E X INGTONCOM M O N S D R LEXINGTONPLN MCCRARY STW WAINMAN AVE ASHDOL STNMCCRARYSTROLLINGRD NCHERRYST S CHERRY STRI D G E W A Y C I R HIGHRIDGEST S MCCRARY STOCCONEECH E E A V ENORTHRIDGE DRSUNSET DR OAKHURST DREASTSTHOLLY STNORMANSTCHEROKEE STRUSHWOOD RDRAILROAD STBOSSONG DRBUNTING R D ARNOLDST W KIVETT ST DANWOOD ST C A N NONCTSPRI NGVALLEYRD LEWIS ST POWHATAN A V ECRESTVIEW STSUNSET DR NFARMERRDNOAKDALESTSOUTHWAYRD WESTWOOD DR BREEZEHI LLRDWESTST² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4k D4a D4l D4g D4o D4h D4pD4n D4k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet PenwoodBranch HaskettCreek CedarForkCreek Asheboro (U220BUS)(N 42N)(U 220BUS)(N 42N)(S3262)(379)(438) (350)(700)(432) (804)(368)(400)(213)(1)(280)(360)(350)(125)(358)(451)(620)(710) (714)(331)(150) (800)(321)(141)(334)(126)(300) (200)(329)(700)(339)(332)(142)(300)(230)(321)(311)(153)(405)(32 0 )(500)(151)(600)(628)(422)(157)(128)(700)(307)(404) (400) (142)(210)(612)(100)(146)(400)(200)(415)(301)(329)(300)(419)(238)(120)(500) (100) (200)(306)(2 0 0 )(600)(300) (100) (600) (300)(200)(312) (500)N CHERRY STREDDING RD GLENWOOD RDEKIVETTSTS COX STG R E E NSBOROST HIGHLAND STDIXON AVE ASHDOL ST SILVER AVES FAYETTEVILLE STUWHARRIE STSMAINSTLEWIS ST NORTH STRAILROAD STINDEPENDE NCE D RFRAZIER STN FAYETTEVILLE STSUNSET AVE FR EEDOMDR STARRCTSCHURCHSTW WARD ST HOOVERST WSALISBURYSTN PARK ST E SALISBURY STROSS STHAMMERAVEW WAINMAN AVE S PARK STWHITEOAKSTN MAIN STS CHERRY STHOLLY ST LANIERAVE W KIVETTSTHAMLINST TRADE ST PERSHINGSTLEE STBROOKSIDE DR W WARDST EWARDST N CHURCH STHIGHLAND CTOLDEMAIN TER R AC E DRDAVIS STMEMORIAL STPEACHTREE STSUMMIT AVEN COX STDIXON STWORTH ST MARMADUKE CIR E ACADEMY STHOME AVE NCHURCHSTBURNS ST CRANFORD ST SCARBORO ST EWAINMANAVE E WARD ST MACARTHU R S T BURNSST SELMSTCHES T N U T ST LINDLEY AVE W ACADEMY ST HILL ST ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4l D5iD4k D4p D4hD4g D5e D4o D5m D4l Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet UttoCedarForkCreekAsheboro Asheboro Asheboro (U 64 B U S )(S1426)(S3255)(S 1 4 2 8 )(S1355)(S1429)(S1354)(S1633)(S1839) (U 64 B U S )(S3147)(S1427)(S1352)(S1428)(S1323)(S3 2 5 5 )(U 64)(U 64 W ) (S 1 4 2 4 ) (S1346)(266)(261 ) (2000 ) (748) (1236 )(2100)(975) (2300)(1459)(400)(1100)(900) (100 0 ) (1500 )(1400)(1208)(324)(200)(2 2 0 0)(500)(1211) (1800 ) (1300 ) (1600)(200)(300)(600)(100)(100 )(2400) (2015 )(2016 ) (1500) (13 0 0 )OTIS RDWESTSIDE CIRUS H W Y 6 4 W CRANBROOK WAY OAKGROVE RDNOAKDALESTWESTBURY DRWESTCHA P E L R D ROOSEVELTRDOLD FARMER RD ROSE GARDEN TRL CRANBROOKCIRRO CKSP R IN G RD SEMINOLE DR JARR E L L D R FLOYDDR ROCKLA N E D R CHEYENNECIRWILLOW WOOD RD HENRY RDOAKLEAFRDUS H W Y 6 4 W SKEEN VIEW RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4n D4c D4a D4r D4o D4s D4k D4n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Little Rive rAsheboro ( S 142 8 )(S1157)(S1450)(S1323)(S 1 4 3 2 ) (I73 /74 )(N 49S) (S 3 1 47) (S142 8 )(S3255)(U 64 B U S ) (S1431)(S1429)(U 6 4 B U S )(S1448) (S1430) (R73/7 4 )(S1713)(I73/74)(S1446)(110)(1300 ) (747)(788)(2200)(914)(1140) (2990 ) (900)(1050) (2991 )(119)(1020) (1236 )(129)(159)(910)(1006)(1062) (21 3 )(600)(800) ( 2 47 ) (720)(1900)(764)(2000)(927)(1000) (736)(1800)(926)(921)(3015 ) (800)(900)(1070) (3010 ) (1100)(50)(500)(2901 )(324)(746) (748) (800)(900)(2100)(1161)(820)(1101)(10)(700) (82 6 ) (806) (700) (200)(600)( 1 00 ) (783) (830) (0)(2873)(600) (2880 )(1000)(2745)(2758)(100)LO N D ELLE LNW D I X I E D R WHITLEY STA L BEM ARLERDUSHWY64W BE R G S TOLDFARMERRD BREEZEHILLRDUWHARRIE STOA KG ROV E RD MARKWOOD ST INTERSTATE HWY 73/74LAMBERTDRNOAKDALESTSEMINOLE DR S MCCRARY STI NTERSTATEHWY73/74MACK RD NC HWY 4 9 S FIS H E R C I R LAKE DRDUNDE E S T OAKG R O V E R D SPENCER AVE RIDGEWAY DR B REEZEWAY CT ROBBINSSTDAIRY ST FERMERRD BRADY AVECHEYENNECIR BROOKWAYRDOAKLEAFRDRIDGEWAY CIRTROTTER L N JE R R YHUGHESST BRITT AVE SHANALN ELWOODSTOUTSTKINGSWAY RDWILLIAM AVE MORGAN AVEROCKSPRINGRDREGISTER S T LEWALLEN RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4o D4s D4k D4pD4n D4l D4tD4r D4a D4o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet C e d a rF o rk C r e e k PenwoodBranchAsheboro (U 220BUS)(U 6 4BUS) (U 64BUS)(S1713)(N 159)(U 220BUS)(10)(333)(1422)(328)(560)(432) (311) (118) (414)(1328)(51 7 )(326)(253)(628)(129)(1407)(1319)(1625)(1100)(600)(304)(996)(746)(819)(1600)(200)(822)(1500)(522)(500)(720) (453)(1510)(926)(1700)(400)(827)(1502)(1300)(500)(956)(929)(725)(251) (521) (212) (300) (400)(818) (700)(800)(1000)(1100)(1400 )(919)(0)(954)(100) (8 00) (433) (300) (200)(700)(900)(700)(400) (446)(1200)(600)(1500 )(900)(100) (500) (1 00 0 )(817)HIGHLAND STKINGSWA Y R D STOWE AVE GLENWOODRDS FAYETTEVILLE STTHIRD STALBEM ARLERDSILVER AVE DELLWOOD AVEHILLCREST CIRATLANTIC AVES COX ST STOWE AVE SPENCER AVE TELEPHONE AVE LINDSEYAVE RICH AVE FIRSTSTBULLA ST E DIXIE DRS PARK STW TAFT AVE WELLS CIRCASPN DR OAKDALE STW DIXIE DR R AMPHAMMER AVEFAIRWAY RDARMFIELD AVE HAMMER AVEBRADY AVE BRYAN AVEMACON STS CHURCH STCOOPER S TJOYCE STCOX AVES MAIN STBIRKHEAD ST WASHINGTON AVE MAPLE AVE E DORSETT AVELEE STE WALKER AVE WILLIAM AVE MORGAN AVE BRITT AVE LAKE DR CENTER STW WALKER AVE ZOO PKWY RAMP E TAFT AVE STRAIGHT STWINDERMERECTATLANTIC AVE COUNTRYCLUBDR CENTER ST² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4p D4l D4t D4o D5m D5i D4s D4k D5q D4p Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet UttoCedarFork Creek TaylorsC reekAsheboro (S1200)(S1355)(S1258)(S1352) (S 1 3 2 3 ) (S12 1 3 ) (S1356)(N 49S) (S1208)(S1144)(S1193)(N 49S) (S1159)(S1272)(850)(1238) (1370) (674)(900)(7 0 6 )(600) (300)(814)(1100)(200) (1 0 0 ) (1000) (500)(963)(739)(800)(310)(408)(5 0 0 )(900)(400) (589)(324)(1066)(800)(700)(700) (1100)SOURWOOD DRN CH W Y4 9 S OLD NCHWY49 OAKLEAFRDMACK RDMA Y B E R R Y L N EASTONEXT OAKWOOD ACRES RDREVELLE TRLCRA NBROOKCIR LUXURY LNWESTBURY DRGREENLEAF ACRES D R FRI ENDLYCIR ETHAN CTREVELLETRLMONROE AVE FRIENDLYACRESRDJAECO CAUDILL DR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4r D4c C4f D4s D4n C4gC4e D4o D4r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Li ttl e R iv e rAsheboro (S1230)( S 1241)(S1191) (S1267)(S1157)(S1208)(S1229)(S1221)(S1266)(N 49S)(S1157)(S1204)(S1144)(S115 0 ) (R 7 3 / 7 4 )(S1144)(R 73/74)(I73/74)(I73/74)(386) (735)(2100)(201)(750)(2200)(644) (600)(100)(200)(110)(450)(161)(371)(800) (508)(721)(2000) (842)(700)(716)(1100) (900)(2216)(1231) (900)(700)(471)(2218)(426)(1200)(400)(2264)(1000)(401)(2397)(800)(246)(735)(800) (3015 ) (832)(119)(646)(500)(700)(628)(1700)(319)(200)(2313)(961)(800)(806) (100) (3010 ) (1047 )(324)(1916)(1800)(600)(0 )(1900)(3278)(300)(0)(3271)(500)(3116)(3091)INDUSTRIAL PARK AVE S HERWOODOAKSDRSHERWOODAVE LUXURY LN NICKI ST SPRINGWOO D CTWHITLEYST LAMBERT DRW MINE ST LONDELLE LNMYRTLE STMORGAN AVELAMBERT MINE STMCDOWELL R D SHERWOODRD MACK RDE MINE ST ETHAN CT ENTERPRISE STCHARMI N D R ARMADILLO DRASHMONT CTHICKORYCREEKTRLHA R V E L L S TE XTHOLLINGS R D MYRTLE STOAKLEAFRDM O NR OE AVE SUNNY LNCARDINAL STHARVELL STGLENDALE DR NC HWY 4 9 S CURRY DRHILLBROOK DR SPRINGWOOD RD INTERSTATEHWY73/74OAK DRDENNIS ST² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4s D4tD4r C4g D4o C4f C4h D4n D4p D4s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Asheboro Asheboro Asheboro Asheboro Asheboro (U 220BUS)(S2922) (S2813)(S3012)(S2 921)(S2928)(S2811)(S2823) (S2917) (S2932)(S2934)(S2812)(S2815)(S2814)(N 159)(U 220BUS)(S2915)(S2918)(S2919)(S2810)(S2947)(400) (1828)(2400)(700)(2020)(500)(1625)(1500)(463) (303)(2420)(270) (721)(611)(2223)(160)(2200)(800)(2216)(456)(100)(2100)(200)(421)(0)(1800)(300)(2000)(1900)(300)(1700)(700)(400)(1700)(2500)(406)(500)(504) (200) (1800) (100)(400)ZOO PKWYSFAYETTEVILLESTSHERWOOD RD INDUSTRIAL PARK AVE ELDORADO RD NE W BERN AVE CHARLESAVE RIDGEST NOLEN AV E FOSTER ST NORTHAMPTON DRLEGENDDRWOODCREST DRENTERPRISE STMCDERMOTT STBRAY BLVDTEACHEYSCHOO LDRNOLENAVE EXTBOGEY LNBROOK DRFAIRWAY RDBOYD AVE H A L L D R ANCHORDR APRIL LNFIRST STTHIRD STSTEELE STSYKESFARMRDSPRINGWOOD RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D4tD4s C4h D5q D4p C4g C5e D4o D5m D4t Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet MillCreek GabrielsCreek(U 64E) (S2221 )(S2256)(S272 9 ) (S2705) (S2343) (S2734)(S2731)(S2715)(S2333)(S2704)(U 64BUS)(S2605)(S2692)(S2725) (S2604 ) (S2601) (S2 3 9 4 ) (S2604)(S 2 7 1 3 )(U64BYP)(R64)(S2215)(U 64BYP)(1300) (364)(2700)(500)(1101)(3300) (2 0 6 3 )(245)(2200)(111)(1400) (2400) (2243)(112)(1542)(2327) (2262 )(2131) (1493)(2351)(329)(3200) (1824) (2356) (2118) (2320)(205)(317)(2607)(800)(400)(2302)(700)(786) (600)(100)(3515)(2500)( 48 6 )(889)(882)(114)(3705)(3329)(2187)( 1 943 )(498)(2726)(285) ( 1 000)(2893) (2354)(300)(159)(1 7 0 0 )(527)(1810)(3523) (0 )(132)(3490)(3491)US HWY 64 E CRESTWOOD LN SUBSTATION RD TRO G D O NHILLRDLUCKRD MOUNTAINOAKVIEWDRIRONMOUNTAINRDEPRESNELL ST LOFL IN POND RD MADI S O N CI R SQUIRRELHOLLOWLN DEWEYRDROCKY KNOLL RDPINECREEKRDG WILDFLOWER CTSUNFLOWER DRTROGDON POND RDLAWRENCE HEIGHTS AVE WOODS STREAM LN CLIFFWOOD DRCEDARLODGERD BALSAM ST WILDWOOD LN MARSHALLLNCLAPP DRDEERBERRY CTPONDEROSA HEIGHTS PLWI NDFLOWERLNWOODRIDGE DR CRAIG STGREENVALLE YRDH A WKWAT CHRDSOHOMEYDRROMANRDCREEKWAYRDGROCKYK N OLL RDEXTUS HWY 64HENLEY CTRY RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5d D5b D6c D6a E5dE5s E6q D5k D5g D6e E6rE5r D5j D5f D6f D5n D5b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Squirrel Creek (S2606)(S2675)(S2736)(S2828)(S2700) (S2986)(S2 7 2 4)(S2715)(N 42 S )(R64)(S2600)(S2670)(S2671)(N 42S) (S2602)(S2722)(U 64BYP)(S2827)(S2605)(S2604) (S 2 6 0 3 )(U64BYP)(484)(1 5 6 7 ) (1400) (17 0 0 ) (2400) (1061) (700)(1263 ) (800) (1 5 4 2 ) (17 1 3 )(668)(1675)(1 1 0 0 ) (1888) (2351) (1 2 0 0 )(1233)(1191)(600)(1300) (15 7 5 )(17 6 4 ) (2 3 0 0 )(1281)(1500) (12 6 4 )(1377)(1300) (1596) (1 6 9 1 )(1000 )(1482)(3488)(900) (1748)(3489)(800)(1400 )(0)(1407)(497)(488)(2000) (2200) (1080)(1600)(964)(3461)(533)(3468)(1336)(1900)(1302)(1 0 7 6 )(3491)(3490)NC HWY 42 SBRIARCLIFFDRKENNEDY CTRY DRBUFFALO FOR D R D GLEN N CTRYRD MILESM O F FIT TR D WELCH LNIRONMOUNTAINRDDANIEL RDBROWERS CHAPEL RDSPOONS CHAPELRDOSPREYDRHIGHTSTFORESTVALLEYDR TWINCRYSTALTRL HENLEY DR LUCK RDKENLEEC TBROWNSTONEHILLSDR US HWY 64USHWY64PONDEROS A HEIGHTSPLCRYSTALW OO DRD PONDER O SA H EIGHTSPLOLD B UFFAL O FORDRD CIRCLE B DR G R A C E L A N D D RFLETA B RO W N RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5d C5 D6c C6aC5f D5j D6a D5r D5bD5k D5n D5d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet PenwoodBranch Asheboro (S2317)(S2249) (S2316)(S2247)(S2246)(S2188)(S2186)(S2248)(S2187)(S2345)(441)(442)(260)(444)(700)(1104)(1300)(805)(926) (7 9 1 )(650)(1100)(100)(946)(800)(928)(622)(1200) (250) (900) (20 0) (300)(540)(606) (400)(824)(678)(419)(930)(62 0) (1000)(538)(440)(200) (400)(446)(500)(870)(700)(700)(500)(830)(634)(1071 ) (560) (600) (949)CROSSS TFAIRFIELD ST WATKINS STN ELM STSPRING STWILLOW C R EE K C TCLAY STDUNBAR STBOLING DR BRENTWOO D C T CAROLINA AVE EASTVIEW DRGLOVINIA STE PRESNELL ST NO R T H S H O R E DR E PRITCHARD ST BREWER S T MEADOWBROOKRDFARR STKEYSTONEDRTWAIN DR STERLING ST TIPTON DRBAYLEAFCTWOODLANDCIR CROWNEPARKAVE LOACHSTPOLOCRO W NE AVETABOR CT PENNWOODDRBROOKWOODDR DAISY RDWOODLAWN STBOOKER T WASHINGTON AVECRAVEN DR KIDD DRGREENFIELDSTTUCKERSTHILLSDALE DRVANCEST TRANSFERSTATIONPL² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5e D5i D5f E5q D4h E4t E5r D4l D5j D5e Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet PenwoodBranchAsheboro Asheboro (S2213)(S2296)(S2 2 9 4 )(S2295)(S2345) (S 2 1 9 1 )(S2347)(S2216)(S2265)(S2345)(S2216)(S2183)(200)(6 83)(221)(1345)(772)(100)(949)(600)(1800)(1200)(1709)(821) (1300) (500)(200)(1500)(400)(1400)(1900)(319)RAGSDALE RDKIDD DR LA NSDO W NERD R O C K C R U S H E R R D OLD CEDAR FALLS RDCRESEN TDRE PRESNE L L S TCOVENTRYPLSTONEHAVENDR GOLD HILL RDM O R G A N C T RY R DGOLDHILLRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5f E5r D5j D5gD5e D5i E5sE5q D5k D5f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet GabrielsCreekAsheboro Asheboro (U 64E)(S2680)(S2216)(S2214 )(S2213)(U 64BUS) (S2725)(U64BYP)(R64)(S2345)(S2215)(2700)(2200)(2 0 6 3 )(245)(2300)(3491)(2726)(2607)(2500)(1900)(200)(100)(2351)(285 )(3523)(0)(1400)(132)US HWY 64 E E PRES N E L L S T MADISON CIR LAWRENCE HEIGHTS AVE OLD SPRUCE DRU S H WY 64 N O R T H V I EW D ROLDCEDARFALLSRD CRESENT DRHENLEY CTRY RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5g D5b E5s D5f D5k E5r D5j E5d D5g Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet PenwoodBranchAsheboro (S2186)(S2192)(S2216) (S2237)(S2188)(S219 5 )(S2193)(S2187)(S218 9 ) (N 42 N ) (N 42N)(700)(4 1 5 )(185)(600)(100)(1034) (622)(442)(222)(424) (905) (350) (404)(1117)(441)(345)(508)(446)(301)(409) (30 0 )(637)(300)(432)(235)(3 2 6 )(1345)(444)(156)(230)(928)(423)(500)(440)(900)(960)(929) (1237)(113)(1200)(340)(800)(200)(600)(700)(1300)(500)(400)(1300) (700) (1100)(400)(926) (1000) (438) (800) (400)(320)(400)(500)(1000)(830)(300)(203)(200)(916) (1253 )(210)(260)(800) (914) (300) (90 0 )(100)(5 0 0 )(200)(600)N ELM STWATKINSSTGLENWOOD RDCROSS STDUBLINRDBREWERST M A RT IN LUTH ER KING JR DR N C H W Y 4 2 NMEADOWBROOK RDSHANNONRDDUBLI NSQUARERDSHAMROCK RDCE D A RF A L L S R D E KIVETT ST E SALISBURY S T SILVER AVE SHANNONRDO L D C E D AR FA LLSR D WORTHST LOACH STMARMADUKE CIR HARRISONSTS RANDOLPH AVEMAPLE AVECOLERIDGE RDCLIFF RDLINDLEY AVE SPRING STWOODLAWN STGLOVINIA STCOOL SPR IN G ST REDDING RDSELMSTBURNS ST PARKVIE W ST KI D D D R RIDGECRESTRDPATTON AVEFRANKS ST FRIENDLY RDKEMP BLVD THO M A S S TN HIGH STN RANDOLPH AVEDAISY RDMCALISTER STGREYSTONERD CALLICUTSTE WARD ST BROOKSIDE DR BOOKERTWASHINGTON AVEKERRY STGARDINERRDTUCKERSTSPRING STWORTHSTS HIGH STDUNLAP ST² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5iD4l D5j D5e D5m D5fD4h D5nD4p D5i Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet GabrielsCreek Asheboro Asheboro Asheboro (N 4 2 S )(S2216)(S2706) (S26 8 3 )(S2196)(S 2 1 8 9 ) (S2 2 1 3 )(U64BUS)(S2192)(N 42 N ) (S2237)(U 64BUS)(S2191)(1300)(1709)(1229)(1 3 8 1 ) (800) (1300) (1808)(1345)(100 0 ) (125 3 )(200)(1 5 3 6 ) (1 00)(1900)(300)(100)(400)(1700)(1775)(1500)(1400)(1600)(200)(221)SKYLINEDR O LDCEDARFALLSRDE DIXIE DRNC H W Y 4 2 S ROCKCRUSHERRDNC H W Y 4 2 N M ARTIN LU T H E R KIN G JR D R THO M A S S T E SALISBURY ST PATTON AVEVISTA PKWY SKYLINE DRLAKECRESTRDCRE S E N T D R US HWY 64 EMOUNTAINTOPDRCOVENANT MOUN T A IN R D ROSEMONT RDRAGSDALERD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5jD5i D5f D5k D5n D5gD5e D5dD5m D5j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Gabriels CreekAsheboro (S2 2 1 3 )(U64BU S)(S2707)(S2706)(S2676) (S2708)(S2698 ) (S 2 6 0 4 )(S2601)(S2604) (1277) (500)(1500)(364)(1056)(2200)(498)(1900)(100 )(2100)(329)( 6 00 ) (1493) (1300) (1353)(290)( 2 0 0)(300)(527)CRESENT DR CLIFFWOOD DR LUCK RD HAMPTON CTUSHWY64EROMANRDCRE S E N T D R FALCON HILLS DRVISTA PKWY CEDARLODGERDBEANE STGREEN VALLEY RD CRESTWOOD LN STRATFORDWAYVISTA PKWY EXT² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5k D5d D5b D5j D5gD5f D5n D5k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet PenwoodBranchAsheboro (U 64BUS)(U 64BUS)(S2992)(S 2 8 2 6 )(500)(433)(1227)(400) (700)(900)(1100)(171)(938) (427)(9 1 1 )(921)(637)(800) (831)(1615)(1000)(1536)(1000)(1035)(1500)( 1 2 0 0)(1400)(1032)(432) (813 ) (620)(1122)(1600)(414) (900) (10 0 ) (1000)(701)(5 1 7 )(398)(1135) (446)(1034) (500)(600)(845)(700)(729)(800)(700)(600)(900)(1101)(1400)(1100)(252)(1300)(1 6 7 )DUBLIN RDGLENWOODRDKERRY ST LIN D SE YA V E CLIFF RDSILVER AVE EMERSON DR KENMORE S T WELLS CIRAVONDALEAVE DUBLIN RD EXTMACKIE AVE MAPLEAVE SHANNON RDSHAMROCK RDEXECUTIVE WAYLARKWOOD AVE SEQUOIA AVE ARROW WOOD RDGREYSTONE RD DELLWOODAVE WALTON C T E DIXIE DRHILLCRESTCIR GALWAY PL PLANTATION CIRCYPRESS DR HEMLOCK DR STOWEAVE BROWERSCHAP E L RDHAZELWOOD ST E DORSETT AVE COX AVE TROLLINGER RDKILDARE RDBROOKDALE DRTIMBERLANEPEPPERIDGERDLAWRENCE DR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5m D5i D5q D5nD4p D4l D5j D4t D5r D5m Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet S q u ir re lCreek Asheboro (S2600)(U 64BUS)(N 42 S )(S2719)(S2700) (S2697) (S3004) (S2696)(S2992)(S2826)(S2940)(S2683)(N 4 2 S )(S2825)(1206)(900)(668)(800) (20 0 ) (600)(569)(154 )(1135) (700) (100)(350)(1300)(1234) (1100) (1115) (122 3 ) (30 0 )(1407)(252)(1229)(1675)(12 0 0 )(1463)(1400)(1159)(500)(1000) (40 0 )(200)BRIARCLIFF DRE DIXIE DR NC H W Y 4 2 S DANIEL RDCANTERBURY TRLHORSEMOUNTAINDR COLONIALRDHENLEY DR LAZELL AVE CARRIAGE LN LAWRENCE DRBROWERSCHAPELRDDOGWOOD ST EASTWOOD DRSK Y L I N E D R INWOOD RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5n D5d D5j D5r D5m D5i D5k D5q D5n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Ve st a lC reek Asheboro Asheboro Asheboro(S2925)(S2935)(N 159) (S 2 9 4 2 )(S2947)(S2825)(S2956)(S28 2 6 ) (N 1 5 9 ) (S2922)(1615)(952)(0)(819) (2 2 0 0 ) ( 7 7 5 )(1)(877) (1782)(1665)(184 7 )(565)(500) (834) (1862) (559 ) (800) (1 9 3 0 )(554) (900)(653)(1723)(523)(1730)(1700)(189 3 ) (1828)(645)(424)(465)(398)(400)(1600)(904) ( 1 9 6 1 ) (1400)(200)(1740)(62 3 )(504)(600)(2 1 0 0 )(1718)(800)(1000)(1761)(600) (600) (700)(1868)(1800)(23 0 0 ) (303)(700)NEWBER N AVESHAMROCK RDEDGE CT TEACHEY SCHOOL DR MARK AVE ROCKCLIFF TERSTONEY CREEK DRZ O O P KW Y RO C K C L I F F C TRICHLAND PLPLANTATION CIRPEPPERIDGE RDQUEE N S M E A D O W C T BROWN TRLCOLONY RD HALIFAX STSALEM CT BRO W NM IR E DR H O LLY D RPINE GROVE DRMANOR CIR ROCKY LNANNS CT SYKES FARM RDBROWERSCHAPELRDNORTHAMPTON DRARROW WOOD RDBROOKDALE DRTIMBERLANEIN W O O DRDLAURELDR KARLA DR VESTAL C R E EK CTSHEPHERDS WAYANNSCTFESMIR E ST HORSECARRIAGELNCO X EM O O RPL² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5qD4t D5r C5e D5m C5fC4h D4p D5n D5q Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet V estal Creek Asheboro Asheboro (U 64BYP)(S2825)(S2826)(S29 7 9 )(S282 7 )(S282 4 ) (S 2 8 2 6 )(3461)(200)(1463)(569) (1336)(1100)(700)(900)(1200)(6 0 0 )US HWY 64INW OODRDB R O W ERS C HA P E L RDHORSEMOUNTAINDR FLETABROWNRD PINE H I L L R DANNS CT² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D5r D5d C5f D5n D5q C5C5e D5m D5r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet MillCreek (S2716) (S2689) (S2729) (S2734)(S3000)(S2711)(S2611)(S2610)(S2605)(S2681) (S2663) (S2738)(S2605)(S2609)(2452)(214)(1151)(1066) (2974) (3200) (3087) (2662) (5 0 0 )(2958) (4 00)(587)(391)(3034)(673)(3000) (2243)(524)(2400) (2262)(336)(2131)(2851) (2427)(326)(2327) (2320) (3 0 9 )(317)(600)(400)(292)(2569) (1086 )(542)( 7 00 )(2187)(2 86 1 )(238)(300) ( 1 9 4 3 )(729)(2687) (900)(500)(2900) (2500)(889)(2354)(2500)(1101)(600)MEADOW RDVALEWOOD DR IRON MOUNTAIN RDMT TABOR CHURCH RDFIELDCRES T C TCHANEYRDFO X F IR E RDHONEYSUCKLERDGPINE TOP LN NORWO O D L N WILDFLOWER CT KINDLEY FARM RDARLINGTONDR EXT ARLINGTO N D R PRINCETO N C T MEDFIELD CIR PINE CREEK RDG WOODS STREAM LN PRAIRIETRLOLDSTAGECOACHRDMOUNTAIN LNDEERBERRY CTWI NDF LOWERLNBURNS FARM RDIRON LOOP DR G LO W IN G W O O DTRLWALNUT CREEK LNGREENBRUSHRDSPARROWTR L SHARRON DR CREEKWAYRDG MOUNTAINOAKVIEWDR IRONMOUNTAINVIEWRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D6c D6b D6a D5b D5d D6d D6fD6e E6r E6sE5d E6q D6a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Mi ll Creek Franklinville(S2208) (S2672) (S2665) (S2716)(S2614)(S2 6 1 1 )(S2615)(U 64E) (S1003) (4985) (1100)(300)(35 0 0 )(500)(1137)(1086) (3938) (7 0 0 ) (5000)(535)(2900)(2861)(3707) (3575) (11 0 0 ) (4500)(200)(3452) (3200)(100)(3 320) (3800)(700)(3400)(3 2 9 9 ) (900)(341)(900)(174)( 1 200) (20 0 )(925)(4761) (3540) (601)(843)LAKESIDE PARK RD US HWY 64 E CLEARWA TER C T PLEAS A N T R I D G E R DRED ROCK RD QUARTZ STGEMSTONE CTOLDMILLFORDTRLCHANEY R D COUNTRYESTATES DR F OXF I R E RDALLIELNINDIAN SPRINGS RD G L O W IN GWOODTRLARTHURS CT KINDLEY FARM RD KINDLEYFARMRDEXT SYCAM O RE TRL FIELDCREST CT ALBERTMARTINRDIN D IGO TRL GRANTVILLELNKIND L EYTRL ELLIO T T B ROWNTRLBROOKLYNAVEEXTW R IG H T FARM LN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D6b D6d D7D6c D7a E6tE6r E6s D6f D6a E7q D7e D6b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet SquirrelCreek (S2714)(S2604)(S2667)(S2690)(S2736 )(S2682)(S2605)(S2608)(S2606) (S 2 6 0 7 )(S2661)(S2607)(S2605)(2300) (3355)(1855)(2400) (2948) (3100) (2742)(1909)(1344)(1620)(1400)(1777)(159 6 )(1151)(17 8 7 )(2787) (3000)(2900)(3327) (1764)(600)(1539)(3154)(1900)(1700)(2 6 0 0)(1423)(2351) (3148)(1600)(34 58)(1257)(2500)(1101)SPOONS CHAPELRD MARATHO N D R SQUIRRELCREEKRDBUFFALO FORD RD LOE FALL AVEROCK WRENNTRL FILLERRDEXTCLEON STFILLERRDVESPERTRLLUCKRD MTTABORCHURCHRDSPOONSCHAPELCHURCH RD SQUIRREL DEN RDWHITLEY CTRYRDWINCHESTER H EI G HTS DR IRONMOUNTAINVIEWRDROSE HILL RDRILLA STIRONMOUNTAINRDMOUNTAINOFFAITHRDFO X RUNDR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D6c C6a D5d D6d D6a C5 C6b D6bD5b D6c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet (S2607) (S2728)(S2720)(S2673)(S2684)(S272 1 ) (S2607) (S2735)(S2614)(S2614)(S 2 611)(S2664)(S2613)(S2612)(S2664)(1428)(3782) (3900)(1137)(3805) (3989)(2 1 0 6)(1940)(4900)(2 001) (4200) (3940)(1900)(4031)(1600)(2000)(5080) (18 21 )(5000) (4000)(1437)(843)(3458)(1236)(2400)(4260)(3510)(4700)(1708)(3148)(1800)(1694)(3584)(4433)(3355)(3600)(2071)(1670)(1 2 0 0 ) (16 7 3)(4200)(3800)(1400)(3700)GRANTVILLELNB U F F ALO FO RD RD O L DMILLFORDTRLM ILLCR EEKRDG PIL O T C T O LDASHEBORORDEXT YOUNG RD MEADOW RIDGE CT MASONS DRTWINFL OW ER RDWOODLAND VIEW PL PINE L AKESDRWOODGLODRFOX RUN DR OLDASHEBORORDLANTERN DRJENNIFERVIEW DR MAR A T H O N D R S H A D Y K NOLLDRFOXFIRERDSPINKS RD COXBROTHERSRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D6d D7D6c C6b D6b C7C6a D7aD6a D6d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Mi l l C r e e k (S2686)(S2221)(S2256)(S2732)(S2223)(S2730)(S2729) (S2734)(S2688)(S2731)(S2733)(S2224)(S2605)(S2605)(S2343) (S2333) (S2663) (U 64E)(3700)(3500) (2600) (2080) (2373) (2254) (2200) (3329)(391)(2448) (2243) (2400)(2262)(2131) (2427)(326)(2327) (3900) (2320)(214)(200)(205)(317)(400 )(292)(100)(3515)(100)(500)(4000) (2187) (2356) (2302)(1943)(3705)(2500)US HWY 64 E TANGLEWOOD LN VALEWOOD DR WILDFLOWER CTLOFLIN POND RD SQUIRRELHOLLOWLN DEWEY RDIRON MOUNTAIN RDW O O D R ID G E D R PINE CREEK RDG WOODS STREAM LN BOBKIVETTRDMOUNTAIN LNGLENN DRMARSHALL LNCLAPP DRDEERBERRY CTWINDFLOWER LNP LE A S A N T C R O S S R D WILDWOOD LN OLD STAGECOACH RD SPARROW TRL ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D6e D6a D5b D6f E6q E6rE5d D6e Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet (S2702)( S 2 6 1 1 ) (S2703) (S2689) (S2695) (S2686) (S2717)(S2235)(S2687)(S2688)(S2685)(S2718)(S2610)(S 2 6 1 1 )(S2711)( S 3 000) (S2663) (S2681) (S2672) (U 64E) (2600) (2685) (2974) (3 0 8 7 )(3000)(7 0 0 ) (2800) (2662)(2 9 5 8)(4000) (170 ) (40 0) (2254)(500)(2700) (4133) (2452)(3034)(200)(2500) (2900) ( 3 36)(2851) (2926)(2849)(100)(200)(600)(100)(2861) (2793)(542)(3 0 9 ) (300)(238)(2687) (2900) (4500)(2900)(4200) VALEWOOD DR TANGLEWOOD LN F O X F IR E RD CRISTY CIR NORWOODLNCHANEY RDARLINGTONDREXTAR L IN G T O N D R P R IN C E T O N C TUSHWY 64 E MEDFIELD CIR OLD STAGECOACH RDGOSPELCHAPELDRPRAIRIETRL PINE RIDGE RD ANDREWHUNTERRDSYLVAN DRGLENN DRMEADOWRDG L O W IN G W O O D T R L PINE CT GREENBRUSHRDWALNUT CREEK LNSHARRON DR INDIAN SPRINGS RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D6f D6a D6b E6r D6e E6sE6q D6f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet M illsto n e C re e k MillCreek D eep River Bro ad M o uth B ra n c hReedCreek Sandy Run (S2 6 6 2 ) (S2709)(N 22S)(S2710)(S 2 6 56)(S 2640)(S2712) (S100 3)(S2618)(S2613) (S2 6 0 7 )(S2626)(S2656) (S2658) (S2639)(S1003)(S2691)(S2642)(N 22S)(S2628)(S2657) (17 0 0 )(5000) (32 0 0 ) (6300) (4450) (6400) (5453)(1300)(1700)(1056)(2182)(3900)(1400) (5 500)(6019) (5 6 47 ) (4493) (4 606)(3727)(3974)(4400) (250 1)(1752)(925)(3481 )(1500)(3610)(6 977)(1500)(5900)(3109)(2900)(4600) (5285)(6800) (3 3 0 0) (2249 ) (3260)(2895)(5200)(6100) (5600 )(1600)(1100)(1023)(4260) ( 19 0 0 )(1892)(5974) (5080) (6400)(800) (4500) ( 2 3 0 0 ) (6011) (3000)(2500)(2505)(5500) (5738)(2179)(2100)(121 1 ) WIL L I E W R I G H T R D OLDSILERCITYRD BUFFALOFORDRD NCHWY 2 2 S HAWK FARM RD HOLLY LEAF RD PARKWOOD RD PARK RDPL EASANTRI DG E R DSTO UTACRESRDJOEDEANTRL MORELAND R D I R AMCGEERD RIDGETOP RD BUFFA L OTRLBROOKHAVEN RDBROOKLYNAVEEXT MILLCREEKRD PARKSCROSSRDSCHURCHRDHINSHAWTOWNRD CRAVEN BRANCHR D MACONFARMRDRAINBOW TR L DEEPRIVERCHURCHRDWIL LIAMBU RGESSRD PLEASANTRIDGECHURCHRDYOUNG RDLEELAYNERDYORK RIVER RD HOLLYSPRINGSCHURCHRD TROYCAVENESSRD HOLLY SPR ING RDPEACE HAVEN RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR C7 D8 D7 C8 E8 C6b D6d D7bD6bD7a C6d E7dE6t E7rE6s D7 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Mill Creek DeepRiver ReedCreek Ramseur Ramseur (S2709) (S 2 6 1 9 )(S2615)(N 2 2 S ) (S1003) (S2 6 5 7 )(S2618)(5200)(1349)(1752)(1109)(2300)(1006 )(2195)(2072)(250 6 ) (220 0 ) (4427) (2102) (900) (4212) (4450) (5136) (4600) (4411) (250 0 )(444)(1700)(4 7 3 5) (4519)(2061)(1009)(1400)(4493) (4 6 4 6 ) (1100) (785) (4400) (4400)(823)(1120)(1500)(90 0 ) (110 0) (121 1 )(1023)(4500)(600)(925)SPRINGVIEW STW RIDGE STSUNSET OAKS DR PARK RDDIXON STBROOKLYNAVEPLEASANTRIDGERD WILLIAMSST COL E R I D G E R D WOODELLAVEGRACEWOOD RDCHI S HOLMRDMEG A N D R NEWELLST EXTHOLLYLEAFRDEXT JONES ST EXT HOLLY LEAF RD ROUNDLEAFRD W ATEROAKDRNEWELL STNC H W Y 2 2 S ISOMRD RIDGETOP RDBROOKLYNAVEEXT WILLIAMS RDMILLCREEKRD RI CHA R D SONST PLEASANTRIDGECHURCHRDYORK RIVER RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D7 D7aD6b D7b E6t D6d E7r E7dE7q D7e D7a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet M ills t one Creek DeepRiverReed C reekRamseur (S2723) (S2642) (S2737)(S2623)( S 2 6 2 4 )(N 22S)(N 2 2 S )(S2625)(S2642) (S 2 6 2 6 ) (11 1 8 ) (5400) (6015) (5137)(984)(2100)(6400) (5160)(5303)(5453)(1009)(5200) (5 5 00)(1000)(56 4 7 ) (5360) (5500) (90 0 ) (5285)(1056)(7 1 4 ) (5600) (5537)(1892)(1600)(12 0 0 )(761)(5738) (8 0 0 ) BURGESS FARM DR NC HWY22SOLD S ILERCITYRD SPRINGVIEW ST SUNSET OAKS DR STOUTACRESRDPARKS CROSSRDS CHURCH RDHUFF CTRY TRLGREENFIELD STPARKWOOD RD EASTVIEW LN JOE DEAN TRLSTOUT VIEW STBROOKHAVEN RD E DWARDS F ARMRDW ILLIAM B URGESSRD HAWK FAR M R DCANOYFARMRD LEE LAY N E R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D8 D7 D7b E7d D7a E8E7r D7b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Ramseur Ramseur (S2616)(S2618)(S2619)(S2615)(S2618)(2059)(2300)(2203)(2073)(2100)(2195)(4212)(2072)(250 6 ) (4427) (2102)(2 4 00)(400)(4600) (4411) (250 0 )(444)(2106)(4519)(1023)(2061)(4 6 4 6 ) (4400)(823)(600)(925)BROOKLYN AVEDIXONSTWOODELLAVEW JONES STJONESSTEXT MEG A N D R NEWELLST EXTTAY LOR CT ROUNDLEA F R DWATEROAK DRNEWELLSTPLEASA N TRID G EC H U R C H R D ISOM RDBROOKLYN AVE EXTWILLIAMS RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D7a D7e D6b E7qE6t E7r D7e Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Back Bran c h Brush Cr e e k M illstone C reekB r o a d MouthBranch WRENNSMITHRDMOONS CHAPEL RDCOLERIDGERD ELISEA VESTAL RD L UCI LLECHEEKDR CHANDLER LNASHLEY CTVICTORYLN HALCLARKRD L A MBERTCHAPELRD (O8888) (S2723) ( S26 6 2 ) (S2638) (S2 6 2 9 ) (S2635) (S2626)(S2634)(S 2 6 3 6 )(S 2 639) (S2633) (S2629)(S2628)(S2 6 3 0 )(S2632)(S2642)(2500)(2 3 1 4 ) (6400) (5738) (6015) (290 0 )(424)(400) (8100)(2080) (2 2 5 1)(1100)(7100)(2889)(1400)(6 719)(6081) (7800) (6851)(1900)(1600)(7 4 0 3) (8 0 0)(2000 )(1126)(6600)(2200)(7100) (6011)(2526)(6500) (7 4 0 0 )(6706)(730 0 ) (7 400) ( 2 400)(2100)(1700)(1500)(1 3 0 0 )(6300)(6920)MANO R ROCKRDPARKSCROSSRDSCHURCHRD WRENN SMITH RDOLDSILERCITYRD MOONS CHAPEL R D BURGESS FARMDR WIL LI EWR I GHT RDFRAZIER RDWARDFARMRD KIL DE ECHUR CHR D AUTUMN RIDGE DRBURGESSKIVETTRD OLDCOLERIDGERDROYAL RIDGE RD BROWE R D A L E RDLEELAYNERD BURGESSCATTLEDR TROY CAVENESS R D M IC H A EL DR C OLTRANEMEADOWRD OHSTALEYRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D8 E8 C8C7 D7 D7b E7d D8 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet BrierC reekLittle Uwh ar ri e River(WheatmorePond) HUG H E S G R OVECHURC H RD KINDLEY R DE OLD HWY 64ROCKYLN LUK E D R HANNERVILLERD RENEE DR HALTOM RDNOAHTOWN RDROCKY DRC H R ISTMASLN PARRI SHDRBLACKBERRYRD WRIGHTRDH A W K NESTDRVIOLA LNFOREST RIDGE LNE US H W Y 6 4 LOVETTERDSOLES DRPINEMEADOWDRBIGJON RDCABERD A MSTUTZDRROGERJENNINGSLNCHASERDHI L L R D RUSSELL DR BRAMBLEWOODDR SW E ETBRIARRDKIN D L E Y RD (S1344) (S1404) (O9999) (S1 3 9 2)(O9999)(S1637)(S1345)(S1364)(S1357) (S 1 400 )(S1341)(S1401)(S1403)(U 64W)(S1344)(S1401)(S1339)(8200)(7900)(1278)(0) (274 )(1844 ) (400) (7222)(335)(1384)(553) (630 0)(600)(526)(7390)(718)(7377) (6071) (6835) (1053) (9381) (7500)(700)(6 6 0 0 ) (8900) (9600)(6287 ) (10 0 0 )(7200)(7 0 00 ) (6415)(7926)(7 65 4 ) (6400) (8100) (3 2 9 )(800)(6650) (9100) (5900)(7275 )(500)(627)(900)(900) (8400) (6200)(6700)(100)(1300) (703 ) O L D U S H W Y 6 4 FULLERMILLRDNRO S S W O O D R DMISTYDRHUGHESGRO V ERD GADDY CIRRUSSELL S UMMEY D RFULLERMI LLRDS CHIPPE RTRLPINE NEEDLETRLVIOLA DR KINNEYWO O DSWAY ASHETONDR WESTFIELD C HU R CH RD US HWY 64 W FLAKEBRILESRDBLUE Q UARTZDR BRILESMEADO WRDOLDPOSTOFFICERDHOMESTEADRDJANDANDRFOXRUNVIEWLNKENNEDY FARM RD NGRAYROCKRDSLOFLINHILLRDGRAYROCKRDNCHARLIEHARRISRD KENNEDYFARMRDS² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E1 F1 D1 D2 F2c E2c E2a E1 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Little Uwharrie River(Whe atm ore P o n d) U w h a r rie Rive r (S3116)( S 1 4 05)(S1407)(S 1550)(S1406) (S3184) (S3 1 6 1 )(S1549)(S1405)(1001)(1194)(5500)(968)(5400) (11 0 0) (1382) (5548)(1048)(6071)(1244)(1044)(1147)(943)(1238)(4990)(5613)(55 1 7 ) (1300) ( 5 8 2 6 ) (5300) (510 0 )(1100)(1600)(876)(1400)(5396) (142 7) (59 2 2 )(5600) (5200)(300)(1219)(1000)(1200)(200)PLANTAT ION DR FOREST LAKE D R KOONCEDRSTANTON RDEVANS DR ORALN PARINNA D R TABERNACLECHURCHRDSK EE N S MILLRD COVEREDBRIDGERD HARRIS RDASHETON DR INDIANCREEKDRVICKREYDRSTONEY R I VE R DR KOONCECT TUTLOHRDRTHAYERRDPLANTATION WAYPARINNA RD W ILDERN ESSTRL² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E1 E2a F2c E2c E2b F1 F2d E2d E2a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Little CarawayCreek (S1407)(S2061)(S2060)(S1408)(S1539) (S3115) (S1636) (S3117) (S3266) (S16 8 6)(S3161)(S3 1 1 9 )(S1406)(S157 4 )(S 3118)(S1408)(1194)(1048)(1100)(4848)(1600)(876)(1336)(1600)(2100 )(1500)(2349)(1412)(1001)(4893) (4900)(2500)(4153 )(800)(15 0 5 ) (4681 )(2200)(4600) (1 6 0 0) (4428) (47 0 0 ) (5000 )(1501)(4800) ( 4 0 0)(1219)(1276 )(4990)(4300)(4 5 0 0)(1660) COVERED BRIDGE R D KOO N C E C T KOONCEDRHARRIS RDFOREST LAKE DRCREEKSCROSSING RD HOOVERHI L L RDWISCHUM WAYTHAYER RDWATERCRESTTRL BEAU CT EARNHARDTRD MOUNTAIN VIE W DR SLICKROCKMTNRD JORDANVALLEYRDM O UNTAI N M EADOWDRRED FOX TRL C A S H ATT R D DOGWOOD TRL HUNTERS W O O DSDR MTSHEP HE RD RDEXT LI NDA LN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E2bE2a E3a F2d E2d F2c F3c E2c E3c E2b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Uwharrie River (S1393)(S1409)(S1807)(S13 1 1)(S1344) (S1405) (S1357) (U 6 4 W )(S1335)(S 1 3 9 0 ) (U 6 4 W )(S1311)(6100) (500 0 ) (800 0 ) (6600)(6800)(6900) (5317) (6200 ) (100) (6400)(300) (810 0 ) (7000)(200)(300)(5900) (780 0 ) (5205) (5920)(200)(5 4 0 0 ) (72 0 0 ) (100 ) G ALLI M O RE T O W N R D TABERNACLESCHOOLRDROUNDCLIFFDRUS H W Y 6 4 W LAKEPARKRDKINDLEYRDTABERNACL E C HU R C H R DEXTOLDUSHWY64 WOODFI ELDSCOUTTRLTABER N A C L ECHURCHRDWILDERNESSTRLBRILESMEADOWRD RUSHMTNRDEXT RUSHMTNRDBES CHER CHAP E L RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E1 D2 E2c E2a E2d D1 E2b E2c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet UwharrieR i ver(S1 3 82)(S3224)(S3135)(S1807) ( S1408 )(S3155)(S 1 8 4 3 )(S1792)(S1409)(S1333)(S1397)(S1332)(U 64W) (S1372)(S1735)(S1410)(U 64W) (S1686)(S1408)(400)(5923) (6800) (407) (700) (4060) (531 7 ) (5928) (500) (268) (6300) (550) (4900) (5200 )(309)(450 0 )(100)(4890)(267)(200)(4414) (4600)(398)(4800) (6400) (6600) (300)(6000) (41 5 7 ) (10 0 )(300)(800)(500 0 ) (5600)(400)(800)SUMMIT CTUS HWY 64 WLAKEPARKRDHOOVERHILLRDROBBI N S C I R TABERN A C L E S C H O OL R D RIDGESMTNTRL OLDROADDRSPRING FOREST RDCAMERONDR CAMERON PLGARDENGATE RD RICHC T R Y DR K INDLEY RD CAMERON C IR GARREN TOWN RDLLOYDSTSCENIC POINT DRWOODFI ELDSCOUTT R L MTSHEPHERDRD JONES RDMTSHEPHERDRDEXT² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR D2 E2d E3cE2c E2bE2a E3a D3a E2d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet CarawayCreek LittleCarawayCreek (S1414)(S1539) (S1539)(S1412)(3700) (4 9 8 6 )(1475)(1300)(3984)(1615 ) (1600) (1 6 0 5 )(4 0 41)(1 8 0 0 ) (4153)(1 6 00)(3 410)(3100)(3716)(1105) EARNHARDT RD CAR A W A Y M T N R D MTV IE W CHURCHRDBLUEBILLLNSAVANNAH DR NIG H T H AW K R D JERICH OB UT L E RD RMOUNTAINMEADOWDR JERICORD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E3a F3c E3c E3bE2b F2d F3d E2d E3d E3a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Caraway Creek (S3164)(S1413) (S3 1 6 5 )(S1004)(S3162)(S1004)(S3156)(S1415)(2351)(4338)(2342)(2700)(2611) (2571)(2487)(4355)(2130)(2632)(4400) (1600)(2 6 0 3)(1426) (2 0 8 5 )(1700)( 4 100 ) (2400) (4 7 6 5 )(1361)(2200)(1700)(1988)(446 9 )(2800)(4986) (1 900)SPRING GARDEN CTCARAWAYMTNRD PLOTT HOUND TRL WOODFIELDDRCARAW AYSPR INGS TRL RACE TRACK RD EXTMTVIEWCHURCHRD BUCK M O U N TA IN TRLSILVERMTN TRLMIL L R A C E C T OLDCOUNTYFARMRDCARAWAYS U M MITTRL RACE TRACK RD SNOWBERRY TRL CAMPM U NDOVISTATRL CONFERENCECENTERDR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E3bE3a F3d E3d F3c F4c E3c E4c E4a E4e E3b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet CarawayCreekLittl eCar awa yCr eek (S3136 ) (S1877)(S2045)(S3200)(S1416)(S1418)(S 1 4 1 2 ) (S1416 )(S1413)(U 64 W ) (S1411)(S1411)(5006)(5500) (4500)(3577)(3554)(100)(4306)(2 99 6)(1100)(100)(300)(1475)(5100) (3400)(1200)(3600)(4697)(576)(368)(252)(1314)(4800 )(4 5 27) (3200)(443)(4817)(1105) (70 0 ) (520 0 ) (974) (7 1 6 )(200)SPENCER MEADOW RDUS H W Y 6 4 W OLD LEXINGTON RDMOUNTAINBROO K R DH ILLSD ALECTMOUNTAIN BR O O K R D E X T CLUB VI E W D R T R A NQUI L LNMTVIEWCHURCHRDMTSHEPHERDRDAPPLEGATE LN HILLSDALECT WHIPPO O R W I L L D R M O U N TA IN TER DYNASTY DRNORTHCLUBDRKEYAUW EE RIDGE RD J ERI CORDJARVISMILLERRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E3c E3a E3dE2d D3aD2 E2b E3b D3b E3c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet B ackCree k(BackCreekLake)Cedar ForkCreek Back Creek Asheboro (S1 4 9 4 ) (S1413)(S1413)(S1877)(S1418)(S1520)(S1415)(S1 0 0 4 )(S1420)(S1415)(S1416)(4500) (875)(4001)(1361) (1228 ) ( 4 1 0 0) (3 3 0 0 ) (7 1 4 )(800)(2996) (37 0 0 ) (4306) (1966) (70 0) (9 0 0) (4100) (3000)(674)(443)(711) (2204)(1700)(3 8 1 0 ) (2300) (280 0 )(1400)(16 0 0 )(906)(2700)(892)(3400 ) SP E N C E R M E A DOW R D O LD LEXIN G TO N R D W RIVER RUN CARAWAYSUM MITTRL BACK CREEK RDC A R AW A Y M T N RD GR E E N FA R M R D T R ANQUIL LN M T V I EW CHURCHRD MTVIEWCHURCHRDHANNE R H ILL R D WHIPPO O R W I L L D R SPENCERMEADOWRDSMYRNA GROVE DR J E N NI NGSCTRYDRSILVER SPRINGS RD O L D C O U N T Y FAR M R D B EE CHWOODDR HUGHES DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E3dE3c E4c E3b D3b E3a D3a D4a E4a E3d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet BackCreek BackCreek(Ba c k C re e k Lake)(S 3 1 59)(S1415)(S1518)(S3163)(S1518)(S1511) (S1 5 0 4 ) (S3162)(S3148)(S1519) (S1515)(S3143)(S3244) (S1712)(2077)(2000) (1 4 81)(2810)(1100)(2159)(206 5 )(2660)(2351)(1900) (2 4 8 0 )(2500)(1700)(3159)(1721)(2744)(3100)(2080)(2400)(3300)(2200)(2119)(2997)(14 0 0 )(3088)(2396)(2217)(2014) (1200) (2031 ) (2 0 8 5) (1800 ) (1813) (2100)(2380)(1767)(1813) (1246) (1900)(1988)(1300)(2480)(2900)(2600)(2798)(1426) (1400) (2126) (2700) (2 2 0 0 ) LAKE CTRY DROLD COUNTY FARM RDLAKE LUCAS RD MILLPONDDR BENTONRD EXT BENTONRDMORNINGDEW DRSUNDEW DRCARAWAY DR TORY LNMILL POND DR EXTCOO L S H A D E D R EDENFORESTDRWOODFIELD DR SPRINGGARDENCTPI NE VIE WRD W O O D F I E L D C T E X T PLAINFIELDRD WOODFIELDCTGI B NE YMCCRACKENTRL PATRI OTWOODSDRRACETRACKRD AKINSSTHEATHDAIR Y R D COOLERSKNOBTRLSPERORDMILL R A C E C T CARAWAYCT WESTWINDWAYFOXFIELDRD BETSY LN S ILVER MTNTRL ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4a F4c E4c E3b F3d F4d E3d E4k E4gE4e E4o E4a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet BackCre e k(BackCreekLake)BackCreek L ongBranch Cedar Fork Creek Greenes Branch Asheboro (S3226)(S3159) (S1519) (S100 4 )(S3101)(S2083)(S1889)(S1004)(S1518 )(2200)(1000)(1179)(1777)(2119)(2000)(1010)(2204) (1047)(2080)(2700) (16 3 0 ) (2300)(1300)(2026)(114 4)(1541)(1638)(2077)(1535)(1130)(16 3 0 ) (18 9 6 )(1629)(973)(1481)(1426)(1400) (1033 ) (1767) (21 3 6 ) (2000 ) (1473)(1367)(2418)(1071)(2400) (1659)(1862)(875)(2800)(1300)(1489)LAKE LU CAS R D BERRIE PL WILSON D R W RIVER R U N CLETUSLN AKINS STVI E W MONTDRBLUEBIRDLNCHAMBERLIN DRSILVER SPRINGS RD PATRIOTWOODSDROLDLEXINGTONRD CHARLOTTECHU RCHRDPINENEEDLESDR SYLVANWAY WESTLAKEDRERIVERRUNRICHARDSONFARMRDCEDARCREEKDRLAKE CTRY DR SILVERMTN TRLERI VERRUNEXTFOXFIELDRD FAWN DR MOUNTAINLAKERD LITTLELAKESTRLLAKECTRYDREXT² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4cE3d E4a D4a E3b D3b E4s E4k E4o D4g E4c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet (S3144)(S3164)(S1 518 )(S1518)(S3165)(S3162)(S3148)(S3143)(S1415)(2810)(2100) (206 5 )(2660)(2300)(2351)(2480) (1700)(3159)(1721)(2744)(2400)(3100)(3300)(2 0 8 5)(2997)(2217)(2100) (1800) (1813)(2380)(1900)(2600)(2798)(2 2 0 0 ) BENTON RD EXT MORNINGDEW DRBENTON RD SUNDEW DRFERNWOODFORESTRD CARAWAY DRCOO L S H A D E D R EDENFORESTDRWOODFI ELDDRSPRINGGARDENCTWO O DFIELD CT EXT PLAINFIELD RDWOODFIELDCTG IB N E YM C CR A CKE N T RL MILL R A C E CT OLDCOUNTYFARMRDCARAWAY CT WESTWINDWAYL AK E L UC A S R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4a E4e F4c E3b F3d E4e Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet B ac k Creek Asheboro Asheboro (S1712)(S1508)(I73/74)(S3137)(R73/74)(I73/74)(2032)(27 2 5 )(2663)(26 3 9 ) (1100)(1053) (275 6 )(1000)(3088)(2023)(1943)(2757)( 0 )(1924)(2744)(1134) (140 0 )(1977)(1978)INTERSTATEHWY73/74LAZYPINERDBOBCAT TRLPINEVIEW R D G RANTTR LH EATH DAIRYRDHOPEWOOD RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4g E4a F4d E4k E4h E4l F4c E4g Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Asheboro (S3264)(U 220BUS)(S1508)(S3102) (S1712)(S3102)(501) (1000) (475)(2428)(2442)(2443)(4510)(2152)(2757)(4402) (851)(2900)(4600)(736)(100) (300)(2500)(100)(438)IDLEWILD DR HOPEWOODRD MCKNIGHT ST PINEVIEWRD PINEVIEW ST SYLVAN DRBANK STUS HWY 220 BUS NCARLDRHOPEW O ODRDN FAYETTEVILLE STTAYLORDRCOMMERCE PL QUAKER DR ART BRYAN DR NORTHWOOD DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4h F4d E4l E4g E5e E5iE4k F5q E4h Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet B a c kC reek(S1504) (S2081)(S 3 1 3 7)(S1515) (S1504)(I73/74)(R 73/74)(S1504)(S1516 )(I73/74)(400)(1978)(0)(1200) (1246) (18 0 0 )(2326)(1342 ) (1300)(1071)(1238) (2031) (1200)(2080)(2 6 3 9 ) (165 7 )(2663)(1 100)(2078)(2400)(150 0 )(2079)(0) (18 1 3 ) ( 230 0 )(2023)(2032)ROCK QUA R R Y R D COOLERS KNOB TRL TORY L N SPERORD DAVIDSONRDSPERO RDPATRIOTWOODSDRR O C KW O O D R D LA Z Y P I N E R D BOBCAT TRLFRYEFARMSRDINTERSTATE HWY 73/74LAMBCTRYRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4k E4a E4l E4g E4oE4c E4h E4p E4k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet H a skettCreekAsheboro (S1504) (R 73 /7 4 ) (S1506)(285)(102) (1071)(2138)(2146)(278)(281)(216) (100) (249) (265)(2100)(224) ( 0 )(500) (191) (153) (300) (100) (2 0 0 0) (400)(2152)(1)CREEKSIDEDRYZEX ST SPERO RD ROSE LNW C E N T R A L AVE ASPENCT DUNWOODYCT GREENTREECT RAVENWOODDR CHAMPAGNEDRGREENVALERD CARL DR ROCK QUARRY RD FOREST BROOK CIR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4l E5iE4k E4p E4hE4g E5e E4o E5m E4l Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet G reenes B ra n c h Asheboro(S2081)(S3 1 9 0 ) (S1504) (S3276) (S1517)(S2083 )(S3282)(I73/74)(S3196) ( R 73 / 7 4 )(S3196)(I73/74)(1000) (0 )(2000)(2300)(1075) (1238)(2080)(1200)(1071)(1300) (851)(2026)(846)(2194)(1342)(2326)(2258) (2012)(2190)( 2 300)(2418)(2079)(9 0 0 )(2078)(1900)(2373)(2400)(2200)(2123)(2124)SPERORD LAMB CTRY RDBER K L E Y P L MOUNTAINVALLEYDRPATRIOTWOODSDR CHARTIERCT WELLINGTONPL MOUNTAINVALLEYPLNORTHMONT DRDAVIDSON RD DAVIDSON RD EXTDAVIDSON CTRY LNM O UNTAI N LAKE RD INTERSTATEHWY73/74NORTHMONT LAKE DRCOUNTRY LN² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4o E4c E4s E4k E4p E4l E4t E4a E4o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Ha s ke tt C re ek Greenes B ra nchAsheboro (U 220BUS)(I73/74)(S1504)(R 73/74)(S1 5 0 2 )(I73/74)(1837)(418) (1833 ) (414) (314)(1860)(210 )(2078)(1071) (200)(1814)(1528)(22 0 )(4 0 4)(1526)(1547)(18 4 0 )(1530)(1832)(527)(1821)(100 ) (201 ) (300)(1804)(1839)(1846)(900)(1736)(1807)(600) (210) (500) (114) (1000)(1814)(500)(2079)(300)(1600)(530) (218)(0)(64 1 )(1700)(1590)( 1 9 9 5 )(2124)(2123)E BEASLEY STCANOY DRW BALF O U R A V E AMEL IA CT W BEASLEY STSEWELLDR N FAYETTEVILLE STW BAILEY ST W CENTR A L A VE SPERO RD SADDLEWOODC T N TREMONT DRSHADY DRTER R Y A V E HENSON RDRANDALL STYORKTOWN LNCLEGG AV E JORDAN A V E NORTHASHEBOROSCHOOLRDINTERSTATE HWY 73/74THORNSDALE DRSKY DRBURMIL RDNOTTINGHAMST² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4p E4l E4t E4o E5m E5i E4s E4k E5q E4p Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet LongBranch Asheboro (I73/74)(S3220)(S3196)(S1 8 7 1 ) (S 1 8 7 2)(S1873)(S3 1 9 0 )(R73/74) (S1875) (S1 8 74)(S3171)(S1870)(S2 2 6 9 )(S3202)(S1876)(1400)(1227) (1069) (700) (9 6 9 )(1700)(1100)(1000)(104 3)(1700)(19 0 0 )(1600)(1300)(1047) (1300)(2300)(732)(640)(1930) (900)(1167)(800)(1589)(1583)(0)(1 7 7 7 )(1000) (1800)(1100)(2100)(1200)INTERSTATE HWY 73/74VIEWM O N TDRWESTOVERTEROAKMONT DRNEELY D R NORTHMONT DRGREENMONTDR BERRIE PL WIL S ON C T VIEWMONTCTNEELYDRHARPERRDBACK CREEK CTBE R K L E Y P L TUDOR DRWOODSIDE PL BERKLEY LN HEATHERGL E N N PL NROCKRIDGERDIDLEWOODD R GUMTREERDBREVARDDRVISIONDRM ONARCHLNWILSON DR LAURA CT THAYER D R ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4s E4c E4t E4o D4g E4p D4a D4h E4s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet HaskettCreekAsheboro Asheboro (U 220BUS)(U 220BUS)(S2065)(I73/74)(R73/74)( S 2269 )(I73/74)(235)(1421)(1521)(1230)(1445)(1433)(1453)(323)(317) (124)(1436)(1547)(1505)(1238)(1450)(1509)(1500)(1301)(300)(1106)(1322)(208) (215)(302)(1530)(1100)(1528)(1526)(1240)(100) (200)(0)(2123)(200)(2215)(2187)(2210)(2124)(100) VALLEY RD BRITTAIN ST W ALLRED ST SAUNDERS DROLD LIBERTY RDN FAYETTEVILLE STS TREMONT DRSHEFFIELD S T N FAYETTEVILLE STJAMES STKENNELW O O D D R TREMONT DRN TREMONT DRVERNON ST MOODY STMCLAURIN DR BARBER ST SHADY DRNORTHSIDETERARTHUR ST WOODBURY STTHORNSDALE DRWOODCREST RD VISION D R INTERSTATE HWY 73/74² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E4tE4s E4p E5q D4h E4o D4g D5e E5m E4t Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Haskett Creek Deep River (S2128 )(S2 2 1 5 )(S2219 )(S2 1 4 4 )(S2374)(S2145) (S214 3 ) (S2144 ) (S2233)(S2267)(S2261)(S2132)(1600)(1320)(2 2 0 0 )(1928) (15 6 9 ) (141 6 )(2 2 1 0 ) (1 4 2 8)(1951)(1900)(1562)(2271)(1400)(1290)(1821)(1429)(1514)(3000) (190 8 ) (1700 )(2270)( 2 0 3 8 ) (15 2 8 ) (976) (1638 )(2805)(1774) (190 4 ) (10 0 0 ) (2000 )(2000)(1617 )(1100)(1 2 13 )(2400)(1 9 0 0 )OLDLIBERTYRDW O W RDHE NL E Y C T R Y R DLAUGHLINRD EX T PENN SYLV AN IA A V E G A N T S T D U MON T S TRIV E R F L O W D R AYCOCK S T S HER ONCTRY DR WILLIAMPENNDR WICKER LOVELL RD LITTLEPOINTRD PINEHOLLO W DR OLD CROSSING DR LEONARDYORK DR FAITH WAY TRL BARKW O O DR D PEARLCTCARL A L L R E D R D FOXCTRYRD LAU GHLINR D CO U N TYLAN D RDFRA N K L I N DRGEORGE YORK RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5b E6a F5d E5d F6c E5j E5f F5r E5k E5n E6m E5b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet GabrielsC reekDeepRiver Asheboro Franklinville (S2356) (S2357) (S2326) (S2218)(S2216) (S 2 2 1 6 )(S237 7 ) (S2221)(S2267)(S2215)( S2 2 2 2 )(S2215)(S2217) (1 0 7 8 ) (1900)(1487)(1500)(1718) (1144)(1423)(1 0 9 8 )(1018)(1 2 0 0 )(130 0 )(132 1 )(3500)(3300)(1900 )(80 0) (194)(112)(9 0 0 ) (100)(1100)(1562 )(400)(132)(2525)(1 1 0 0 )(2900) TRA I N I N G C E N T E R D R HENLEY CTRY RD VALLEY DALE LN DAVID LNR A N D O LPH TABERNACLERDBEECH TREE PL GILES CHAPELRD FOG G Y TOP R D LOFLIN POND RDWALTERSAU N DERSDRHUDSON LNMAPLE RIDGERDTON YSW A Y OLDCEDARFAL L S R D CEDAR WOODPL BRECKENWOOD CT S UNFL OWERDRTROGDONPONDRDCOUNTYLANDRD FOXWORTHRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5d E6aE5jE5b E5r E5s D5f E5k D5b E5n E6q D5g D6e E6m E5d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Asheboro Asheboro (S3102) (U 220BUS)(S3267)(S2383)(S2390)(S3268) (S3280)(U 220BUS)(S 2 1 50 )(S2312) (S 2 3 14 ) (S3264) (28 9 ) (2 3 5 4 )(1865)(2536 )(2479)(2521) (601)(383)(709)(260)(2320)(245)(1600)(1878)(511)(218)(700) (2 3 5 5 )(2425)(2455)(1773)( 3 0 0 ) (2475) (2 3 6 5 )(2219)(2363)(700) (500) (1200) (312) (27 0 )(2311)(2444)(690)(1964)(2409)(46 0)(2442)(700)(2410)(219 )(2161)(406)(2061)(2260)(2426)( 2631 )(2558)(251)(2354)(734)( 2 900 )(480)(2454)(4510)(2442)(2 4 00 )(243)(2 5 0 0 )(26 3 6 )(708)(2600) (600)(4402)(510) (660) (600)(2334)(2 7 7 8 )(4600)( 2 7 00 ) (100) (500)(2377)(400) (50 3 )(710)( 2 455 )(2302)(2386)( 2 50 0 )(294) (616)(246)(2431)(2400)(400) (100)RANDL E BORO RD COMMERCE PL N O R T H ME A D O WS L O O PIDLEWILDDREXTLEOLN OLD CAS T L E D R CAUSEYDR PAMPASS PLHUBMORRISRD WRENWOOD CT WATERFRONTCT LEONAE DRROCKAWA Y D R WILLOWOOD DR BI R C H B A R K L NWATERSIDE DRFOR E ST PAR KDRN FAYETTEVILLE ST WATERVIEW CT A S HEWOOD CIR CEDARDALEC T BOUNDARYDR LANDI SCT PARK TRL PINEVIEW ST MCKNIGHT ST M O R N IN G G L O R Y R DUS HWY 220 BUS N ART BRYAN DR WALNU T R IDG E RD W IN D S T O N E CT IVY CREEK DRSIXTH PARK AVE FIFTH PARK AVE FOURTH PARK AVE THIRD PARK AVE SECOND PARK AVE FIRST PARK AVE NORTHWOOD DR FOREST EAST LN HICKORY FOREST DRHICKORYFORESTDRWOODBREE Z E DRIDLEWILD DR WHIR LW IND LN DOOLEY DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5e E5i E5f F5q E4h E4l E5j F5rF4d E5e Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet HaskettCreek DeepRi verAsheboro Asheboro(S2331)(S2312) (S3280)(S2332)(S2128 ) (S2 1 2 8 ) (2535 )(734)(636)(2100)(2181)(2152) (601) (813) (600)(708)(2300)(2200)(2400)(2317)(2600)(2500)(2276)(2320)(2563)(2700)(2357)(771)(660) (510) (600) (701)(2555)(700) (637) (649)(2557)(710)(2524)(2202)(750) (900) (2284 ) (749) (2475) ( 2 394 )(1000)(1924 ) NORTH MEADOWS LOOP W O W RDBUCKHORN DRPAMPASSPLOLD CASTLE DR ROSEMARY DRRYANDRWILLOWOOD DR FOREST EAST LN IVY CREEK DRFIFTH PARK AVE STRAWBERRYLNNORTH MEADOWS LOOPSTONE ARBOR DRMORNING GLORY RD SECOND PARK AVE FIRST PARK AVE THIRD PARK AVE FOURTH PARK AVE SIXTH PARK AVE BUTTERFLY TRL PEPPERTREERDGROYAL DRRAINTREE CT ANDERSON DR FOX CTRY RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5f E5j F5r E5e E5b E5i E5k F5dF5q E5f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet H askettCreek PenwoodBranch Asheboro (U 220BUS)(U 220BUS)(2308)(680) (216) (200)(204)(1948)(1946)(1932)(700)( 2 3 5 4 ) (600) (500) (1600)(682)(191)(2136)(300)(2311)(281)(2109)(1944)(471)(285)(210) (315) (2 2 8 8 ) (2 3 5 5 ) (1)(2057)(512)(2047)(845)(300) (153)(2042)(2023)(2024)(900)(503) (510) (400)(2320)(919 ) (500) (69 0 )(0)(2002)(61 6 ) (149)(2000)(2035)(2106)(2018)(2377)(310)(2137)(2000)(2001)(100) (102) (80 0 ) (2302) (100)(2040)(208)(2144)N FAYETTEVILLE STE CENTRAL AVE M EAD O W G A T ED RYZEX ST SUNRISE AVE MCPHERSON STJONES STDOVER STN O R THM EA DOWSLOOPBONKEMEYER CTRYTRL BONKEMEYER DR GREENTREECT CREEKSIDEDRKING CTANGUSTRL JU N I P E R C T WINTER STGLEN CIR HUB MORRIS RDASHEWOO D CIRYANCEY AVELINEBERRYSTGREENLAWN DR KELLY CIR GOLDA AVE WI L LO W OOD DR FORESTBRO O K CI R WALNUTSTVINCENT DRHICKORYFORESTDRCHAMPAGNE DRHOLLANDSTGREENVALE RD WCENTRALAVE LAMAR DR ECKERD ST ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5iE4l E5j E5e E5m E5fE4h E5nE4p E5i Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Deep R iver H a s k e ttC reekPenwoodBranch Asheboro Asheboro Asheboro Asheboro (S2128)(S2148)(1409) (471)(1430) (2 2 0 0 )(1900) (1357)(1 1 23)(2320)(1416)(2126)(800 ) (1162)(976)(1900)(1140)(2112)(1136)(2 403)(845)(1413)(900)(2 2 1 0 ) (1700)(849)(2140 )(2142)(2 1 0 0 ) (1100) (2431 )(2027)(1116) (600) (2 2 0 4 ) (1 1 0 6)(2030)(936)(1924)(1749) (1320)(5 00)(782)(1000)(800) (919 )(1208)(2162)OLD LIBERTY RDPENN SYLVANIAAVE HE N L E Y C TR Y RD ANGUSTRL WINDOVER RD AYCOCK S T G A N T S T W O W RDNORTH MEADOWS LOOPREGENCYDRHUBMORRISRD PEARLCTGOLDHILLRDH E A T H W O O D R D REGENCY DR GEORGECONNORRD SARINA DRMACHALA DRBARCLAY P L BONKEMEYERCTRYTRL HO P EW E L L S T HERI T A G E C T PHILLIPSRDBONKEMEYER DR WARD VALLEY DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5jE5i E5f E5k E5n E5e E5b E5dE5m E5j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Deep River Asheboro (S 2 2 1 5 )(S2219 )(S2374)(S2261)(S2145)(S2267)(2135) (2 2 0 0 )(1928) (1416 )(1413) (156 9 ) (2 1 43 ) (2 2 1 0 ) ( 2 0 0 0 )(1 4 30 )(1428)(1562)(1900)(1290)(1429) ( 2 0 3 8 )(976)(2000)(1100)HE N L E Y CTR Y RDG A N T S T D U MO N T S TOLD LIBE R T Y R D PEN NSY LV A N IA A V E RIVE R F L O W D R A Y C O CK ST LITTLE POINT RD BARKWOOD RDPEARLCTCOUNTY LA N D RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5b E5k E5d E5j E5f E5n E5k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet PenwoodBr anc hAsheboro(U 220BUS)(U 220BUS)(2000)(201) (114) (43 0 )(507)(908)(51 8 ) (32 6 )(1628)(402 ) (900)(1613)(31 4 )(420)(1528)(511)(1806)(505)(217)(401)(1932)(1718)(1944)(200) (41 8 )(71 8)(1732)(1730)(52 2 )(1741)(40 0 )(1819)(1750)(813) (600) (1 8 1 8 )(1820)(1913)(431)(1818)(310)(500)(1625)(1948)(800)(619)(1600)(1946)(1700)(300)(1900)(1557)(100)(523)(400)(1800)(202)(600)(700) (100)(1932)(1900)(1934)(200)WALNUT STECENTRALAVE UNDERWOOD ST W BAILEY ST OLD LIBERTY RDSHARON AVE CENTRALFALLSRD JOR D A N S T TRACI STMIL L I K A N A V E W BEASLEY STTHORNSDALE DRPLEASANTSTDRAPER ST HINSHAW STE BAILEY STN FAYETTEVILLE STPORTAGE PKWYE BEASLEY ST E BALFOUR AVEFLINT STOAK BEND DRNEWELL STWINDCRESTRDVIRGINIA AVE LEVANCE STPINE KNOLL CTSIMPSON AVE CELESTELN H U G H E S S T MCPHERSONSTFRANCIS ST S P IN K S S T HUMBLEHOLLOWDRJONES STW B A L F O U R A V E DOVER STPOPLAR ST WSTRIDER ST CEDARRDHUMBLESTE STRIDER ST TU R N E R S T BENNETT STGREENWOODRDWILLOWRDLAKEVIEW R D ROSEBORO DR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5m E5i E5q E5nE4p E4l E5j E4t E5r E5m Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet PenwoodBranch Asheboro (S2357) (S 2 3 25)( S2183 ) (S22 1 8 )(813) (800)(1339) (1585) (1651) (1568)(1641)(1003)(18 1 8)(1828)(1814)( 1 5 0 0 )(1800)(1613) (1480) (1100) (1 6 0 0 )(1400)(1122) (104 7 )(1934)(936)(900) (1000) (1429 ) (1 7 3 2 ) (1120)(1816)( 13 0 0 )(1900)(908)(142 2 )CENTRAL FALLS RDOLDLIBERTYRDR OBI NS NES TDRFINCHLEY CT BOBWHITE L N JOHNNYS WAYRAYBURNSTGOLDHI LL RD COUNTRYPLACE R DBURGESSSTORIOLE DR BEECH TREE PL DRAPE R S TLAKEVIEW R D LEVANCE STCORNELL ST SANFORDST RIDGEWOODCIR GILESCHAPELRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5n E5j E5r E5dE5m E5i E5s E5k E5q E5n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet PenwoodB ranch Asheboro Asheboro (S2293)(S2247)(U 220BUS)(S2257)(S2258)(S2259) (S2250)(U220BUS)(S2289)(S2182)(S2272)(S2292)(155 5 ) (700)(1323)(1409)(1230)(1445)(1453)(1024)(1500)(400)(1436)(1505)(107)(1526)(1238)(104) (600)(1450)(1402)(222)(791)(217)(1440)(1648)(1620)(110) (600)(836)(500) (155 7 )(1106)(1154)(600)(208) (800)(1300)(1301)(700) (100)(1528)(500)(1507)(310) (775) (400)(1320)(300)(1100)(875)(200)(900)(1200)(100 )(1000)HUMBLEST WINDSOR T R L MEADOWBROOKRDE A L L R E D S TN FAYETTEVILLE STWOODCREST RD OLD LIBERTY RDSNOWDON CT ITASCA CT WESTMINSTER DR SAUNDERS DR ARTHUR ST TREMONT DR VISION DR HONEYSUCKLE RD WOODBURY ST VERNON ST W ALLRED ST CRACKLINDRNORTHSHORE DRBOLING DRHASTY STMEADOWBROOKRDEXTASHLEY ST KEYSTONEDRWINNETKACTHUMBLEHOLLOWDR SCENIC DR ETON AVESHEFFIELD S T RAINBOW DR IDEALDR ENGLISHST BRITTAIN ST WINDSOR DR FERN DRCAMELOT DRHUGHES ST VALLEY RD HARVEST CIRINGRAMDR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5qE4t E5r D5e E5m D5f E4p E5n D4h E5q Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet PenwoodBranch Asheboro Asheboro (S2371) (S2356) (S2308) (S2182) (S2369)(S2370)(S2325)(S2326) (S2217) (S 2 1 8 3 )(S2182)(S2183)(1144) (1323)(1003)(600) (1600 )(1200)(956)(1641)(738)(1045)(800) (1339 ) (1602) (700)(1000)(800)(1024)(1522) (1300 ) (900) (1 1 0 0 ) (1400)(1254)(319)ITASCA CT VALLEY DALE LN CHICK A D E E C I R LANSDOWNELAKESLNYORKMONTCT COUNTRY PLACE RDWINNETK A C T JOHNNYS WAYE ALLRED STWINDSOR TRL ROBI NSNESTDRCEDAR WOOD PL CAMDENCTRANDOLPH TABERNACLE RD CHEDDINGTON DR SNOW DONCTMAPLE RIDGE RDGOLD HILL RDRI DGE WOODCI R² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5r E5s D5f E5q E5n E5d D5gD5e E5m E5r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Asheboro (S2216)(S2356)(S2326)(S2216) (S 2 2 1 5 )(S2215)(S2217)(1487)(8 0 0 ) (1 0 7 8 ) (1213) (1 0 9 8 )(2900)(1144)(900)(1423)(1300)(1900)(9 0 0 ) (132)(1100)(2525)R A N D O LP H TA B E RN A CLERDBRECKEN WO O DCT HENLE Y CTR Y RD VALLEY DALE LN OLD CEDAR FALLS RDMAPLE RIDGE RDWALTERSAUNDERSDRT O N Y S W A Y CEDAR WOOD PL ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E5d E5sE5r D5gD5f E5n D5b E5s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Bush Creek (S 2 144) ( S 2 2 4 5)(S2141)(S2225)(S2143)(S2220)(S 2 1 4 1)(S2 143)(262 2 )(1100)(3342)(21 0 0 ) (1908) (2791)(3286)(2641)(1839)( 2 5 6 4)(1757)(1400)(2700)(1209)( 1 5 2 8) (19 9 0 ) (2500) (3000)(1602)(1620)(137 9 )(1400)(1500) (1864)(1223)(2400)(1100)(1904) (1712) ( 1 2 0 0 )(1293)(2302)(1133)(1495)( 1 9 00 )(2846 )CARL ALLRED RD JENNINGSRDOLIV E R S L N LEONARDYORKDR CRAV ENS NE ST D RQUAILCREEKDR WHITES MEMORIAL RDNANCERDEXTHAITHCOCKRDWI CKERLOVE L L RD RIVERRATRD MA P L E R I D G E D R MOUNTAINOAKS DR OLD CROSSING DR PEPPERSTONEDRGREENLEAFLNCED A R BRA DYLNTI PPETTRDBUSHCREEK DR WINDY DR NANCERDCREEKWOODDR N E VIT L N² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E6a F6c E6bE5b F6F5d E5d E6n E6oE6m E6a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Sandy Creek Franklinville Ramseur Ramseur Ramseur(S2495)(N 22N)(S2455)(S2499)(S 2 5 0 0 ) ( S 2538)(N22N)(2 0 82)(670)(1230)(3100)(11 0 0 ) (1306) (353 2 )(1033)(1400)(33 0 0 )(2200)MULBERRYACADEMYSTACADEMYSTNCHWY22NACADEMY RD EXT RIDGEWOOD RD HARDIN ELLISON RD BUTLERSCHAPELRDCEDARFOREST RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E6b F6 E6a E7a F7F6c E6n E6pE6o E7m E6b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Deep River (S2220)(S2141)(S2221)(S2216)(S2319)(S2221)(S2144) (S2 2 2 6 ) (87 3 ) (1400)(400)(1325) (1900)(2400)(36 54 )(3813)(705)(954)(1145)(22 0 0 ) (1100)(3500)(3900)(1200)( 1 0 0 0 )(3695) (800)(754)(2 3 0 0 )(450)JENNINGS RDTRAININGCENTERDR WICKERLOVELLRD LOFLIN POND RDDAVID LNRIVERRATRDO L D C E D A R F A L L S R DJAMESRAYDR CEDAR FALLSCHURCHDR MEMORYLN WHITES MEMORIAL RDGLENNRICHLN R A MBLIN G R D CEDARFALLSRD MCDOWELLCTRYTRL² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E6a E5d E6m E6n E6q E6r E5b E6m Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Deep River Bush Cr eek Franklinville(S2226)(S2226)(2851)(1209)(1200)(1100)(700)(2800)(2300)(3014)(988)(2609)(3078) (2862)(1006)(942)PLEASANT CR OSS RD CEDAR FALLS RDHAITHCOCK RDNEVIT LNNANCERDBILLYCOLTRANEDRMILLHOUSELNFARMCREEKDRLESTER RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E6n E6a E6r E6oE6m E6s E6b E6q E6n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet DeepRiver BushCreek Franklinville (N 22 N) (N 22N)(S2235)(S2498)(S2224)(S2207) (520) (170)(540)(500)(1033)(2 1 0 0 ) (140)(200)(57 5 )(2121)(500)(300)(30 7 8 ) (1 9 5 1 ) (100)(400)(100)(200)(900)(670)(600)(1400)(2200)(1200)(600)(612) (400) (3000)(1100)(745) (7 0 0 )(100)W MAIN ST PINE ST EAST BEND STACADEMY STDEPOTSTBUTLERS CHAPEL RDSUMNERPLN C HW Y 2 2 N P O NDCIR WEATHERLYDR LINDLEYST SCHOOL RDCLARK AVE BUIE L N RICESTWALNUTST CLARK ST A N D R EW H U N T E R R D CHURCH ST CEDARFALLS R D DEPOTSTEXT E MA I N S T SMITHST NORRISSTBUIE LN EXTROSE STJULIAN RDPLEASANT CROSS RDFAITHROCKRDALLREDST ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E6o E6b E6s E6pE6n E6tE6r E6a E6o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet DeepRiver SandyCreek Franklinville Franklinville Ramseur Ramseur (N 22N) (N 22 N )(S2492)(270)(500)(57 5 )(400)(250)(600)(400)(500) (537)(355)(700) (100)(670)(20 0)(226)(300)(100)(500) (797) (400) E M A I N S T NC HWY 2 2 NWEATHERLYDRSUNRISEAVE FAI T H R O C K R D PATTERSON GROVE RDE AST BEND ST LAMBE LNCHURCH ST WEST STRICEST C RAVENSTPARKS STOAK STRISINGSUNWAYCLARK ST HOLLY STACADEMY STPONDCIR WALLACE ST EXTYORKLN WALLACE STRAMSEUR LAKE RDMATTHEWSST ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E6p E6b E6t E6o E7m E6s E7a E7q E6p Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Franklinville(S2222)(S2224)(S2223)(S2256)( S 2221 )(S2221)(100)(450)(100)(194)(400)TROGDONPONDRDLOFLINPONDR DFOXWORTH RDPLEASANTCROSSRDM CDOWELLCTRYTRLBOBKIVETTRDDEWEYRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E6q E5d E6r D6e E6m D6f E6n D5b E6q Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet (S2228)(S2384)(S2264)(S2224)(S2235)(S2229)(S2324) (S2227)(S2235)(S2263)(S22 2 4 ) (1051)(469)(521)(581)(561)(3 100)(1100)(800)(2852)(485)(700 )(256)(1000)(300)(400)(100)(2759)(2902 )(500)(2889) (2786)(600)(2776) (3000)(100)P LE A S A N TCR O SSRD ANDREW HUNTER RDPENTECOSTAL CHURCH RDAN D RE WJAC KSO NTRL BROOKDALE RDBI LLYCOLTR ANEDRWILLOW LAKE RDBROADOAKSST HILL TOP HOME RDWOODLANDTRL ERNEST RD ORLENDO DR ACORN R D G ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E6r E6s D6f E6q E6n E6o D6e D6b E6m E6r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Franklinville Franklinville Franklinville Franklinville(S2229)(S2235)(U 64E)(S2208)(S2207)(S2207)(1051)(718)(3 100) (57 5 ) (4761)(1100)(800)(5000)(500)(900)(5100) (100) (30 00) (745)(100)US HWY 64 E ALBERT MARTIN RDP LE A SANTCROSSRDGEMSTONE C TANDREW HUNTER RDAN DRE WJACKSO NTRLHILL TOP HOME RDLAKESIDE PARK RD ACORN RDG FAITHROCKRDFAITH ROCK RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E6s D6b E6tE6r E6o D6f E6n E6p E6s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Deep River SandyCreek Franklinville Franklinville Franklinville Ramseur Franklinville ( S1003 ) (S261 6 ) (U 64E) (U 64E) (S2616)(S2207)(4669)(300)(216)(57 5 ) (4 4 0 0 ) ( 4 245 ) ( 4273 ) (400 0 ) (4028)(4634)(2 0 0 )(4300)(4067)(4100)(4600)( 4 2 0 0 ) (3800)(3600) (5100)(3900) (100 ) (4500) (4428) (281)(4056) (3700 )(5500) (3700)(355)(529 6 )(5611) (3800)(100)OGLES CREEK STINFINITE WAY EXTPOSTOAKRDGEMST ONECTRO CKIERIV E R S T BAYDOESTPL EAS ANTRI DGER D JONESSTEXT RED ROCK RD INFINITEWAY D O V E V IE W STDAWSON S T US HWY 6 4 E HUCK ST ARROW ST RISING SUN WAY FAITH ROCK RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E6t D6b E6s E7q E6pE6o D7e E7m E6t Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Mou nt PleasantCreekS an d y C re e kRamseur Ramseur (S2442 )(S2491)(S2455)(S2479) (S 2 4 4 2 ) (S2 4 7 9 )(S2491)(S2489)(S2495) (1400) (4300)(3532 )(2629)(4145)(1487)(1306)(300)(956)(4 2 5 2)(1600)(1300)(2082)(6500)(1900)(810)(4 3 4 1 )(6100) (12 00 )(5700)(1472)(760) (341 ) (2 3 0 2 ) MULBERRY ACA D E M Y S THARDINELLISONRDLOWBRIDGERD LAKE RIDGE CTSANDYRID GEDRRIDGEWOOD RD RAMSEUR JULIAN RDL A N CELOTDRPATTERSONGROVERDFERGUSON RD B R A D Y S T E X T ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F7 E7aE6b F6 E7b E7k E6p E7n E7oE7m E7a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet ReedC re e k(S2456)(N 49N)(S2479)(S2480)(S 2 4 8 1 ) (S2 482)(N 49N)(S2481) (1200) (5997)(1500)(1383)(4900)(1600)(7343)(900)( 4 0 0 ) (5190) (7100)(1800)(7600) (6500)(2200)(80 0) (1300) SEAYS RD GRIFFIN DRNC HWY 49 NSHORTGRASSDRWHITES CH A P E L R D FERGUSON RD MT OLIVET CHURCH RD E A S T E R NRANDOLPHRDGOLDS TON RD L O W B RID GE R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F7 E8E7a E7b F8c E7lE7k E7n E7dE7oE7b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Ree d C reek Ramseur Ramseur Ramseur (S2669) (S2485)(N 49N)(S2534)(S2625)(S2484)(S2477)(U 64E)(S2626)(S2481)(S2621) (S2 6 21)(S2668)(S2627)(U 64E) (S2 626)(7190) (370) (350) (500)(338)(323)(1100)(800)(317)(4907)(1200)(4949)(7229)(5102)(400)(2 1 7 ) (5045)(700)(986)(4955) (6015) (5024)(7300) (5200)(450)(5136)(132)(9 00)(600) (5100)(761)(7400) (352) (5156)(300)(500)(103)(8408) (5303)(800)(200)(8100) (5700) (5300) (6100)(100)(5804)(7600) (1 0 0 ) BURGESS FARM DR JORDAN R D RAMTEX DR CURTIS ST BUSH ST CRESTWICK RDTHORNB R O OK R D ELAMAVEN C H W Y49NCOTTO NWOODDR CCSQ U A RERDBROOKGREEN RD PARKSFI ELDTRLDIX O N TILLEY R D LEELAYNERDARDEN CT NOAH RDCANOY FARM RDF O USHEE RD FOXGROVE RD GRAVES THOMASRD US HWY 64 E REED CREEK RDWRIGHTCTRYRDHUFF CTRY TRLHOLLYHI LLSTEASTERN RANDOLPH RDROBY C OE RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E8 E7d D7b D8 E7a E7l E7r D7a E7k E7n E7o E7d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet (S2510)(S 2 4 8 1 ) (S2511)(N 49N)(N 49N)(S2482)(1371)(479)(1470)(5400)(570)(1381)(5300)(552)(441)(1410)(500)(8 0 0 )(1500)(5425)(1200)(1600)(5190)NC HWY 49 NISLEYLNMCQUEEN R DELW ORT H DR LITTLEGOLDENTRL SON NYSDRREEVESTRLC HRI STOPHERWAYDRCHEEK RDLO W B R I D G E R D GOLDSTO N RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E7k E7a E7b E7l E7oE7n E7d E7k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet R ee d C r eek (S2556)(S2541)(S2540)(S2510)(S2481)(N 49N)(S2477)(S 2 4 81 )(479)(5563) (5560)(300)(5600)(500)(80 0 )(100)(1600)(1800)(103)(400 ) GRIFFIN DR MCQUEEN R D ISLEYLNBENT OAK AVE EXT LEONARD MEADOW RDEX TLEONARD MEADOW RDQUAIL CORNER RDBENT OAK AVECHEEK RDLO W BRIDGERD EASTERN RANDOLPH RDNC HWY 49 NWRIGHTCTRYRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E8E7l E7b E7k E7dE7o E7l Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Franklinville Ramseur Ramseur Ramseur Ramseur (S2489)(S2 5 4 8 ) (S2537)(S2492)(N 22N )(S2491)(523 ) (4418) (4465)(300)(700)(341)(4474) (21 0 ) (300 )(400)(256)(4435) (536) (187)(810)(500)NC HW Y 2 2 N CAMP STFRIENDLY LN BRINTONPLFORESTVIEW STBRADYS TEXTWOODMON T P L WOODMONTDRPATTERSON GROVE RDRAM SEURLAKERDDU C K WOR T H C OX R D² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E7a E7m E7q E7nE6p E6t E7r E6b E7m Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Ramseur (S2537)(S2489)(S2487)(S2488)(N 49N)(S2484)(U 64E)(N 49N)(S2442)(127)(158)(355)(36 6)(492)(704)(4736)(4435) (7229)(4700)(4465)(7190)(335) (30 0 ) (49 0 7 ) (7000)(179)(203)(233)(374)(4 7 2 0 ) (2 1 7 ) (300 ) (20 0 )(400)(6 0 0)(268)(800)(7080) (4581)(100)(300)(341)CCSQUARERD KINGRDBRADY ST EXTNCHWY49NAR R O W H E A D R D BROADSTCRESTWI CK R D LAMBERT TRLJORDAN R D KIMREY STBRINTON PL SUNSHINEHEIGHTS R D TEMPLE VIEW RDHUNTINGWOODRD DIX ON TILLEY R D ELAM AVEALLREDVIE W AVE SPICEWOOD LNSILKWOODDRRAMSEURJULIANRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E7n E7a E7r E7oE7m E7k E7dE7q E7n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet ReedCreek Ramseur Ramseur (S 2 5 3 3 ) (S 2 4 8 3 )(S2553)(S2485)(N 49N)(U 64E) (S2535) (S2534)(S2668)(S2484) (U 64E) (300 ) (500)(338)(2 1 7 ) (4907)(1100)(800)(1200)(7229)(4949)(5102)(300)(5045)(986)(7300) (5200) (600)(132)(900) (5100)(200)(7 4 0 0 )(100)(352) (5156) (7600) ELAM AVE OA K L A N D C H U R C H R D CRESTWICK RDTHORNB R O O K R D DIX ON TILLE Y RDN C H W Y49N JORDAN R DC C SQU ARE R D BROOKGREEN RD ARDEN CT NOA HRDFOX GROVE RD GRAVES THOMAS RD HOLLYHILLSTUS HWY 64 E REED CREEK RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E7d E7o E7k E7n E7l E7r E7a E7o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet DeepRiver SandyCreek Franklinville Ramseur (N 22N) (S2 548) (U 64E) (N 22N) (S2 617)(S2616)(U 64E)(2106)(2061)(400)( 1 8 7 ) (6400) (536) (100)(6513) (52 3 )(2059)(4411) (2047 ) (1600 ) (6407)(2052)(48 7 ) (220 0 ) (200 ) (2008)(2215)(1708) (300)(6271)(142)(6100)(2040)(2203)(6443)(2300)(6200) (216)(2000) (40 0 ) (1700)(2026)(4100)(100)(4212)(5611)NEWELL STBROOKLYNAVEWATEROAK DRJORDAN RD NC H W Y 2 2 N COLE R I D G E R DCAMP STW JONES STJONES ST EXT WOODMONT D R JONES ST EXT WELB O R N C I R LE ONARDSTMISS ION H TSGREENHILLRD CRAVEN STFORESTVIEW STA D M IR A L D R E JO N E S S T DIXONSTPARKSTELIZABETH STUS HWY 64 E WOODE L L A V EWATKINS STLEONARDPARKSTWRIGHT ST² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E7qE6t E7r D7e E7mE6p E7n D7aD6b E7q Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Deep River R e e d C ree k Ramseur Ramseur ( S 2489 )(U 64E) (U 64E) (N 22S) (S2621) (6443)(6839)(179)(0)(536)(450)(491)(100)(489)(1525)(1531)(500) (2 0 0 ) (1523)(6873)(600) (1254)(445)(200) (419) (2200)(7000) (4 8 0 )(1396)(1900)(6844)(6700) (363)(1000)(1600 )(1511) (1539)(1250) (5 1 8 ) (1100)(530)(728)(404)(555)(413)(444)(1280)(1207)(110 9 ) (440)(538)(317)(1303)(1350) (1001) (1354) (55 1 ) (1006 ) (2 1 9 )(1320)(158) (539)(6893) (6784)(1362)(5024) (127)(806)(6731) (49 0 )(1200)(716)(100 )(338)(400)(6600)(430)(2300)(520)(492)(3 0 0 )(508)(1300)(410)(620 )(300)(718)(340)(448)(1501)(366)(500)(800)( 7 0 0)(2000) (400) (570)(600)(618)(1324)(460) (1360)(700)(1380) (370) (350) (4955)(323)JORDAN R D KING RDKIMREYSTCOLUMBIAAVEPARKSFIEL D T RLYORK STNC HWY 49 NMAIN ST COLERIDGERD WEATHERLY ST PINEWOOD CIRHOLLY HILL ST CAPEL ST CHURC H S T BROOKL Y N A V E CARTER STCHI SHO LM RDLE ONARDSTFOUSHEE RD WILLIAMSSTLIBERTY STCOX ST BR O O KV IEWCIRDEPOTS T STOUT STLINEBERRY STELAMAVEW RIDGE STWEATHERLY SQ SALISBURYST M EADOWOODDRSBRADYSTCRAVENSTBRADY ST EXT S HADYDR STEELESTREED CREEK CT STUART STN BRADY S T ERIDGESTWOODELL A VE BROAD STMOFFITT STTATE ST OLIVER STOAK S T CURTIS ST BUSH ST ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E7r E7n E7q E7d D7a E7o D7e D7b E7m E7r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet BrushCreek R e e d Creek Reed yForkM ill s to ne Creek GRAHAMMOORERD RICKY RDUS 64 W ZIONCHURCHRD MOONSCHAPELRD(O8888)(S2555)(S2723)(S2469)(N 49N)(O1367)(U 64E) (S2629) (S2475 )(S2477)(S2628)(S246 8 )(S2471)(S2621) (U 64E)(S2631)(S 2 6 30 )(S2476)(S2469)(S2472)(S2627)(S2474)(1036)(1100)(9271)(1700)(6015) (9600)(1171)(9500) (10600) (6 11 6)(9170) (5997) (7100)(1358)(1754)(1500)(1867)(300)(9315)(400)(2200)(800)(7600) (6081)(1258)(2)(100)(890 0 ) (10200) (8408) (200) (1087) (6300)(738)(500)(103)(7 5 0 7 )(900)(700)(6100) (9673)(424)(400)(443)(1000)(5804)(100)PARKSCROSSRDSCH URC H R D NC HWY 49 N USHWY64 E PRIMROSE LNBROWNSCROSSROADSRDWHITE POPLAR STBURGESS FARMDR WHITE LAKE DRLANGLEY RDCLAYB RO O K RDGERTRUDEDR GRIFFIN DR LANGLEY MEADOW RD FRAZIERRDGUESSRDYORKC TRY DRFER G U S O N RD DEAD EN DLNKIVETTFARMRD WARD RDVA U G H N YO RK RDCHATH AMVIE WRDWRIGHTCTRYRDBURGESSKIVETT RD JCTEAGUERDEXTJCTEAGUERDFOUSHEE RD KILD EE C H U R C H R DSHADYGROVECHURCHRDROBY COE RD HICKS FARM RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E8 D8 F7 F8c D7b E7d E7b E7l F8tF8s E8 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet BrierCreek Little U wh arri eRiv er(WheatmorePond) HUG H E S G R OVECHURC H R DLIBERTYCHURCHRDNOAH TOWN RD KI NDLEYRD BEN LEE RD K E NN ED Y RD BLYTHE DR BUIEBODENHEIMERRDRIVER S L NGRANT LEELNU N D E RWOODDR LUK E D REARLIE EVERHART RDRENEE DRKIMBERLY LNALBERTA DRJEANETTE LNMAHO NIAPLNODAWAYLNS NC HWY 109D OTRDPAULSAIRPORTRDROCKY DRMO ORELNBREANN ATERBLACKBERRYRDLEERDSHANDA LNLAUREL DRLEONA LNMAXMOORERDLIBBY GRACE CT VIOLA LNLOVETTERDTULALNPOWERSRD CHRISTOPHERLNBIGJONRDCABERD CHASERDBRAMBLEWOODDR SW E ETBRIARRDHANCOCKLN E US HW Y 6 4 CARTPATHTRL (S1549) (O 9 9 9 9 ) (S 1 4 0 1 ) (S1 3 9 2)(S2050)(S1553)(S1 400 )(S1402 )(S1405)(S1552)(S1547)(S1547)(S1404)(52 0 ) (2091) (1303)(1278)( 2 1 5 1 )(2480)(6458)(2156)(6030)(6410)(6100)(2132)(1384)(60 49) (2 6 0 0 )(6500)(1921)(6402)(600)(2108)(63 00 )(1800)(2179)(2177)(2012)(670 0 ) (2 2 6 3 ) (6959)(1600)(3615)(1 2 0 0 ) (270 0 )(2134)(7225) (6 6 0 0 ) (2 0 0 0 ) ( 2 3 1 2) (2 3 5 7 ) (6900) (6583) (2200)(2513)(6786)(7 0 00 ) (6415)(500)(2900) (2300)(2200) (6650)(7275 ) (6300) (6900)(1900)(6079)(17 0 0 ) (900) (32 0 0 )(3000)(703) (1 4 0 0 )(1481)THAYER RD BLACK O A K C T WILLOWOAKDRT O D D D R FINCH FA R M RD PAULS AIRPORT RD FULLERMI LLRDNHERI TAGEVIEWLNKENNEDYFARMRDNOLDMOUN T A IN R D POSTRDORCHARD TRLHIDEAWAYLNH U GHESGRO V ERD RUSSELL SUMMEYDRSNYD ER CTRYRD WELB O RN R IDG ECT SUG ARCANELN CALVARYWAY PINE NEEDLETRLCENTU RY LNFINCHFARMRDS NYDERSRDLYNNCIRELYNNCIRWWHISPERINGWOODSCT RI VER C HASEDRJADESWAY TABE R N A CLECHURC H RDBEVANDRLITTLEUWHARRIERD BLUE QUARTZDR PLEASANTL OOP P A RRISHFAR MRDSHEPHERDSVIEWRD OLDPOSTOFFICERDCHIPPER T RL ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E1 F1 F2c F2a E2a F1b E2c G2c F1j F1fF1g F1 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet LittleUwharrieRiver(Wheatmore Pond)(S3254)(S3140)(S3251)(S3173)(S3174)(S1794) (S3 2 4 9 )(S3270)(S3250)(S1795) (S3253)(S1552)(S1553)(S3172)(S3176)(S1547)(S3269)(S205 0)(S1553)(S1547)( 7 080 ) (63 2 5 ) (27 0 0 )(2779)(6900 )(2778)(6578) (2075)(2473)(3488)(3087)(6800) (2439)(2797)(2480)(6866)(2762)(5805) (6 4 9 5 )(7156) (270 0 )(3041)(63 6 5 )(6030)(6739)(7006) (7059 ) (6500)(1921)(7000) (6879) (6533) (2132)(2974)(2900)(6 700)(2800) (7003)(3500)(3 1 16)(7087) (64 1 1 ) (660 0 )(2108)(2 5 92)(2000) (63 0 0)(1900)(3000)(2179)(2177)(6942)(2012)(2 2 6 3 )(6079)(2 8 2 9 )(3191) (7200) (6900)(2134)(6100) (32 0 0 ) (2900)(2700)(2513)(2200) (2600) (23 1 2 ) (3600)(3517)WRIGHT RDSTONEHENGE RDOAKWOO D C T STONESIDE CIRGATEDR BRI A R P A T C H L N REDDY FOXX LN PIN O A K C T BLACK O A K C T WILLOWOAKDRT O D D D R TWIN O AKSDR WOODVIEW DRFINCHFARMRDO LDM O U N TA IN RDAUTUMNWOODSCT HERI TAGEVIEWLNMAPLELEAF CT STONEHENGE PL LACEY CTHICKORYHILLDR DOGWO O D CI R FU L L E R M I L L R D N POSTRDTY LN DESTIN DRCOURTLAND DR STEEPLECHASEDRTREE HOLLOW RD COURTLANDCIR NAN C Y L N EAGLENEST C T S A R A H LN SUNDANCETRLTREEH O L L OWEXTPLEASANTLOO P CENTURYLN LYNNCIRELYNN CIR WSHALLOWRIVERDRSHEPHERDS VIEW RD BEVAN DRHIDEAWAYLNEAGLEPOINTDRREFUGECHURCH DR P A R R I SHF ARMR D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F1 F1b F2a F2c F1j G2c F1f F1g G1tG1r G1s F1b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet OVERLOOKDRBLYTHEDR BLYTHEDRCA R T P A T H T R L G U M W O O D RD (S3185) (S3140)(S1547)(S3253) (S1794) (S3 172)(S1555)(S1547)( 7 080 ) ( 4 4 21) (6952)(7156)(4200)(4364 )(4300)(6942) (7087) (7006) (7200)(4000)(2729)(3615)GATEDR OAKWO O D C T FULLER MILL RD NDOGWO O D CI R COURTLAND DR TREE HOLLOW RD TYLN REDDYFOXX LNGUMWOOD RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F1f F1j F1g G1r F1b G1s F1f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Little Uwharrie River(Wheatmore P o n d )(S3275)(S3254)(S3249) (S1794)(S3173)(S3174)(S1795)(S3253) (S3172) (S 1 5 5 3 )(S3176)(2820)(2883)(3087)(660 0 )(2779)(6900 )(2778)(231 2 )(6900)(2473)(7156)(6800)(2700)(2797)(6866) (6952)(2900)(2762)(7006)(3041)(6953)(6739)(7059 ) (6533) (7000)(2513)(6879) (7087)(2974)(6700)(2800)(7003)(3500)(660 0 )(2592)(6942) (7200)(2829) (2600 ) (3600)STONEHENGE RDSTONESIDE CIROLD MOUNTAIN RDMAP L E L E A F C T BRIARPATCHLN REDDYFOXXLN PARRI S H F A R M R DTWINOAKSDRWOODVIEW DRDOGWOO D CI R FOX HUNT CTSTONEHENGE PL GATEDR SPRUCECTTY LN HICKORYHILLDRJOSH CTEAGLELANDINGDR COURTLAND DR TREE HOLLOW RD STEEPLECHASEDRR ID G EWOODCT COURTLANDCIR NAN C Y L N S A R A H L N T R EE H O L LOWEXTSHALLOWRIVERDRREFU G E C H U R C H D R ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F1b F1gF1f G1s F1j G1tG1r F1g Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet LittleUwharrieRiver(Wheatmore Pond)BLYTHEDRCARTPATHTRL (S1 5 4 7 )(2156)(6900)(3615)(32 0 0 )ORCHARDTRLSHEPHERDS VIEW RD FULLER MILLRDN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F1 F1j F1f F1b F1g F1j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Uwharrie River (S1549) (S3129)(S1897)(S3240)(S1760)(S1759)(S3257)(S3256)(S3130)(S1547)(2700 ) (6100)(3205)(3488)(2900)(3000)(5 632)(2600) (5100)(2200)(2273)(3608)(3142)(2300)(3200)(5700)(2500)(5247)(3099)(2859)(332 7 ) (5805)(3517)(3000)KEN N E D Y R D WILDWOODRDHIDEAWAY LN ROBBINS FARM DRFINCHFARMRDFOREST GROVE DRPINECREST DREASEM ENTDRGREENBROOKRDTHAYERRD CEDAR WOOD DR SYLVAN TRLALAMO DRBROKEN OAK RDMARIEDRMOUNTAINVIEWSTH U C K L EBERRYLN MILLERFARMDRTALLCEDARLNLACEY CT ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F2a F2c F2b G2c F1b F1 F2d G2dG1t F2a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet L it tle C a r a w ayCreekUwha r rie R iv er(S1408)(S3229) (S 3 2 4 3)(S3258)(S3283)(S2048)(S3129) (S3228) (S1544) (S3 1 06 )(S1546)(S1408)(S1 5 4 5 ) (S1 5 4 2 ) (S3106) (41 2 8 ) (57 0 0 )(5350)(5300)(4260)(4686) (489 8 )(3600)(2875)(4240) (4238) (2934)(2900)(4 3 1 2 )(2910)(4200)(3100)(2687)(3804)(4377) (5100)(4000)(4305)(4500)(4300) (4309) (5 389 ) (5000)(3003)(4664)(4100)(3400) (410 5 ) ( 4 5 2 1 ) HO O V E R H I L L C T MILLERS MILL RDHOOVERHILLRDKENN E D Y R D H U NTINGTO N D R MT GILEADCHUR C H RDOAK BROOK CT HUNT RIDGE CTHUNTERS RUNB Y RDLNWHITETAIL DRWALL LN CLEARRIDGE DR FOREST GROVE DR GILEADDRSYLVAN TRL CRAVEN P I N E S R D CEDARWOODDR OLD PARK R D MT G ILEAD CH UR C H R DSUMNER RD M ILLERSMILLRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F2bF2a F3a F2d G2d F2c F3c G2c G3q F2b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Uw harrie River(S1549)(S1549 )(S1550)(S1548)(S1548)( S 1405 )(S1547) (5500)(1600)(19 0 0) (3327) (5600)(1900)(1804)(1427)(5000)(5700) (5294) ( 1 200) (6049)(2200)(2600) RIVERSIDE ACRES CT THAYER RDTAB ER N A C LE C H U R C H R DTHAYER RD RIDGETOPCTTHAYER RDSKEENS MILL RDSNYDER CTRY RDFI NCHFARMRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F2cF1 F2a E2a F2d E1 F2bF1b E2b F2c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Little C ara w a y Cre ek (S3210)(S1408)(S1542)(S1408)(S1636) (S31 60)(S1548) (S1539)(S1549)(2687)(2268)(1501)(2200)(470 0 ) (4600) (2226)(3400)(4500 )(2790)(5200)(1600)(5000)(2856)(2395)(2600 ) (3453 )(3235)(4700)(3600)(4333 ) (4105) (4424)(2500)(4497) (3000) (4894) (4840) (4634) (4600 )(1804)POPLAR R IDGERDGILEAD DRNORWOOD CTSOUTH CTLAKECTHUNTERS WOODS DRHARRIS CTCAS H AT T RD SNYDER CTRY RD HOOVER HILL RDPIERCE LNTHAYER RDFEATHERSTONE CTPOPLAR RIDGE RD MORNING S I DE LN MTGILEADCHURCH RD PINEVALLEYDR HEARTHSI D E DR J OR D A N VALLEY RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F2dF2c F3c F2b E2b F2a F3a E2a E3a F2d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Little Cara wa yC reekCaraw ay Creek (S1525)(S1778) (S 3 1 3 2 )(S3221)(S3 2 43)(S1538 )(S1635)(S1716)(S1540)(S1858) (S18 3 8) (S1845)(S1004)(S1844) (S1832 ) (S153 5 ) (S100 4 ) (S1837) (S3131)(S1730)(S1833 ) (S1834 )(S1408)(S1 8 3 6 ) (S1835 ) (S1542) (S153 7 ) (S1729) (S1536)(S15 4 4) (S1543) (4800)(4600)(2945)(3 685) (4617)(3351)(8500)(3549)(8000 ) (3752)(8200)(4700)(5000)(4500) (34 9 9 ) (3340) (3500)(3592)(4041)(4664)(3433)(6835)(2800)(3200)(3834) (41 2 8 )(4022)(3400)(2559)(8100 )(3700)(4900)(3000)(4400) ( 3 2 0 2) (3402)(3940)(4105) (3800) (3900 ) (3905) (3680)(3 0 1 1 )(8300)( 7 80 0 ) (3 9 06)(3400)(3800) (6928 ) (3226) (4100) (31 6 9 ) (3300) (3624 )(4969)( 3 700 ) (3794) (3560 ) (7100)(3600)(3135)(4000)(7 4 0 0 )(3800)OLDMARLBORO R D BRIDGEPOINTDRMTOLIVECHURCHRDBEESON FAR M RDHIL LSV I LLE RDTARMAC DRBEAU MONTDRGI A N T O A K S C T G R E Y D R JESS SMITH RDNOAHS T RLHOFFMAN STPEARL AVE B Y RDLNOLDFLINTHILLRD CL O VER DR HARDINS FARM RDHOOVERHILLRDFLIN T H I L L R D DYLAN LNG IA N TO A K SD R HILLSDALE PARK DR HO O V E R H I L L C T SWEETBRIAR RDRAMBLEWOODRD S OUTHERNHILLRDCARLTON DR F ARL OWPI NESDR MT G I LE A D C HURCH RD VALLEY DR TREESPARROWDR B A Y B E R R Y DRCLEARMORNING RDLAKESIDE DRDAVISNELSONLNTODDHAGERMANTRL OLDFLINTHILL R DEXTCARAWAY TRLRUNWAY DRCAROLE DRKNOLL VI E WD R NELSON RDCRAVENPINESRD LEVELPLAINSRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F3a F3c F2b F3b F2d F3d G2d G3r G3sG3q F3a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet CarawayCree k(S3272) (S1536)(S1525)(S1523)(S1526)(S1525) (3179) ( 4 2 17 )(4316)(3237)(4000)(38 0 0 )(3433)(3351)(2 746)(3000)(3 2 3 6 ) (4140)(4239)(3226) ( 3 20 2) (2400) (4027)(3985)(3685)(3437)(4100)(2000)(3402)(3 7 0 0 ) EVE LY N ST STEWARTSTQ UAI L MEADOW ESTA TESR D GATEWOOD AVEHARDIN S FA R MR D MTOLIVE CHURCHRD B EE S O N FA R M RD YOUTHU NLI MITEDDRRAMBLEWOODRD ST E WARTSTEXTTODDHAGERMANTRL F ARL OWPI NESDR MARYVIOLA DRAL L RED H EIGHTSDR B AK E R F A R MRDEDGAR RDMARSH MTN RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F3bF3a F4a F3dF3c F4c G4cG3rG3dG3s F3b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet C a r a w a y C r e e k (S1 0 0 4 )(S1716)(S16 8 8)(S1004)(S321 4 )(S1 5 2 5 )(S1541) (S15 2 4 )(S1635)(S 1 5 4 0 ) (1600)(6800)(6600)(29 40) (3062) ( 2859)(6835)(2773)(2657)(3030)(3351)(3 1 4 5 )(2707 )(3100)(4 9 8 6 )(3000)(2800)(28 2 2 )(3400)(2710) (60 0 0 ) (3500) (3500) (3708)(6634)(6091)(6194)(3125)(3282) (2980 ) (3300) (3818)(3243)(3255)(6400)(3594)(2900) (3149)(2547)(3490) (439 1 )(2559)(2314)(55 0 0 )(2600)MOUNTAIN MEADOW DR JESSSMITHRDFLINTHI LLRDCATH ERINEWAY BEESON CT K OL BY CTBRIDGEPOINTDR HAMMONDRD HEARTHWOODRDINDIANTRL B EE SON F A R M RD EARNHARDTRDCARAW AY MTN R DRAMBLEWOOD RDDYLAN LNFARLOW MEADOW RD W ILLIAMHENLEYPLLI BERTYS RUN DR YOUTHCAMPRD UDELLDR CROTTS EDWARDS DR WESLEYFARM L N BECKERDITERD FAW DR WINN DEE REST LN DEVIE CANOY DRSWEETBRIAR RDWINDSONG RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F3c F3a E3a F3dF2d F2b F3b E2b E3b F3c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Caraway C re ek(S1521) (S3170)(S3284)(S3178)(S3222)(S3281)(S3177)(S3183)(S1523)(S1524)(S1524)(2798)(3100)(3800) (2773)(3400) (2552)(265 6 )(2657)(2910) (2940)(3121)(27 0 7) (2647) (498 6) (3030) (2577)(2 40 0) (2194)(2 5 0 0)(3040)(2520)(2962)(3000)(2 9 18) (2800) (2100)(3100)(2 517)(3200)(3049)(200 0 )(3607)(3181)(2600)(3081)(3426) (2300)(2342)(2722)(2746) (2589)(3818 ) BECKERDITERD FLI N T H I L L R D EARNHARDT RDBEESON FARM RD H E A RTHWOODRDFORESTTRL LOFLIN FARLOWLN SAWYER R D WESLEY FARM L N S H AWNEET RLRIDGEWORTH CTCAT HERINEWAY MARSH MTN R D CARAW AY MTN R D INDIAN T RLSON GBIRDLNSHARON ACRES DRIVORYLNTURTLE DO V E R D BROOKSHIRE CT MEADOW ACRES LNGREEN GLADE RDJAMIEDAVISRDAPACHETRL THOMPSONHEATHRDSAWYER RD EX TPLOTTHOUNDTRL Y OUTHUNL I MI TEDDR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F3dF3c F4c F3b E3b F4aF3a E3a E4e F3d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet (S1944)(S2069)(S1945)(S1524)(S3109) (S1523)(S207 0 ) (U 3 1 1 ) (S1936)(S1514)(S2 0 6 8)(S15 1 8 )(S2031)(I 74)(R 74) (U 3 1 1 )(S1525)(S1524)(S1949)(I 7 4 )(S1522)(S19 41)(5370) (5207)(4815)(5013)(4013) (55 0 0 )(4591)(4493)(620 0)(4400)(4620)(5373) (20 5 3 ) (6300) (5211) (2513)(4957) (47 0 0 )(3739) (12 0 0 )(39 2 2 )(2700)(3820)(2400) (63 5 3 ) (5131)(4000)(4153)(2362)(4654)(1300) (1802) (6000 )(5500)(1696) (12 0 0 )(3901)(1900) (1 1 0 0 )(4500)(479 1 ) (4 9 0 0 )(4854)(4700)(4032)(5000) (3 8 0 0 )(4817)(3757)(1448)(5274)(2451)(5275)(5300) (0) ( 4 3 0 0 )(4276)(5009) (5 7 0 0 )(3700 )(2006)(18 0 0 ) (3 4 14 ) (34 1 3 )(3587)( 4 3 46 ) (5501 ) (5444 ) US H W Y 3 1 1BRANSONDAVISRD WAL LBROTHE RSRDOLDWAYRDBECKERDITERDPLAINFIEL D R D COOPERFARMRD JAC K S O N W A YNELS ONPARKRDJOHNGLENNDRLYNDONLNTOWERVIEWLN INW O O D V I E W D R RIC H FIELD S R D OLDCOUR TH OUSERDMARY VIOLA DR PIEDMONTDAIRYRD H OLLIN GSWORTHFA RMDR MILLIKANRDMARSHMTNRD WALKER MILL RD WILD ROSE DRMEADOWLAKELN AZELDR CO M M O N W E A L T H R D BUC K LN BEESON F A R M R D STALEY HILL RDBEECHTREECT INTERSTATE HWY 74C OLTRANECEDARR DNEWB H I L L R D OLD PLANKRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F4a F4c F3b G4c F3d F4d G4d F4k F4g G3d F4a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet (S 2 0 7 0 ) (I 7 4 ) (S1504)(S1524)(S1513)(S 2 0 6 9 )(S1518)(S 1 5 1 2 )(S1518)(3088)(6 4 4 3 ) (6 4 4 2 ) (2800)(2918)(2700)(2 3 0 0 )(4493)(390 1) (2700)(3300)(1300) (1379)(2798)(3820)(341 7 ) (2810) (1100)(4229)(1 7 2 5 ) (5 5 0 1 ) (5 4 4 4 )(3081)(3905)(904)(3500)BUCK LN HEATH DAIRY RDIN T E R S T A T E H W Y 7 4 SUNDEWDRBECKERDITERDSAW YE R R DEXTPLA IN F I E LD R DSTALEYHILL R D S P E R O RD RICHFARM TRL PINEFIELD DR OLDCOURTH O U SERDLACYH O DGEDR MORNINGDEW DR CO O P E R F A R M R D GROO M RD THOMPSONHEATHRDTURNERDAIRYRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F4c F4a F3d F4d E4a F3b E3b F4k E4gE4e F4c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet B ackCreek Asheboro Randleman ( S1630 ) (S1956) (S2124) (I 7 4 )(U 220BUS)(S2071) (S2072) (S1646) (S22 7 0 )(S1954)(S1511)(U 220BUS)(I 73)(U 3 1 1 )(I73/74)(S2372) (S1512)(R 7 3)(R74)(S1511)(382 8 )(400) (4 1 6 6 )(200)(211)(3808)(2992)(3200) ( 1486 )(1001)(4303)(384) (383 4 )(4800)(3820)(141)(3771)(238) (2979)(1100)(300)(5 4 4 4 ) (505)(4600)(5 5 0 1 )(101)(3690)(3226)(2900)(1943)(416)(1006)(111)(900)(300) (7 9 4 )(4190)(3500)(387 0 ) (500)(700)(830)(3563)(100)(1200)(1866)( 1 400 )(3800)(4009)(3847) (4900)(1801)(4000)(1924)(100)(1800)(1600)(133 )(1615)(904)(448)(1901)( 3 232 )(1886)(670)(1865)(6 7 0 8 ) (6 4 4 2 ) (6 88 7) (0) (6 4 4 3 )(3088)HWY 3 1 1 E X T US H W Y 3 1 1 HOMEPLACEDRHEATHDAIRYRDS MAIN STCAUD L E R D US HWY 220 BUS N H E RI TAGEDREVANS TRLCOLONY CT SALEM CT MORNINGSIDE RD TAYLOR DRWE S L EY ANR DHAZELHULL LN MCCOLLUMST PRISTINEVALLEYRDOLD COURTHOUSE R D BLUEVIOLETDR FOREST PARK DR CLAUDE HOLDEN DR IN T E R S T A T E H W Y 7 4 H ARSH A W DR SOUTHERNDR T ORCHDRBALDWIN DRMIMOSA CTCENTR ALPIEDMONTCTPOINTE SOUTH DRLULA RAY R DTIMKENPLBROO KWOODACRESDR CHEST N UTT O A KRD H O LLINGSWORTHRD HOL LIN GSWORT H RDEXTD AI R Y BREEZEDRINTERSTATEHWY73BOWMANAVEINTERSTATE HWY 73GUM STINTERSTATEHWY73/74WAKETA DR TURNER DAIRY RD COUNTRYACRESDRSTOUTRDHA R S H A W DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F4dF4c F4a F4l F5i E4a F4k E4g F4p F5q E5eE4h F5m F4d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Randleman (R73)(S1989)(I 73)(S1951)(5500)(1233)(12 8 5)(4800)(877)(1227)(600)(0)(800)(4645)(1226)(4552)(1429)(1446)(4900)(80 0 ) (120 0 )WALKER MILL RDH ARRISONTRL ISLANDFORDRDW ACA D E M Y S T HUNTERS R I D G E R D TIGERSDENRDINTERSTATEHWY73COMMONWEALTHRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F4g F4a G4d F4k F4h F4l G4c F4g Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet DeepRiver Randleman Randleman(I 73)(S1958)(S1989)(I 73 ) (R 73 )(4779)(217)(1022) (436) (500) (531) (848) (672) (700 ) (665)(650) (4 6 0 0 )(1026) (800)(221)(512 ) (4638)(1226)(1) (630 )(816) (404)(200)(9 5 0 )(4693)(701)(4526)(877)(1227)(100)(430 0 )(1446)(4645)(1429)(0)LITTLEF O X RD CARLI S L E A V E E X T N STO UT ST HIGH POIN T S T WACADEMYST ROLIS RD REYNOLDSRDRATTLERSRUNPENNSDR TI G E R S D E N R D HOLDER STBURGESS STP A R R ISHDRRI VERPOI NTEDR MO U NTAIN AVEINTERSTATEHWY73 EDITHRUSSELLRDINTERSTATE HWY 73 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F4h G4d F4l F4g F5e F5iF4k G5c F4h Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Randleman Randleman Randleman (S2036)(S1518) (U 3 1 1 )(S1513)(S1952)(S1952)(S1953)(U 3 1 1 ) (S20 3 5 )(S2072)(4329) (45 0 0 )(1030) (452 4 )(4552)(4437)(8 0 0 )(4155) (1285)(1233)(4100)(4400)(83 7 ) (460 0 ) (1100)(4475)(4957)(1200) (470 0 )(4068 )( 4 1 0 4 )(4462)(4300)(3820)(4561)(4200)(4 1 6 6 )(562)(4000)BROOKWOOD ACRES DRUS H W Y 3 1 1 HIGH POI N T S T ISLANDFORDRDCO M M O N W E A L T H R D OLD COURTHOUSE RDHOLLY GROVE CTHARRISONTRL ALLRED CIROLD HIGH POINT STHOLLYGROVEDRJOH N G LENNDRPLAINFIEL D R D FRAZIERCTRYDR G A R Y D A L E D R BROWN LOOP ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F4k F4a F4l F4g F4dF4c F4h F4p F4k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Randleman(R 73) (S2072)(I 73)(S1954)(S1954)(I 73) (8 0 0 ) (310) (316) (600 ) (1446)(670)(503)(1026)(63 0 )(217)(700) (300) (411)(100)(407)(1)(619)(1030) (324)(201)(0)(4329)(1429)(4465)(4200)(598) (200)(325)(600)(100)(60 4 )(105)(300) (4100) (500)(4022)(400)(500)(4538)(3800)(400)(4284)(4000 )(1615)(1600)CO M M O N W E A L T H R D OLIVER S T SUNSET DR BROOKWOOD A C R E S D R W A C A D E M Y S T STOUTRDHOLDERSTWORTH STS STOUT STSTEVE NSONST NSTOUTSTCENTRAL PIEDMONT CTREECEAVE DEPOTST JESS FERREECTDEPOT ST EVANSTRLLEE STREECECTPARRISH DRHIGH POI NT S T BRITTANY LNDAVIS STINTERSTATE HWY 73 BOO KER T W OMBLE R DBOWMAN AVEROCK STCAGLESTPOINTESOUTHDRALLRED CIRBENTLEY DRBROOKSHIRE RD FAIRWAYVIEWDR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F4l F5iF4k F4p F4hF4g F5e F4d F5m F4l Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet BackCreekRandleman (U220BU S)(S1956)(S2124)(U 31 1 )(S1954)(S22 7 0 )(I 73)( S16 3 0 ) (R7 3)(I 73) (382 8 ) (400 ) (384) (300) (238)(1001)(101) (383 4 )(1100)(505 )(3226)(1200)(900) (500) (300) (416)(100)(1006)(387 0 )(3500)(3800)(1866)(100)(1865)(1801)(1800)( 3232 ) (0)(1600)(1615)(133 )(670)HWY 3 1 1 E X T US H W Y 3 1 1 TORCH D REVANS TRLMCCOLLUM ST BLUE V I O L E T D RSMAINSTCLAUDE HOLDEN DR BALDWIN DRCHESTNUT T O AKR D POINTE SOUTH DRCEN T R ALPIEDMONTCTTIMKENPLBOWMAN AVEINTERSTATEHWY73WES L E YAN RDSTOUTRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F4d F4p F4l F5m F5iF4k F5q F4p Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Polecat C reekBullR unRandleman (S2135) (S21 2 0 )(S2132)(S2111)(S2 1 3 4 )(S2119)(S2240)(S2 1 1 1 )(S2132)(S2136)(415 3 ) (2000) (4400) (349 9 )(430 0 ) (4 4 0 0 )(4000)(3410) (4040)(2000)(1200) (9 8 6 )(900)(2021) (36 8 7 ) ( 3 800 )(3300)(1800) (1700)(4460)(3000)( 3 1 1 2 ) (4000 ) (4100)(2121)(3593)(32 0 0 )(3445)(2091) (37 0 0 )(3900)(1500)MAJES T I C O A K D R N A O M IRDCAMP FIRERDCAMP NAWAKA RDBETHANYCHURCHRDCREEKRIDGECTRYRD BULLRUNCREEKRD L AURELLNCAMPN A WAKA RDEXTMAMIEMAYRDJA K E PUGH D R R O C KO W R DDELTA DRCEDARSPRIN GSRD CROSS LNTOM BROWN RDNI XONFARMRDMILLIKA N F A R M R D CAUDLEFARMLN² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5b F6 G5d F6c F5j F5d G6c F5f G5r F5n F5o F5b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet PolecatCreekDeep River (S2122 ) (S213 4 )(S2261)(S2132)(S 2 1 44 ) (S2393) (S2 1 3 1 ) (S 2 1 2 2 )(S2138)(S2240)(S2358)(S2132)(3060)(18 7 5 ) (1736)(1141) (2564) (11 0 0 )(2409)(3024)(1760) (310 0 )(2256)(2693)(1602)(2643)(1 0 00)( 2 200) (2000) (1878) (1 9 00) (2058) (1328)(2805)(1651)(3200) (3500)(2551)( 3 1 1 2 )(3057)(2300)(3200)(1305)(1 2 92)(2442)(1900)(2258)(3200)(2855)(3064)(3307)(1725)(2400)(3300)(1228) (1400)(1100) (2 6 0 0 )(2692)(3000) (2900) (1110) ( 2 7 4 0 ) (2 0 1 2 )MACK LINEBERRY RDGEORGEYORKRDHODGE RD WORTHVILLERD C A S T LEROCKRDCHART W E LLLN WA LLCTRYDR MILLBORO RD OLD LIBERTYRD BECK C T R Y D R ROUTH COXDR ERMINES T DENNY DR GENEALLREDDR OLDSETTLEMENTRD ROBBINSSCO T T RDCREE K RI D G E C T R Y RDLOVELL DRISABELDRWHISPE R IN G PINE DRWI CKERLOVELLRDBETHANY CHURCH RDALLENVESTALRD FRANKLIN HILLS CT TOMBROWNR D NELSONPL DEERRUN DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5d F6c F5b E5b F6 E6a F5j E5f F5r F5n F5o F5d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Deep River Randleman Randleman(U220BUS)(S211 6 )(U 220BUS)(S 1 9 6 1 ) (850)(333)(1100)(7700)(334 )(800)(214)(380)(316)(107)(4502)(217)(1) (101)(808)(415) (141)(700)(1000)(400)(404)(111)(900)(7580)(230)(100) (2 0 0 )(4532)(403)(200)(1102)(300)(500)(110)(30 0)(600)(104)(100)(201)(100)(4 4 0 0 ) E NAOMI STNMAINSTN STOUT STUS HWY 220 BUS NCOMMONWE A L TH S T REDBUD LN HIGH POI N T S T POPLAR ST MAGNOLIA DRSHAWSTTROLLINGER STLAURA CT HANCOCK S TCARLISLEAVECARLISLEAVEEXT LAMB STBRADSHER CT FOX STW EA V ER ST HAMMONDSTWEAVERSTDA N I E L S S TLAMB STRICHAR D S O N R D PINNACLE DR RANDOLPHSTNEW S A L E M R D ROBERT HINSHAW DR OAK LN N COBLE ST SUNRISECIRERIVERDRWRIVERDRR A N DLE M A N LAKERD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5e F5i F5fF4h G5c F4l F5j G5rG4d F5e Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Polecat Cre ekRandleman Randleman Randleman Randleman (S2118)(S2135)(S2117)(S21 19) (S 2 1 1 8 ) (50 5 ) (1012)(3475)(1)(4400)(700) (41 79 )(1)(51 1 ) (1500) (415) (1177) (349 9 ) (100)(3870)(4324)(1142)(200)(800)(600) (1000)(101)(400)(4 1 5 3 ) (850) (200)(900)(300)(4198)(4000 )(316) (3687) (3833 )(300)(1000)(4255)(100) (1700) (800) ( 4 2 0 0 )(4356)(1300)(4197)(1524) (500) (3 9 0 0 )WOODS DRWEAVER S T E NAOMI ST MOOR E A VE BRADSHER CT B R OWNOA K S RDCHARTEROAKSDR WA T E R O A K C T RED OAK CTAZALEA DRGLENNS WAYNAOMI RD PINNACLE DR CREE K R I D G E C T R Y R D HAMMOND ST SILVE R F O X L N OAK LEAF PLCEDARSPRINGS RDFOX STAVONLEA LN MAJESTICOAKDRTROLLINGERSTS O U T H P I N O A K D R F O XWOODCT MANESSDRREDOAKDRLOU MYERS LNLACYDRREDBUD LN N O R T H PI N O A K D R MAGNOLIA DR WHITEOAKDRTROGDON WAY TRL FOX HOLLOW LN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5f F5b F5j F5e G5r F5i G5c G5d F5f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet DeepRiver Randleman (U 220BUS)(U 220BUS)(316)(324)(319)(400)(242)(3400) (1 0)(248)(0)(700)(102)(700)(230)(333)(201)(213) (105 ) (310)(503)(205) (41 0 )(241)(306)(100)(610)(217)(400)(604)(800)(409)(500)(407)(400)(203)(312) (201) (113)(400)(411)(100)(1 30) (850) (130) (200)(600)(600)(700)(401)(301)(300)(214)(300)(200)(200)(100)(500)(600)(506)(101)NMAINSTWORTHVILLESTSUNSETDR DEPOT ST W ACADEMY ST E AC A D EM YSTBROOKSHIRE RD BAR K E R S T STEVENSON S T S MAIN STLAMPLIGHT DR C OMMONWEAL T HST MARTHA CTA C C E SS RD RANDOLPH STE NAOMI STWORTH STLEE ST FOX STNSTOUTSTEASTST PRESNELLST RAILROADAVEBELL AVECOMMERCE SQE BROWN ST SWAIM STMORGAN STHINSHAWSTCRANF O R D S T EVANSTRLMILL STSMITHAVEHILLIARY STSHARON LNFREEMAN STR IV E R WALK DR WHITE STBRITTANY LNHILLCREST DRNEAL STW NAOMIST VARNER STCHURCH ST HANCOC K S T SPENCER ST BACK STUPTON STPENNY STTABERNACLESTSIBBETT ST SPRINGVALLEYDRTHIRD STW BROWN STPOPLARST PARK STFERGUSON STOLIVER ST HONEYCUTTST F E R R E E ST RAILROADAVES COBLE ST ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5iF4l F5j F5e F5m F5fF4h F5nF4p F5i Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Polecat C r e e k DeepRiver Randleman Randleman (S213 5) (S 2 1 3 3 ) ( S2 1 3 4 )(900) ( 3 410)(100)(146)(850) (36 8 7 )(100)(116)(500) ( 3 4 7 5 ) ( 34 9 9 ) CRANF O R D S T DELTA D RMOOREAVEFOGLEMANLNCRE E K R I D G E C T R Y R D GLENNS W A Y E NAOMI ST CED A R SPRINGSRD RIVERSBENDDR E BROWN ST APPLEWOOD RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5j F5b F5i F5f F5n F5e F5oF5m F5j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Randleman Randleman (U 220BUS)(S2122)(S1956)(U 220BUS)(S2123)(S2244)(S2363)(S2121)(S2122) (S2290) (S2307) (S2268) (S2125) (700)(100)(726)(502)(3300)(400) (3 3 72)(124) (307)(200)(731)(700)(1400)(708)( 3 0 4 6 ) (500)(1300)(3200)(525) (674) (3 0 9 6 )(3153)(2953)(300)(1200)(716)(600)(645 ) (548)(348)(800)(238) (138) (600)(3100)(3325)(384)(300)(900)(3309)(101)(1000)(2676)(3400)(3300)(100)(700)(200) (300) BROOK ESTATES RDEVANS TRLSMAINSTBOWERS LN PINEHURST DRIVY ROCK CT WORTHVIL L E R D FORESTDRWINDSORPLACECIR BLUE VIOLET DR CAUDLE RD MCCOLLUM ST CL A R EN C E BOW E R S R D B O WE R S C R E E K RDMELODYLNRAILROAD AVE CONE ESTATES ST KIRKMA N P L LAMPLIGHT DRFOREST ESTATES DRRUMBLEYPI NESTHOMERLN MIDWAYVIEWDRTORCHDRBEAVERCREEK RDALLRED WAY SHEFFIELD AVE WORTHVILLE STDOGWOOD DR WIN D SOR P LACE C IR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5m F5i F5q F5nF4p F4l F5j F5rF4d F5m Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet DeepRiver PolecatC reekRandleman Randleman Randleman (S2300)(S2127) (S2125)(S2126) (S2301) (S21 2 2 )(S2128)(S2122) (310 0 ) (106) (1114)(1246) ( 3 09 6 ) (201) (600) (525) (862)(112)(900) (1200) (3340) (1000)(100)(3100)(200)(700)(1000)(571)(3200)(29 5 1 ) (674 )(2939)(1305) HOD G E R D BECK C T R Y D R C A STLEROCKRDRIVERPARK R D WORTHVILLE RD B O WE RS C RE EK RDRUSSELL W A L K E R A V E BROOK ESTATES RD BOWERS LNSHADY FOREST RDGALLI M O REDR VILLAGE AVESHADYFORESTRDEXTBOWERSMEADOWDR R IVERPARKRDEXTFOREST ESTATES DRSKYHAVENRDEL K R D W O W RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5n F5j F5r F5oF5m F5i F5b F5q F5d F5n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet PolecatCreekDeep River (S2122)(S2300)(S2122)(S21 3 4) (S2131)(S2132)(1875)(1000)(310 0 )(1602)(1 9 0 0 )(1651)(3200)(1305)(3 1 1 2 ) (1725)(3300)(1100) (2012)(2740) G E OR G E Y ORK RDHODGE RDWORTHVILLE RDCASTLEROCKRDBECKCTRYDR ROBBINSSCOTTRD C R E E K R ID G E C T R Y R D BETHANY CHURCH RDMILLBORORD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5d F5o F5b F5n F5j F5r F5o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Asheboro Asheboro Randleman (U 220BUS)(S212 3 ) (S 2 3 1 4 ) (S2150) (S2123) (S2123 )(4600)(211)(2870)(383)(234)(400)(240)( 3 0 4 6 ) (262)(2810)(301) ( 2 94 8 ) (237) (141) (601)(610)(359) (282 7) (320)(2910)(3064)(3 0 0 ) (451) (100)(2901)( 5 0 3 ) (200) (260) ( 2 4 5 5 )(2863)(2900)(2956)(2790)(2608)(2932)(300) (500)(100)(3096)(2800)(2979) (400) (645 )US HWY 220 BUS N SALEM CT MORNINGSIDE RD FOREST PARK DRTURTLE LAKE BNDCAUSEYDR HOMEPL A C E D RHERITAGE DRGINGER CTCLA R ENC E BOWERS R D KAMERINSTCECYLIA CT TORTOISE LN CAUDLERDOLD CAS T L E D R BOUNDARYD R VICTORIAN CT REGI NAS WA Y WALNUTRIDGERDMIMOSA CTSONNETT DRBUCKHORN DRLAWSONCTSPRINGHAVENDR CAUDLEESTATE DR GUM STBOWERS CREEK RDHORSESHOEBENDRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5q F5rF4d E5e F5m E5f F4p F5n E4h F5q Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Asheboro (S2128)(S2128)(2828)(3096)(2804)(601)(2845)(2535)(2886)(2587) (833) (818) (812) (807)(2939)(2652)(500)(900)(2608)(578)W O W RDBOWERSCREEKRDOLD CAS T L E D R SPRINGHAVENDR NEWMAN TRL CAMELLIA LN MCCOLLUM FARM RD LYNNWAY DR CAUDLE ESTATE DR H E R IT A GE MTNTRL BUCKHORN DRWOODMENCAMP TRL ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F5r E5f F5q F5d F5n E5e F5o E5b F5m F5r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet BushCreek (S2240)(S2 1 1 1 ) (S 2 514)(S2288) (S2 4 54 )(S2136) ( S2 4 4 8 ) (S244 6 ) (N 2 2 N )(N22N)(S2198)(S21 4 2 ) (S 2 4 5 3 ) (S2261)(S2138)(S2455) (S2140) (S2132)(S2 2 6 1 )(S2141)(4217)(2629)(3445)(3000)(6800)(5200 )(6300)(4673)(4323 ) (1878) (4 2 0 5 )(4300) (2971)(4000)(3660)(2760)(5839)( 3 1 4 9)(3800)(3209)(304 7 ) (2208)(6 9 00) (1800) (3 0 8 7) (2700) (1864)(4200) (2672)(5927)(4640)(3859)(4656)(4500)(3 7 1 8 )(5700)(3160)(1900)(3800 ) (3252) (3812)(2700)(3993) (2400)(2236)(4000)(2730)( 4 926 ) (4400)(3700)(28 5 3 )(2900)(2900)(26 0 0 ) (3384) (35 4 3 )(3500)(2 7 0 0 )(3200)(3100)(530 0 )(18 6 2)(4161)(33 0 0 ) (3 6 8 0 )(4061) (5 4 0 0 )(4400)(2 7 07 )(3348)(3300)(3342)(3582) (280 0 )(6400) (3200) (3740)(2410)(3500)(3500)(4800)(3430)(3532) (3 6 0 0 ) (2000)(5600)(2707)BE THANYCHURCHRD MARY ROBBINSON RDLOW BRIDGE RDTOM BROWN RDNCHWY22NTOM BROWN RDVINCENT OAKS DROLDLIBERTYRDOLD SETTLEME N T R D PLUMTREERD GRAYSCHAPELSCH OOLRDPERRY BLVD BENNYLINEBERRY R DISABEL D R DAVIDALLREDDRSMITHH OLD E N RD MA MIE M AY R D WHITESMEMORIALRDNELSON POND DRRE G IN AL DRDBRUCE PUGHRD R L ROUTH D R O A KLEYRD CROSS LN A LT ONDR LITTLES DR P UGHDR BUSHCREEKDR GUILFORDWAYMACKLINEBERRYRD K IN G SW AYRD MEADOWS CTRY LN WAL K E R S T O R E R D JIMWALKER RD COOLSPRINGSCHURCHRDEXT CO O LSPRINGSCHURCHRDJIMMY SCOTT RD PARRI SHHA MP T ONTRLMARCLIF RD RALEIGHDRJESS H A C K E T T R D LILLIEWOOD LNOAKHOLLOWTRLKID D S M I L L R DHOMEWARDTRL OLD B R O W ER M ILLRD LO CUSTG R OVEDR ROU T H RDEME RAL DFARMRD CARLALLREDRDSH AD Y BROO K D R H A R DIN ELLISONR DHALL RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F6 F7 G7 F6c E6a E7a F5b E6b G6cG5d G6d F5d E5b F6 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet BushC re e k (S2382)(S2141)(S2288)(S2138)(S2261)(S2143)(S2261)(S2 1 4 2)(S2141)(3200) (1878)(3430)(3000)(2600) (2971)(2760)(1864) (270 0 ) (4200) (2672) (3859)(1900)(4656)(4800)(3993)(2730)(3200)(2900)(26 0 0 )(3100)(4400)(3342)(3500)(280 0 )(2410)(2707)WAL K E R S T O R E R D LITT LE S DR OLD SETTLEMENT RD MACKLINEBERRYRDVINCENT OAKS DRISABEL DR PERRY BLVD WHITESMEMORIALRDBUSH CREEK DRPUGHD R OLD LIBER T Y R D GUILFORDWAY MARCLIF RD RALEIGHDRCARLALLREDRDHALL RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F6 F6c E6a F5d F5b E6bE5b F6c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Sandy Creek BoodomCreek Mount Pleasan tC reek Ramseur (S 2 4 8 1 )(S2261)(S2479) (S2445 )(S2442)(S2557)(S2550)(S 2 452)(S 2 4 4 9) (S2453)(S2437)(S244 0 )(S2543 )(S2450)(S 2458) (S2438)(S2439)(S2442)(S2456) (S 2 4 5 9 )(S2448)(3812) (2451)(6800)(2255)(1200)(2957)(7600)(3660 ) (5513) (4841 )(3200)(2 1 57) (614 5 )(1383)(5704)(2154)(3192)(7044) (5 060)(2600)(1466)(2711)(6000) (6900) (4057)(2300) (5800)(3690)(24 7 6 ) (20 0 0 ) (4742)(1600)(3740) (4200)(1758)(2815)(3000)(1707)(28 0 0 ) (4900)(4370) (2900)(4573)(1487)(2283)(4800) (3718) (4631) (13 0 0 ) (2629)(458 2 ) (4700) (5567)(3118)(5235)(17 0 0)(31 0 0 )(5400)(35 0 0) (1900) (3 3 0 0 ) (2500)(2899)(4900) (5 0 0 0 )(2400)COOL SPRI N G S C H U R C H R D E X T LOWBRIDGERD OLD LIBERTY RD BROWERMEADOWRDRAMSEURJULIANRDSEAYS RDHAYSTACKLN FERGUS O N R DBENN Y L IN EB ER RY RD DOUGLASD RWHITES C H A P EL R D SANDY CREEK CHURCHRD YORK A C R E S D RROUTHRD STILL MEADOWS LNKIDDS LNSOAPSTONEM TN R D SHO RT GRASSDRCLA R ENCEYORK RD AMICK LNWI L LI AMSDAIRYRDGARY MCMASTERSRD CLACIELN FLINCHUM FARM RD SANDYLAKED R M INT HILLD R WOODROW JULIANRDKIDDS MILL R D SP RI N GSIDERDLAND ESTATES DR HE ADENCTRYTRL WOODMEADOWS R DEMERALD DR SANDYRIDGEDRKINGS WAY RD BOGGSTRL BUMPAS RDSHA D YH OLLOW RD FOUST RDWILLARD RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F7F6 G7 E8 F8c F8a E7aE6b G6d E7b E7l F7 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet RockyRiver BoodomCreekM ou nt Pleasant Creek Liberty (S24 3 8 ) (S2469 ) (S2460) (U 4 2 1 ) (S2438 )(S2435)(S2 4 5 9 ) (R 4 2 1 )(N 49N)(S2436)(S2437)(S2458)(S2459)(S 2 4 3 8)(3700)(3300)(2 2 0 0 ) (6533) (6773)(5242)(5800)(3200)(6236) (0)(3155)(6281)(6327)(3148)(3146)(4600)(3100)(6172)(6100)(5023)(3309)(330 0) (6 5 0 0 ) (6800)(5300)(16 2 7 )(6662)(28 0 0 ) (16 2 6 )(4400)(5947)(5400)(2500)(70 0 0 ) (17 7 6 ) (17 7 7 ) (7200)(6503)(2928)(2500)(4700)(2700)(2797)(17 0 1 ) (2658) (17 0 0 )(6000)( 6 6 00)WEEDEN STTROYESTATERDSO A P S T O N E D R SANDY CREEKCHURCHRD TURNER LA K E R D NC HWY 49 NLEONARD DR WILLA R D RDWHITE OAK WAYDOGWOODWAYMAPLE WAYHICKORY WAYHAPPYHILLSDRBROO K S D A L E R DDUNCANFARMRD HEADENCTRYTRL US H W Y 4 2 1 POERDHICKSCTRYLNCRUTCHFIELD CTR Y R D B Y R D H OU SE R D BUM PASRDWALL RDSOAPSTONE MTN RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F7 F8a F8c F8b G7 G8c G8r F8o G8s F8a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet UtnearLibertyRockyRiver HANNA H M A C R D C O O P E R R D B TEAG U E R D MUDDYLN ALBRI G H T R D Liberty Liberty Staley Liberty (O8888)(S2461)(S1006)(S2552)(S2425)(R 42 1 )(S2426)(R421) (U 4 2 1 ) (S1006 ) (S2427) (S2460)(S2464)(S2 4 6 3 )(N49N)(U 42 1 ) (1 9 6 0 ) (227)(2600)(5596)(5824)(3400 )(5800)(6773)(5242)( 0 )(2700)(2754)(3900 )(4700)(3800 ) (3421 )(7 2 3 0 )(5023)(5617)(2695 ) (6503) (7000) (6662) (3236 )(3387)(2427)(1939) (0) (17 7 7 ) (3300) (177 6 ) (3491 )(3000)(6800) (6800)(2698)(2948 )(5300)(1871 ) (1838) (1837 ) (7200) (1870 )OLIVERS CHAPEL RDNCHWY49NOLD 421 RD TURNER LAK E R D STALEYVIE WTRLDEATON LANGLEY DR LIB E RTY PAR K AVE CRUTCHF IELDCTRYRD GLENNSMITH DRDUNCANFARMRD IS A A C D R FLYNT RDUS H W Y 4 2 1 HINSHAW CTRY RDPIKE FARM RDKINRO RD BROOKSDALERD JOHNMARSHRD OVERMANRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F8bF8a F8c G8r F8pF8o G8dG8s F8b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Mount Pleasant C re e k BrushCreek ReedCreek(S 2 5 5 8 ) (S2470)(S2503)(S2 5 4 5 )(N49N)(S2478)(S2472)(S245 7 )(S24 7 0 )(S25 0 7 )(S2547)( S2473 )(S2458)(N 49N)(S245 6 )(S2472)(2200)(2763)(600 0 )(4400)(7200) (6500)(6545) (2658)(1400)(2700)(7600)(3200)(2 2 0 0 ) (692 1)(2100)(1087)(3300)(33 0 0 )(2000)(3400)(2900)(1900)(6748)(1000)(1860)(6300)(3008)(6 5 9 8 )(2013)(1217)(1200) (2 464)(1707)(1700)(16 0 0 )(6900) (6319) (6600)(1500)(172 6 )(2157)(4000)(3600)(1700) (6145)(2200)NC HWY 49 NSOAPSTONEM TNRD WHITESCHAPELRD OLD STALEY RD COX M EADOW RDDEBRADR FE RG U SONRD S O A P S T O N E D R WILLIAMS CTRY RDWARRENDR WRIGHTCTR YRDW EEDENST SHADY GROVE CHURCH RDKIVETTCOUNCILRDSMITHADKINSRDEXTGOLDFIELD R D RA IN EYRDSEAYS RDLANDESTATESDR SMITH A DKINSRD JUNE TRL LA C K E Y R D LANGLEYLOOPSTILLMEADOWSLN² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F7 E8 F8c F8a F8b F8s E7b F8o F8c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Staley(S2461)(S2536)(S2462) (S2469)(7345)(61 0 0 )(2400)(240 0 )(7300)(1800 )(2600)(2500)(300) (7100) (315 1 )(2300)(7200) (427 ) (22 6 ) (3300)STALEYCOVETRLMARGARET CHAPEL RD LITT L E R DOLIVERSCHAPELRD STALEYCOVEDRSCOTTON RD W FRANKLINVILLE STMARLEY CIRWEEDEN S T N M A I N S T ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F8o F8c F8b F8s F8p F8t F8a F8o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet STALEY SNOW CA MP RDDOERUN US 4 2 1 N US 4 2 1 N W COOPER RDCHARLIE COOPER RDCOOPERRDStaley(S1006)(U 4 2 1 ) (1 8 7 0 ) (0)(250)(7300)(24 0 0 )(7345)(2 0 0 ) (300) (610 0 ) (2 2 6 ) ( 1 0 0 ) (210 0) (7500)(2400)(2427)(1 9 3 9 ) (7700) (1 9 6 0 )(300)(200)US H W Y 4 2 1 E FRANK LI N VIL L E S T W FRANKLINV I L L E S TS STA LE Y S TSTALEYCOVETRLSTA L E Y C O V E D R F O U S H E E S T WARREN STOLD 421 RDW FRANKLINVILLEST N STALEY STH I L L S B O R O S T LITT L E R D PITTSBO R O ST GRAHAM S T N M A I N S T OX F O R D D R DOERUNTRLGRAY FOX LN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F8p F8b F8t F8o F8s F8p Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Brush Cr e e k Staley Staley(S2559)(S2473) (S2470)(S2471)(S2470)(6900)(1700)(172 6 ) (300) (7200)(1800)(1258)(7400) WILLIAMS CTRY RD OLD STALEY RDCOXMEA DOWRDW FRANKLINVILLE ST SCOTTON RDLANGLEYRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E8 F8s F8c F8t F8o F8p F8s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet OLD U S 4 2 1 N Staley (S2469)(O1367)(3 3 0 )(0)(98)(5 4 0 ) (120) (300)(410)(300)(7400)(300)(1867)(20 0 )(400)(100)(600)(5 0 0 )(2)THRU ROA D SMAI NSTN M A I N S T W R A I L R O A D S T PITTSBO R O S T COLUMBIA ST WFRANKLINVILLEST ENTERPRISE ST FO U S H E E S T KIVETTSTS S T A L E Y S T SC H O O L S T OLD STALEY RDP A R K S TCHURCH STSHAW STWARREN ST C O O P ER ST BROWNS CROSSROADS RDAS HEBO RO ST EDWARDS S T WARD RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR E8 F8tF8s F8pF8o F8t Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet NorthHambyCreek E S U N R I S E A V EDUKE STLEACH AVETRINITY ST S U N RIS E C E NTERDRCAROLINA AVE VIRGINIA AVE FRANCES ST VIVIAN STTENNESSEE AVE CONRAD STPONTIAC DR U N I T Y S T PONTIACDRLIBER T Y ARMSCTDUKE STDUKE STMASON WAYSUNRISE CENTE R C T F R E E MONT DR BRILES ST LONGVIEW DRSWANEE LNSHORT ST BORDER STFA LLINGCREEKDRSAVANNAH LN DEDMONDCTGEORGIA AVE DUNCANDRBISHCTTODD CT COUNTY LINETrinity Trinity Trinity Trinity Thomasville (S 1 5 4 7 )(S1558) (300) (1379)(113)(112)(65 4 3 ) (192) (1351)(5)(6591)(101)(1300)(200) (1) (20) (6 6 2 5 )(8123)(1 0 0 ) E SUNRISE AVE BRECKENRIDGE DRU N I T Y S TCHARTERPL KENTUCKY LN SIGNET CT NEW YORK DRMARYLANDDRFLORIDA DRWEXFORDCIRTURNPIKE R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1f G1j H1r G1g H1s G1k G1f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet NorthHambyCreek Trinity Thomasville (S1842)(S1841)( S 1 5 4 7 )(S3151)(S 1 8 4 0 )(S1840)(6213)(1351)(1410)(6 5 3 1 ) (1379) (65 9 1 ) (20)(4779)(200)(112)(6673) (6 5 0 0 ) (4863 )(101)(4861)(6600) (6753)(4853)(4500)(65 4 3 )(100)(8 1 2 3 )(1)(6700)(4844)(6835)(4622)( 6 3 6 9 ) (300) (401)(4494)(113)(6961) (7 3 0 0 ) (6900) ( 6 7 3 9 )(6677)U N I T Y S T ESUNRISEAVE E SUNRISE A VE N EW YO RKDRWEXFORD CIR WEXFORD CIR OAK KNOLL CTTURNPIKECTFLORIDA D R FREEMONT DR BRECKENRIDGE DRCOLONIAL CLUB DRPIKE VIEW DR JAY MAC CTNUGGETT CTLAKEVIEW CTT U R N P IK E R D FREEMONT CT COLONIALCL U B D RMCWAY CTCOLONIALMANORDRMARYLAND DRSINKFARM RD WILDWOODTRL² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1gG1f H1s G1k G1h G1lG1j H1tH1r G1g Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Trinity (S1842)(S1561)(S1831)(S1827)(S1732)(S1648)(S1885)(S1558)(S1829)(S 1 5 6 2 )(N 62)(S1558)(S1840)(S1731) (4771)(4449)(4800)(5500)(6200)(5621)(7000)(5000)(6 6 0 0 )(5636) (6900) (6 7 0 0 ) (6800) ( 4 511 ) (6600)(4749)(6500)(4774)(4644)(4422)(5558)(4827)( 4480 ) (6306)(5100)(4 5 0 0 )(4615)(6105)(6090)(5700) (7021)(4600)(6700)(4545)PIKE STREGINA STCOLONIAL CIR NC HWY 62 CEDAR HILL CTGREENVALLEY D R TURNPIKE RD OAK KNOLL CT COLONIALCLUBDRELLEN AVEBROOK CIRREDDICK STTRINITYCTI R WI NSTMEYERS STCEDARBERRYRD MAPLEOAKDRPIKESTEXT JERRY STCOLLETTFAR MR DJOE HOFFMAN DRBR O O K CI REXT WANDA DR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1h G1l H1t G1g G2e G2i H1s G1k H2q G1h Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet CLONIGER DR E H O LLY HILL R D OLD RALEIGH RDDUKE STDIANA DR CASTLETONDRD O N T R U E L L L N BUCKINGHAM LN DONTRUELLLN REGENCY INDUSTRIAL BLVDLA K E S H O R E D R ARTHUR DR LEACH AVE LOCKS L EY C TLONGVIEW DRTROTTERS RUN R O T A R Y C I R ROTARY L NSCOTTWOODDR COUNTY LINE RDLAKEVIEW CIRTrinity (S1855)(S1787)(S1856)(I 85) (N 62)(S1790)(O9999)(4058)(7100)(7400)(1379)(4302)(1351) (7069)(6998)(7033) (7100)(6954)(4200)(1300) (7200)(7300) (7034)(1841) (1842) (4106) (4300 )(4100)NC HWY 62VALLEY VIEW RDCOLORADO BLVD QUAIL WAYTEXAS BLVD LANSDOWNEPLE SUNRISE AVE COUNTY LINE RDMONTANADRCOURTNEY LNVALLEYCIRWYOMING CTKINGSTON RD INTERSTAT E H W Y 8 5 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1j G1f G1k G1n G1g G1o G1j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet LittleUwharrieRiver(WheatmorePond)Trinity Thomasville (S1840)(S1886) (S1547) (S1790)(S1855)(S1791)(S1887)(S178 8)(S1734)(I 85)(S1786)(S1651 ) (S 1789 ) (S1856) (S1857) (N 62)(S1787)(S1556) (S3189 ) (N 62) (S 1 7 8 5 ) (S15 4 7 )(I 85)(R 85) (6 3 6 9 ) (4503) (1351) (7034) (7069)(4200)(6424)(7200) (3766 ) (4106) (6600) (1379)(7 3 00)(5900)(6794)(5800)(1643)(3746)(4058)(4100)(5838)(5664)( 6 0 0 0)(4200)(7600)(5600) (4 2 2 3 ) (1596) (4000 ) (4671) (5477 ) (7000) (7100)(6447)(1410) (4600)(4300)(4951) (6 5 1 6 )(7200)(7100) (4400) (6 1 0 0 ) (7400) (6800) (4800) (6900) (621 3 )(1841)(1842)(0)(1768)(1767) BELLAWOOD D R B O RD E A U X D R U N I T Y S T NC HWY 62MARYLAND DRCOLONIAL CLUB DR ESUNRISE AVE TEXAS BLVD COLORADO BLVD REGALWO O D C TKINGSTON CTCHATEAU DRLANSDOWNE PL VALLEY VIEW RD WELBORN RD WHIT E HOR SE DRMEADOWBROOKVIEWRDMONTANA DRFINCH FARM RDSTONEGABLES DR INTERSTATE H W Y 8 5 TRAVELERDRQUAIL WAYVALLEYCIRREGALWOODDRKINGSTON RD BRIARC L I F F RDSHADYDALE ACRES LNSHERWOOD FOREST DR ROCKLE D GELNCOURTNEY LN GRA LA N D R A R D E N R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1k G1lG1j G1g G1o G1f G1h G1pG1n G1k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Trinity(S1840)(S1745)(S1766)(S 1895 ) (S1893) (S 1 5 6 2 ) (S1764)(S1734)(S1819)(S1765)(S1733)(S1732) (S3127) (S1767) (S1556)(S1885)(S1731)(S1894)(S1556)(S1899)(N 62)(S1763)(S1762)(I 85) (7400)(5558)(4000)(3900)(6070) ( 4 5 4 5 ) (6299) (4 2 0 0 )(4 3 00)(6516) (6600) (7000)(3893)(4400)(4951) (6300) (6400) (7100) (6200)(5400)(3944)(4 5 0 0 ) (4 9 1 2 ) (6500)(4449)(4100)(6500)(4480)(4 2 2 3 )(4511)(5500)(4422)(4300)(6700)(4438)(4400)(5041) (6218) (6900)(447 3)(7200) (4310)(4800)(6600) (6700) (4200)(5200)(4100)(1643) (1596) WELBORN RD GREEN VALLE Y D R NC HW Y 62COLONIAL CLUB DRCRESENT AVEWOODCREST STLAKEWOOD CT EXTTWINWOOD DROAK HAV EN C T LOWERYWOOD CIR HEATHWOOD DR CO L ON I A L C I R B O R D E A U X D R OAK HAVEN DROAK CT B E LLA WO O D DRREDFOXRDC O L L E T T FA RM R D DAWNWOOD DRT WINWOODCT CEDARBERRYRD EDGEWOOD DR SHADYDALE ACRES LNCOLONIALCIRREGINA STFORESTMANORDRJERRY STIRWIN STLAKEWOOD CIRROSEWOOD DR SUMMER SHADE DRJORDAN S T JO R D ANST FAIRWOOD DRINT ERS TAT E H W Y 8 5 INTERSTATE H W Y 8 5 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1l G2iG1k G1p G1h G2c G1g G2e G1o G1l Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet ARTHUR DR I 85 S I 85 N DONTRUELLLN OLD FAR M R D KAYLAN LN SUMMERS TRL WELBORN F A R MDR SPLITRAILCIRQUAIL LNPEACEFUL RETREAT TRLS CAMEO DRTOWER RDSINGLETREE LNHERITAGE CT N CAMEO DRROXIE DR FARABEELNTrinity (S 3 1 53)(I 85) (S3152)(1842) (7500) (7200)(3700)(7000)(3900)(7300)(3500)(7455) (3800) (3 6 0 0 )(1841) (7400) CHAPSWORTH DR ENGLISH PRIDEDR CEDAR TRLSTIRRUP CT FOX CHASE DR BELMONT DRCANTER DRTROTTERS RUN CITATION DRINTERSTAT E H W Y 8 5 OLD FARM RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1n G1j G1r G1o G1s G1k G1n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet LittleUwharrieRiver (WheatmorePo n d )Trinity (S1734)(S1547 ) (S1651 ) (S3203) (S3201) (S1547) (7 1 0 9 ) (5477 ) ( 7 0 7 7 )(3746)(3608)(6872) (5300 ) (3 6 0 0)(3566)(3766 ) (6965)(3464)(6934) (3569) (5200 ) (4000 ) (6960)(3944)(3900)(7062)(5238 ) (6800) (6900)(6915)(3900)(5100)(7100) (6341)(3634)(3497)(7200) (7200) (5400 )(3763)(7057) (7 1 1 8 ) (6411)(3509)(4000 ) (6807) (6797)(3700)(7300) (7113) (7000) (7000) (7014) (4 5 8 0 ) F ALCON WAY FI NCHFARMRDBRIDLEWOOD DR WHITE HOR S E DR SHERWOOD FOREST DR EXTTRAVELERDR SADDLEBROOKDR QUARTER HORSE DR WINNERSCIR STEEPLEGATE DRSADDL E C L U B D R CARRIAGE PLCAMERON CT CHAPSWORTHDR ASCOTDRTROTTERS RUN SHADYDALE ACRES LNSHERWOOD FOREST DR DAWN ACRES DR BELMONT DR DERBY WAY TANNER CT WHEATMORE CT COUNTRY MEADOWS LN FOXCHASE D R W A TERFO RDDRENGLISH PRIDE DR HUNTERS CLUB DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1o G1s G1k G1pG1n G1lG1j G1tG1r G1o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Trinity(S1745)(S1741) (S1744) (S3198) (S3127)(S3199)(S3179)(S1821)(S 1 8 9 2 )(S1743)(S1742)(S1891)(S1820)(S1740)(S1819)(S 1 5 4 7 ) (S 1891)(S3107)(4300)(6807)(4000)(3400)(3725)(6500)(3660) (6800)(6900) (6600) (6 6 00)(6700) (3537) (6400)(3600)(4000)(3803)(3706)(3800)(4100)(3900)(4580) (3900) (3 8 9 3 ) (3800)WOODCRESTSTLAKEWOOD CIRWHEATMORE CT EVERGREENDRCIRCLE CTERIK DR LAKEWOOD CT EXTMEA DOW DR RED FOX RDLAKEWOODCT ROSEWOOD DR MEAD O W CTLONGVIEW AVEAZALEA LNR O C K D AM C TCRESENT AVEFOX MEADOW RDGREENWAY DRFI N C H F A RM R D CARRIAGEHOUSECIR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1p G2c G1l G1t G1o G2i G1s G1k G1p Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet FULLERMILLRD WALL AVEQUAIL C TSINGLETREE LNSHADY LNFARMBROOK PL OAK BUCKET RD WAGON WHEEL RD OVERLOOK DR AUTUMN DR OVERLOOK HTSELTON CTBLAKES CTS CAMEO DRO L DE FORESTCT TOWER RDPEACEFULRETREAT TRLTIMBERLAND DRGAME TRL FRIENDLY RDTrinity(S3153)(S1866) (S1865) (S 1 5 4 7 ) (S3208) (S3207) (S1554)(S1864)(S1867)(S1869)(48 0 0 ) (7103) (47 0 0 )(7500)(3400)(3093)(3200)(7400)(2729)(4 4 2 1 ) (7300) (4 6 0 0 ) (7329) (7323) (7400) (7217)(3000)(3300) F U LLE R MILL R D NGREENTREERD YOUNGOAKDR WRIGHTRD F A R MBROOK PL CEDAR TRLMOUNTAIN VIEW WAY GUMWOOD RDHARVEST DRKATRINA DR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1r F1f G1s G1n F1g G1o G1r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet LittleUwharrieRiver(WheatmorePond) Trinity (S3248)(S3245)(S3275)(S3277)(S3278)(S3273 ) (S3274)(S1554)(S1554)(2778)(2779)(7217)(6800)(6674) (3198 ) (3300 ) (6866) (6835) (3058 ) (6806) (6953)(6 8 5 0 )(2940)(3037)(6 9 4 5 ) (6869) (7 0 0 0)(2820)(2 9 0 4 ) (7103)(2999)(2 9 9 5 ) (2883)(3100)(6665)(7 0 0 8) JENNIFER LY N N D R STONESIDE CIRSTONEHENGERDWRIGHTRD ABIGAIL DR RIVER GATE CTDUSTYROCKDR STONEHENGE PLWOODALE CT C RO O K E D STREAM LN BUILDERSDRWOODALEFOR E S T LN LITTLECREEKDRYOUNGOAKDR R I VER RIDGE LN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1s F1g G1tG1r G1o F1f F1b G1n G1p G1s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Little U w h arrie River(Wheatm ore Pond) Trinity (S3108) (S3248)(S3246)(S3232) (S3107)(S 32 4 5 )(S 1 5 4 7 ) (S3106)(S1553)(S3247) (S 1 5 4 7 ) (6701) (3537)(3516) (2904)(3692)(3725)(35 0 0 )(3619)(6800)(6600)(3400)(3548) (4 5 0 0 ) (6600)(3600) (6700)(3400)(6379) (4000) (4 5 8 0 ) (7000)(2900)(4300)(3191)(6500) (3 5 1 7 ) ABIGAIL DR MEADO W CT OLDMOUNTAINRDLITTLE C R E E K D R GADDY DREVERGREENDR JENNIFER L Y N N D R K EN N E D Y R D B A RBARA L N FINCHFARMRD LEAHJUSTINEDRCIRCLE CT STARLETTE LN EV ER GREENDR AUTUM NACRESLNLEAH JUSTINE DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G1t G2c F1b G1s G1p F1g F2a G1o G1t Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet U wharrieRiver Trinity (S1891)(S1564)(S1897)(S3110) (S3252)(S1868)(S1759)(S1760)(S3223)(S18 8 8 ) (S3106) (S1556)(S3252)(S3106)(S1557)(S1564) (5968) (35 1 7 ) (4411) (6466) (5454)(3803)(3700) (6 2 3 6 )(3842)(4360) (4300)(3893)(5900) (6299) (6159) (5524) (5500)(40 90) (5513) (3709)(3892)(65 0 7 )(3500)(4000)(3884)(3200)(3962)(5354)(4100) (57 0 0 ) (6000) (6 1 0 0 ) (6291)(5204)(420 0 )(3099)(3142)(3205)(4 5 0 0 ) (6600)(3600)(3400)KENNEDY RD FIN C H F A R M R D BROKENOAKRDALAMOCT HOPEWELL CHURCHRD BROWN HOUSE RD MEADOWBROOKDRRED FOX RDHABITAT DRALAMO DRLAWSON DRWELBORN RD WALKI NG STICKDRLEESVILLE ST LIBERTYCHURCH DREVELYNDR HARTSELLDRKENNEDY CT MOUNTAI NVI EWSTSHANNONDRBROKAWDR HABITATDR EXTSUMMERVILLEDREXTM ILLERFARMDRMARIEDRROBBINSFARMDRMORRIS RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2c F2a G2d F2bF1b G2iG1l G2j G1t G2k G1p G2c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet UwharrieRiver Trinity TrinityTrinity(S1566)( S 1 5 6 7)(S1704)(S1545)( S 1 5 4 5 ) (S1566) (5 3 8 9 )(4496)(5204)(5752)(46 5 9 )(4 7 5 2)(4800) (5300 ) ( 4 6 4 6 ) (4 4 44)(4243)(4228)(4100)(4700) (44 1 0) (57 0 0 )(4200)(4453)(4010)(5000)(4792)(4519)(3400)(540 0 ) (4600) SUMMERVILLE DR EXT KE N N E D Y R D M ILLER SM IL L R D SUMME R VILLE D R EX T FAIRVIEW CHURCHRD PEA C E F U L L N PINE CONE CT E D GE F AR MLNFRIEN D SHI PLNHILLCREST LNSUNSET KNOLL DRR O B BINS CTRYRD S HA G BARK DRFLORA MAE LNPEACE RDSUNSETKNOLLDREXTS H IR L E Y J EA N DR MILLE R S MI LL R D² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2d F2b G2c F3aF2a G2l G3iG2j G2k G3q G3m G2d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Uwharrie River Trinity (S1883)(S3252) (S3123) (S 1884) (S1 5 6 3 )(I 85)(S1 8 8 2 ) (R 85) (S1558) (N 62)(S1595)(N 62)(I 85)(5702)(4887)(1603)(5000)(4700)(4900)(6600)(5437) (5500) (5900)(6090)(6100)(5136)(5704)(4600)(5600)(5700) (4800)(1596)(49 0 0 )(0)(1568)(6306)(1400)(5700)(4924)(6200)(1401)JOE HOFFMAN DR HOPEWELL CHURCH RDMERLE DR MORGAN ST OLDHOPEWELLCHURCHRDCOLLINS STNC HWY 62 WAGONER RD DWIGHT STBROOKCIREXT PAYNE STCOLTRANE ST OLDTURNPIKE RDSABINE S T SURRETT DRINTERSTATE HWY 85TURNPIKERD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2e G2i G2f H2q G1h G1l G2j H1t H2r G2e Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Trinity (S1826)(S1702)(S3122)(S3212) (S 1 5 64)(S1823)(S1880)(S1640)(S1824)(S3104)(S1724)(S1606)(N 62)(S3103)(S1656)(S1703) (S1565)(S1564)(S1661) (S3123)(I 85)(4978)(6200)(47 1 5 )(4887)(5176)(5000)(5177) (5276)(4911)(6 1 0 0 ) (5300) (5068) (5263) (6 0 0 0 )(4752)(5114) (5 800 )(5200)(4687)(5400)(4900)(5153)(5043)(5700)(5332) (5238)(4937)(5335)(4933)(5700) (5228)(4927)(5000)(5600)(6600)(5100) (4800)(5242)(5076)(4873)(5300)(5400)(5146)(4700)(5500)(1400)(1401)NOLA ST EXTDARR RD SABI N E S T NC HWY 62DARR R D EXT HILLTOP AVE DOGWOOD HEIGHTS LNMEADOWBROOKDRCOLLINS STTRINITY BLVDKIMBERLYLN REDDICK VIEW STBROOKDALE DRTONY DRDARRRDEXTRONNIEDALERDELMWOOD STALBERTSON VIEW ST ALPINE DRCAIN CTRIDGE D R OAKWOOD DRJAMES AVE JOHN DR BROWN STREAVISSTKIMBERLY LNOSBORN ST WILLOWBENDRDMERLE DR MORGAN ST WAGONER RD INTERST AT E H WY 85 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2f G2j H2r G2gG2e G2i H2s G2k H2q G2f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Trinity Archdale Archdale Archdale(S1654)(S1607)(S1653) (S1565) (S1004)(S1566)(6200)(5258)(5089)(4759)(5080)(4978)(5330)(4661)(5300) (468 7 ) (5059) (201 ) (12000)(5156)(510 0 ) (475 1 ) (200) (5030)(5200)(1 2 0 4 2 ) (5010)(5109)(4878)(100)(5092) (4800) (4900) (5141) (11766) (4715) (6723 )(6500)FAIRVIEWCHURCHRDDARRRDROSELEE DRGROVE STCOTTONRDROLLING RDRONNIEDALE RD ALFO R D S T MAYNARDDRNORMANAVE TRINITYRD ENGLISH CTREAVISST LAKE DARR RD CEDARDALESTWARREN LN BARWOOD TER SPIVEY LNCUMBYRDDARRRDEXT ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2gG2f H2s G2k G2h G2lG2j H2tH2r G2g Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Trinity Archdale Archdale (S1004) (S1 0 0 4 )(S1567)(700)(6000)(4300)(4715)(4400)(4201) (200) (11744)(500)(4100) (1003)(5015)(4901)(5023)(4809)(4601)(11700)(4801)(468) (201) (801)(901) (5475 ) (11766) (4501)(5020)(101)(4 908)(100)(100) (11300) ( 4800 ) (5100) (500 0 )(4701)(100) (100)(301)(11200) (200)(5006)(5150)(10700 )(202)(1001)(5800)DEATON RDROBIN LN WESTHAVEN LNWHISPER OAK DRCAMERON CT BIRCHWOOD CT MAPLEWOOD CT TRINITY RD ROBIN CTFOXBORO CT OAK FOREST LN BLAIR DR ROBIN LN ASHWORTH CT BROOKLEIGH CT ROBBINSCTRYRDBILLY AVEARCHDALE RD JACKIE AVELANE DR TREETOP CT ASHWORTHDR BRANDON LN WINCHESTERCTENGLISH CT FRYE STROBIN CIR SPRINGWOOD LN² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2h G2l H2t G2g G3e G3i H2s G2k H3q G2h Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet UwharrieRiver Trinity (S1765) (S3252)(S3133)(S1883)(S1556) (S1767)(R85)(S1761)(S1762)(S1556)(I 85)(S 1 5 6 3 )(S3252)(5433 ) (6500) (6400) (6218) (4422)(4500)(6200) (5400 ) ( 4 3 6 6 ) (6300)(4400)(5437) (4 4 00)(6100)(4324)(4600)(1643) (6299)(6070)(0)(1603)(4100)(5700)(1596)(46 0 0 ) (49 0 0 )HOPEWELL CHURCH RD WELBORN RD HEATHWOOD DR LOWERYWOOD CIR STONERIDGEDR WI NDRI DGEC T DAWNWOOD DRCOLDBR O O K CTW E L B O R N R DOLDHOPEWELLCHURCHRDINTERSTATEHWY85WEDGEWOOD TERCOLTR A N E ST ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2i G2c G1l G2j G2e G2fG1h G1p G2i Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet UwharrieRiver Trinity(S 3 2 0 5 ) (S1825) (S 3 1 3 3 )(S1564)(S1826)(S1824)(S1823)(S1556) (S1563)(S1564)(4324)(4752)(4500)(4472)(4466)( 4 3 6 6 ) (440 0)(4763)(5262) (5300)(4 4 22)(5152)(5204)(4952)(5000)( 4528 )(4705)(4600)(4700)(5433) (5332)(4687)(4606)(4657)(5492) (5700)(4666)(46 0 0 ) (4360)(4800)(5204) S TO N E R ID G ED RALPINE DRC O LTRANEST ME A D O W O O D C T OAKWOOD DRWI NDRI DGEC T COL D BROOKCTLINK CTNOLA ST LINK RD SUMME R VILLE D R E XTMEADOWBROOK DRROLLING RDNOLA ST EXTWAGONERVIEW DR WAGONER VIEW DR BILLYLEERDGLENNVILLE DR WELBORN RD ALBERTSON FARM RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2j G2c G2i G2f G2k G2gG2e G2d G2j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Trinity Archdale (S1753)(S1846)(S1847)(S1751) (S1752) (S1754)(S1566)(S1568)(S 1848 ) (S 1 5 6 6 )(6500)(4484)(6100)(4661)(5152)(4569)(6000)(4944) (4600) (4900)(4500)(4606)(4700)(6000)(4705)(5204) (4900)(4759)(5752)(4647)(4486)(4512)(5000) (5000) (6 2 0 0 )FAIRVIEW CHURCH RDCALVERT STROLLING RDFAIRVIEW LNLINK RD BARKLEY STWESTHAVENLNSHI RLEY JEANDR LANVALE AVE FAIRVIEW DRDEATON RDRONNIEDALE RD BILLYLEERDSUM MERVILLE DR EXTFAIRVIEW DR EXT FAIRVIEW CTROSELEE DRPEACOC KL NSUMMERVILLEDRONEALFARMRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2k G2d G2lG2j G2gG2f G2c G2h G2k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Trinity Trinity Archdale (S1568)(S1567)(S 1 5 6 7 )(S1704)(5023)(5020)(5448) (100) (5400 ) (200) (4189) (4438)(4486)(6000)(470 0 )(4866)(4400)(4647)(5089)(5475 )(4569)(4453)WHISPER OAK DRDEATON RD ROBBINSCTRYRD OAK FOREST LN PETE LNWESTHAVENLN ALEXANDRIA DR PEACOCKLN SPENCERVIEWLNDEERWOOD LNPEACE RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2l G2d G3iG2k G2hG2g G3e G3m G2l Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet MuddyCreek Ta ylo r Bra nch (I 74) (S1756)(S1777)(S1776) (S1 930)(S 1 6 6 9 )(S2054)(S1571)(S204 1)(S1530)(S1 0 0 9 )(S1719)(U 311)(S2042)(S1526)(S1755)(S2027)(S2077) (S1983) (S1531) (S1984)(S1922)(S1929) (R74)(S1932)(S 2 0 5 3) (S 2 0 6 6 ) (S1928) (I 7 4 )(S1927)(3 4 1 3 )(6151)(5330)(6477) (4562) (2884) (2967)(5475)(2760)(5563)(2 9 5 7 ) (8470) (5700) (51 5 2 )(5800)(5250)(6400)(5536)(3346) (86 0 0 ) (8 4 1 5 )(5842)(2824)(82 1 0 )(5218)(49 2 8 )(5726)(5400)(6400) (2600)(5400)(5200)(5319)(5914)(6500) (5508) (87 0 0 )(6200)(7 6 0 0 )(5102)(2902) (5815)(5594)(2646)(5500)(5300)(83 0 0 ) (81 0 0 )(5587)(5420)(3019) (2781) (2896) (2532)(5600)(5100)(5254)(3198) (2300) (3 2 0 0 ) (2800) (5292)(5800)(5600) (28 3 7 )(5973)(2700) (0 )(5500)(1000) (25 6 4 ) (54 6 1 ) (48 1 5 ) (6000) (3017) (2958) (10 0 1 )(5700)RHONDA DR INTERSTATEH WY74 US H W Y 3 1 1 MUDDY CREEK RDENFIELD DR SPENCER LAKE DRDAWN DRCEDAR SQUARE RD GLENVIEW DR PO O L E R D EDGARRDB R ONZIELAWSONRD LANCER DR STANLEYRD OLDC ED AR S QUARERD GODNICK LNBOULDER CT CRAY DR EXTCRAY DRWHITE LN POOLE RD EXT JOHNSONSTEXT HOWARD RUSSELL RD RI D G E V I E W R DGLENOLAINDUSTRIALDR H YDEAWAYLNO L D S P EN C ER R D BOULDER DREDGARVIEWDRBELORUSH DROLDGLENOLA R D STONEY CREEK DR ELKES PLJOHNSON STDEWITT COLTRANE DRCANTERRDSOUTHLAND DRMOBILE DRHILLFARMRDBOWMAN LOOPDRFOLWELLDRSPENCERRD MANOR RIDGE DRJASPERDRCANTE R LN RICH A R D S O N RD ELMERBEESONRDH U G HES FAR MRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3b G4a H3d G4c G3j H3c G3f G3d G3k H4q G3n G3o G3b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Bob Branch(S3167)(I 7 4 ) (S1858)(S1526)(S3146)(S2 0 6 7 ) (S1946) (S 1 5 2 8 ) (S2028) (U 3 1 1 ) (S 2 0 6 6 )(S1689)(S3168) (S1527) (S1931) (S1529) ( S1 5 2 6 ) (U 3 1 1 ) (S1528) (7 5 2 8 ) (3 0 1 7 ) (7 5 0 0 )(3010) (63 5 3 ) (2 9 5 8 ) (65 0 0 )(4700)(4654) (3400) (2400) (3153) (3200) (66 9 8 )(4100)(4 0 2 7 ) (51 0 0 ) (3271)(4500)(4 30 0) (3300)(2513)(2408)(4800)(2781)(5000)(4600)(2540)(2665) (5 3 0 0 )(3985)(4497)(4500)(264 6 ) (65 4 3 ) (4 8 1 5 )(3100)(4316)(3100) (2818) (6 8 0 0 )(5100)(2500) (2114) (7 6 0 0 ) (2800) (47 0 0 ) (7 0 0 0 ) (4 4 0 0 ) (34 1 3 ) (34 1 4 ) U S HW Y 3 1 1 MARLBOROCHURCH RDVILLADR INT E R S T A T E H W Y 7 4 O LD E D GAR RD ETTA CTALLEN DRMARCALCIR OLD MARLBORO RD ROSIN RUN SILVER MAPLE RD EDGAR RDALL R E D H E I G HT S D R WALKERMILLRD GR A Y F A R M R D PINE NEEDLE LN EXTBRADR D MARY VIOLADRLOFLIN DAIRY RDSPARTA DRBANNER WHITEHEAD R D NEWLIN FARM RDFREDFRANKTRLBAKERF ARMRDWHISPERINGWAYH U G H E S F A R M R D STEWART STFARLOWEDAVISDRHOG SLIDE RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G4c F3b F4a G3d G4aG3b G3s G3k G3o F3a G3j G3r G3n G3d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet CarawayCreek Archdale Archdale(S1917)(S 1749)(S1750)(S1810)(S10 0 9 )(S1570)(S1 0 04) (214)(5621)(101) (5200)(261)(5207) (3620)(400)(5745)(300)(3700)(201)(4000) (5600 ) (5000) (1015) (3900)(5348)(980 0 )(5400)(1003) (300) (100)(200)(5400)(312)(95 3 8 )(100)(5700)(5200)(1 0 7 00) LANE DR BELGIAN DR COUNTRY LNCREEKWOOD DR LINDA DRDONNAVIEW DRGREGG STSUITS RD KREAMER DRRIDGECREEK DRBLAIRCTBLAIR DR CHET DR TOM H IL L RD HARDIN ST ROBERT LN CHET DR EXTUS H W Y 3 1 1 MEADE DRROBIN LN RIDGECREEK CIR ARNETTE DRARCHDALERD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3e G3i G3f H3q G2h G2l G3j H2t H3c G3e Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Caraway Creek Archdale Archdale (S1808) (S1739)(S1810)(S1809) (S1738) (S1 0 0 9 )(S1811)(S10 0 9 ) (S1918)(S1919)( S2053 ) (I 74 ) (3200)(5400)(87 0 0 ) (3700) (95 0 0 ) (89 0 0 )(5500)(3620)(5730)(94 0 0 )(5665)(3600)(5600)(5500)(953 8 )(5621)(9 0 0 0 )(5400)(910 0 )(5600)(54 6 1 ) (1001)(1000)BELO R U S H D R LILLY FLOWER RDUS H W Y 3 1 1 DONNA VIEW DR CEEBEE DR KREAMER DR DRIFTWOOD DRFERNWOOD DR SHADY LAWN CTARNETTE DRMAULDIN DRFRANKWHITEDRCRESTWOOD DRTROTTER CTRY RDOLD POOLE RDPOOLE RD I NT ERST ATE HWY 7 4 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3f G3j H3c G3e G3b G3i G3k H3dH3q G3f Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Ca r a w a y C r e e k Archdale Archdale(S1570)(S1 0 0 4 ) (S1727) (S1725) (S1746)(S1571)(S1004)(S1726)(100)(3982)(4045)(5400)(4759)(4063)(5000)(5650)(3943) (10 6 0 0 ) (4189)(5200)(10200)(5100 ) (41 3 4 ) (5500) (10400 ) (10 7 0 0 ) (3800)(4868)(4100) (3664) (3900)(3 7 0 0 )(10001)(5100)SHINING WAYSOLITAIRE DRALEXANDRIADRVALLEY FORGE DR WINDEMERE CIRYORKTOWN DRPINE RIDGE DRARCHDALE RD POTOMAC DR TOM HILL RDKENTLAND DR OLD GLE N OL A R D ARBOR DR WILLIAMSBURG DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3iG2l G3j G3e G3m G3fG2h G3nG2d G3i Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet CarawayCreek Archdale Archdale Archdale (S1780) (S1756)(S1699)(S1726)(S1772) (S1698) (S1773) (S1770)(S1532)(S1769) (S15 7 1 ) (S1775) (S1768)(S1747)(S1777) (S1774)(S1757)(S1758)(S1755)(S10 0 9 )(S1532)(S1776)(S1697)(S1571) (89 0 0 ) (3664)(5347) (3800) (3500)(5600)(4763) (3400) (4562)(5358)(3600)(5100)(5212)(5500)(5400)(3200)(5000)(5900)(5300)(5800)(5650)(3400)(5600)(330 0 ) (3600) (3500)(5300)(5700)(4900)(5100)(87 0 0 )(6000)(5400)(4980)(3700)DENISE DRUS H W Y 3 1 1 MARLBROOK CTPINE RIDGE DR RHONDA DRTOBACCO RDARBOR DR LANCER DRMEADOWDALE LN OLDGLENOLA RD ENFIELD DRGLENVIEW DRDELWOOD DRWINDEMERECIRHOLLYRIDGE DR BUNDY DR IVEY LN ALLWOOD DR CRESTWOOD CTRY CT ROCKRIDGE CT L I LLYFL OWERRDDAWN DRELMONT STCLIFTON DRMANOR RIDGE DR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3jG3i G3f G3k G3n G3e G3b G3oG3m G3j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet (S1776)(S1755)(S1922 ) (S 2 0 6 6 ) (S1571) (S 1 6 6 9 ) (S10 0 9 ) (S2041)(S1530)(S 2054)(S1719)(S1930)(S1928) (U 3 1 1 )(U311)(S2042) (S2053)(S1526)(S2077) (S1531) (R 74) (I 7 4 ) (8 4 1 0 )(5100)(5400)(5200) (2884) (5 500)(2794)(5727)(5475)(5594)(3019) (6000) (2900) (29 5 7 ) (5765) (8470) (5700) (51 5 2 )(5800)(5250)(5536)(4 8 1 5 )(3346) (86 0 0 ) (84 1 5 )(2824)(8 2 1 0 )(5218)(3200)(49 2 8 )(5400)(87 0 0 ) (5600)(5200)(5319)(7 6 0 0 ) (5508)(5102)(2902) (5815) (5300) (8 3 0 0 ) (8 1 0 0 )(5420)(2781) (5292)(5600)(30 1 7 ) (10 0 1 )(3198) (320 0 ) (28 3 7 ) (29 5 8 ) (0 ) (25 6 4 ) GLENVIEW DR US H W Y 3 1 1 LANCER DR MANOR RIDGE DREDGAR RDPOOLE RD BRONZIE LAWSON RD C ED A R S Q UAR E R D MUDDY CREEK RDHIL L FARMRDO LD C EDAR SQUARERD MOBILE DRSPENCER RD CRAY DR EXTCRAY DRW H I T E L N POOLE RD EXT JOHNSONSTEXT RI D G E V I E W R D NORTHLAND DRGLENOLAINDUSTRIALDRH U G HES FAR M RDOLDSPENCERRD OLDGLENOLARD EDGARVIEWDRBEL O RUSHDR EDWARD WALKER STJOHNSON STSOUTHLAND DRBOWMANLOOPDRRI C H A R D S O N R D INTERSTATEH WY74 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3b G3kG3j G3o G3f G3n G3d G3k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Caraway CreekArchdale (S1799)(S1813)(S1812)(S1803)(S1804)(S1805)(S1802)(S1801)(S1004)(S1800)(S1567 ) (S1806)(S1004)(S1566) (S1567 )(4400)(4579)(3878)(100)(9500)(1400)(10001)(1300) (1000)(4500)(4455)(4153) (4300) (3900)(9700)(1100)(9600)(38 4 4 ) (4095) (1200)(9800)(4674)(4600)(4100)(4700)(9900)(4500)(4000) (4200)(9200)(4600) (4700 ) OAKVIE W DR WOODLYN WAY VIRGINIA CTRIVERVIEW C T REDDING CTROYALPINESDRARCHDALE RDLEYLAND TER VILLA G E D R RIVERVIEWDRMARQUISECTPARKWAY DREMERALD CTSOLITAIREDRVIRGINIA DRSHINING WAYREDDINGCTRYRD CREE K V I E W D R KYNWOOD DR FA IR V IE W C H U R C H R D COLONY LNRADIANT PATHCOTTAGE LNKAY LYNN DRCEDAR XINGROBBIN S C T R Y R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G2d G3m G3i G3q G3n G2l G3j G3r G3m Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet CarawayCreekArchdale (S1783) (S1532) (S1780) (S3238) (S1862)(S1784)(S1782)(S1863)(S3188) (S3230)(S3231)(S1806)(S1781)(S3239)(S1861)(S1532)(S1533)(3878)(4400)(3676) (5084) (3769) (4000 )(4500)(4955)(3700) (3700) (5200) (3500)(3600) (5300)(4756)(3844) (3745)(4700)(3800)(4821)(4900)(3719)(3715) (3508)(4800)(3834)(4800)(4600)(5 3 4 7 )(3400)(4400)RIVERVIEW C T RHONDA DR OAKVIEWDRWOOD VILLAGE DR TOBACCO RD CREEKVIEWDR TAYLOR CTBEECH CIR KAY DR JILL DR ROSEWAY RDTALLWOODDRPINEVIEWDRVILLAG E D R LYNN VIEW DRLYNN OAKS DRLAURENTAYLORDR DENISE DROLD TOBACCO RD PLINEY FARLOW RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3n G3j G3r G3oG3m G3i G3s G3k G3q G3n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet (S3167)(S3169)(S 1 5 2 8 ) (S1529)(S1526)(U 3 1 1 ) (S1532) (S3168) ( S15 2 6 ) (S1533) ( 52 5 6 ) (3400) (5 2 0 0 ) (51 0 0 ) (3300) (4400 )(4800)(5 3 0 0 ) (2800)(5400)(7 6 0 0 ) (4900) (3100) ( 4 700 ) (4400)VILLADRED G A R R D OLD E D G A R R D MARCAL CIRSPARTA DRHOG SLIDE RD US H W Y 3 1 1 TOBACCO RD PLINEY FARLOW RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3o G3d G3s G3k G3n G3j G3r G3b G3o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet CarawayC reek (S1852) (S1851)(S1853)(S1408)(S1004)(S3121)(S1849)(S1850)(S1779)(S1545)(S1004)(S1778)(S1534)(8600)(3977)(4050)(8500)(3761)(8900)(4969)(4200)(9200)(4100)(4138)(9124)(4 3 0 0 ) (380 0)(9000)(3900)(4792)(8700)(4000)(3900)HILLSVILLE RDVALLEY RI D GE D R HILLCREST CTBEAUMONT DRSKYVIEW CT TAXI W A Y HILLVIEW CT ROLLINGWOOD CTHOOVERHILLRDROLLINGWOODDRMANOR PARK DRARCHDALE RDTARMAC DRVALLEYRIDGEDREXTHANG A R R U N MILLERS MILL RD ROY FARLOW RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3q F3a G2d G3r G3m F2b G3n G3q Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet C ar aw ay C reek(S3126)(S1814)(S3124)(S1533)(S1858) (S3125) (S1534)(S1535)(S1534)(S1858) (3849)(3338) (3327) (3098) (3200)(3600) (3369)(4100)(4300)(4200)(4400)(4100)(4400)(3900) (3400) (3500) (3700)(4041)(3900)(4022) ROY F A R L O W R D PARTRIDGE L N LOBLOLLY DR MEADOW LARK L N PLINEYFARLOWRD OLDM ARLB O R O R D CREEK DRPHEASANT RIDGE DRCEDAR DRGOLDEN EAGLE DRPLINEY FARLOW RDSPARKY LN HARDINS FARM RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3r F3a G3sG3q G3n F3b G3oG3m G3r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet B o b Branch (S3125)(S3271)(S 327 2 )(S1814)(S1817) (S 3105)(S3146)(S 185 8 )(S1815)(S1526)(S1818) (S1816)(S1896)(S1527)(S1526)(S1534)(S1528)(3500) (3700) (3369)(3462) (3181) (2979)(3160)(4000)(4 2 7 0 ) (3069)(4199)(4 2 4 2 ) (3300)(3478) (3060)(4100)(3100) ( 40 2 7 ) (3153)(4100)(4300)(4400)(3 5 11 )(4200)(3271) (3600) (3400) (3 1 3 7) (3338)(4500)(3237)(3327)(4400)(2998) (3098) (3079)(4276)(4497)(2646)(3100)(2818)(4700)(3200) ( 4 4 0 0 ) ROY FARL O W R D SPARKY LN OLD MARLBORO RD MEADOW LARK L N LOBLOLLY DR EUGENE ESTATE DR GATEWOODAVEQ UAI L MEADO W ESTATES R DBROOKWOOD ESTATES RDMITC HEL L ESTATESSTEDGAR RDPOINTER LNAL L RE D H EI GHT S DRDAVISESTATE S S T ROSIN RUN PHEASANT RIDGE DRQUAI LMEADOWDRCEDAR DRB R A DRDM A R LB O R O CHURC H R DPINE NEEDLE LNPARTRIDGE L N PINE NEEDLE LN EXTSILVER MAPLE RD EUGENE STWHISPERING WAY O LD E D GAR RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G3s F3b G3d G3r G3o F3a G3n G3s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet M u d d yCreek (S2006) (S2003 )(S2004)(S1940) (S2032) (S1926) (S1934)(S1944)(S1928)(S 1 9 2 6 )(S1926)(S2005) (S1929)(S2034)(S1933)(7229)(1953) (61 0 0 )(6400)(5650)(7173)(2532)(6153)(1890)(5330)(6800) (1722) (1812) (1800)(7000)(6873)(6200)(5800)(7300) (1476) (1700) (6400)(5952)(929) (1 5 5 8 )(6115)(1800)(660 0 ) (1400)(6779)(7 1 0 0 ) (7500) (6084) (2294)(1833)(6500)(6271)(6219)JOHNSON OAK DR CEDAR SQUARE RDHICKORY WOOD LN GREENDALERDPINEWOOD DRH YDEAWAYLNHEATHERDRLEWI SDAVI S RDDAVIS CTRY RD SPENCER R D KNOLL DR SPENCERLAKEDRNINACOLTRANE LN RIVERW O OD RDGREENHILLTRL BRANSONDAVISRDDAVIS FARMTRLHOHN DAVIS RDGILBERTDAVISDRSTEEDRD GREE N D ALE R DEXTFARLOWFARM R D DAVIS ACRES T R L HARLO W RD CED AR LN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G4a G4c G4bG3b H4c G4d H4dH3d G3d H4q G4a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Deep River (S 2 0 3 8 )(S1987)(S1988)(S1993) (S2012) (S1926)(S1968)(S2049)(R 73)(U 2 2 0 B U S)(I 73 )(S1939)(S1940) (S1936)(I 73)(929)(6062)(8 1 0 0 )(925)(5877)(5842)(52 6 2 )(780)(10820)(10755)(10860)(8 3 0 0 ) (700)(10700)(5837 ) (600)(1200)(5033) (613 ) (8 1 1 1 ) (5293) (522)(1001)(1000)(5924) (600)(4675)(83 4 8 )(0)(300)(6400)(6084)(6659)(10300 )(1180)(1181)(5520)(978)(7600)(1227)(1226)STEED RD HOLDER INMAN RD OLD WALKER MILL RDADAMSFARMRDRIVERWOOD RD EXTSARTIN R D GOLDENLEAFLNHANNERRDEXTST AN TO N FA RM R D US HWY 220 B US N CLASSIC DR DAVIS CTRY RDEDDAVISLNMARSHCTRYLN WOODOAK TRL I NTERSTATEHWY73HANN ER RD FRAZIER VIEW RDHOLDERINMA N R D E X THOCKETTTRL RIVERW OODRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G4bG4a G5a G4d H4d H5c G4c H4c G5c G4b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet MuddyCreek Bob Branch (S2025) (S2031)(S20 2 8) (U 3 1 1 ) (S1945 )(S1936)(S1944)(S1931)(S 1 9 4 2 ) (S1944)(S1941) (S1943) (S 2 0 6 7 ) (I 7 4 )(4316)(2540)(4700)(2408) (63 5 3 )(4815)(65 0 0 ) (2400)(4654) (66 9 8 ) (68 0 0 )(5200)(2513)(4694)(5062)(1673)(5100)(1448) (65 4 3 ) (4500 )(5500)(4900 )(5300)(4850)(5800)(1900) (1569) (55 0 0 ) (5013 ) (1400) (2114) (4 6 0 0 ) (34 1 4 ) (34 1 3 ) MARLBORO C H U R C H R D STEWART STWALLBROTHERSRDBANNER WHITEHEADRD BRANSONDAVISRDLOFLIN DAIRY RD US H W Y 3 1 1 ETTA CTALLEN DRWALKERMILLRDMARYVIOLADR NELSON PARK RDFREDFRANKTRLMARKETDRFARLOWEDAVISDR BEECHTREECT WALKER MILL RDL EI GHLNW IL L COLT RANE RD EARLJOHNSONRDG R A Y F A RM R D INTERSTATE H W Y74 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G4c F4a G4a G4dG3d F3b G4b F4g G3b G4c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Bob BranchS im m onsBranch Deep River MuddyCreek (S 1943)(S1965) (S1962 )(S1939)(S1926)(S1961)(S1936)(S1936)(I 73)(4400)(4185)(4645)(6076)(1200)(734 )(4141)(58 4 2)(5837 )(6000)(5600)(5297)(1400)(466)(4675)(398)(4198)(5518)( 52 0 0 )(5500)(6659)(1226)(1227)SMALL RDRANDLEMAN LAKE RDOLDWALKERMILLRDTIGERS DEN RDWALKERMILLRDED DAVIS LNGOLDENLEAFLNDAVISCTRYRDJ ESSE S MAL L R DBUTTK ED AIR Y LO OPEARL JOHNSO N R D ST PETERCHURCH RD WALTE R MEADO WSRDADAMSFARMRD INTERSTATE HWY 73² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G4dG4c G4b G5c F4a G4a G5a F4g F5eF4h G4d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet SimmonsB ranchPolecatCreek(S2282)(S1007)(S2114)(U 220BUS)(S2280)(S2012)(S1939)(S2114) (S2385) (S1988) (S2281) (U 2 2 0 B U S )(S2342)(S2101) (334)(5600)(475)(5767)(9000)(5500)(600) (156) (9 374)(344)(300) (413) (5589)(9037)(6100)(8800)(227)(5915)(6300)(9108)(5 4 7 5 ) (6000) (1 0300) (9 4 1 8 ) (510)(166)(5520)(522) (10100) (282)(6062)(263) (99 0 0 )(6119)(100) (617) (162)(9199)(149 )(6200)(9 6 0 0 )(5900)(6400)(100) (5657) CEDAR RUN DR US H W Y 2 2 0 B U S N TILLEY LN PROVIDENCE CHURCHRD BIG OAK WAYMAPLE RUN DRLAWRENCE SMIT H D R ADAMS RD EXTPEELER DR POPLAR BEND CT BRANSON MI LL RD ADAMS RD HOLDER INMAN RD LOWEDR ACTS TEMPLE DRRANDLEMAN RDGEORGIA DROX E NDINERDFARLEY DRWIND INGCEDARRDRED CEDAR CT T U CKERLNREGAL DR O L D G R E E N S B O R O R D CLYDE TOOMESLNOLD WALKER MILL RDWOODOAK TRL TWO PO ND DR EVANSCEDARLNCECIL VIEW LNMASON CIR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G5a H5c G4b G5b H5d G4d G5dG5c H4d G5n G5a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet L itt le PolecatCreek PolecatCre ek( S 2323) (S2230)(S2318)(S 2 1 0 6 ) (S22 9 7 )(S2322)(S2340)(S2271)(S2113)(S2114) (S2378)(S2339)(S2114) (S2241)(S2306)(S2359)(S2106)(S2349)(6 2 0 0 ) (1085) (1744)(4341)(8200) (5 5 5 5 )(7800)( 5300 )(5365)(5 8 3 3 ) (1700)(4984)(1 6 3 7 )(7828)(1000) (2100) (5778) (5420) (103 2 )(1500)(6 1 6 3 )(5158)(800)(5528)(6 100) (1400)(5813)(6085)(5616)(5715)(5209)(5 5 7 8 ) (1873) (5803 )(800 0 )(1100) (12 0 7 ) (56 6 7 ) (580 0 )(6084)(617)(6053)(5200)(1396)(6000)(5510)(5727)(5890)(5 8 8 0 ) (843)(5352)(5545)(5320)(1569) (1082)(5672)(1200)(7300)(5400) BLUE R I D G E R D BERRYLN PROVIDENCECHURCHRDRACINERD ADAMS WAYTIM B E R T R LCHAUCER TRLRAVENCT ROLLING FARM RDSAPLING WAY SUMMER T R L SUSSEX TRLRED BIRD CT BRITTANY TRL OAKRIDGELN FREDLINEBERRYRDROBINLNHEBLER LN QUAILHOLLO WDR DASHWOODDRPONDEROSA RDMEADOWLARKCTOLD P R O V I D E N C E R D HOLLYOAKDR FALCONDRBIRDSVIEWRDCREEKS IDE DREZRA DRPROVIDENCEFARMD RWOODSTREAMRDNIGHTWOODDR RED LANE RD SURRIETRLBARKER DR ROLLING M EADOWSRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G5bG5a G6a H5d G5d H6cH5c G6cG5n G5b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet SimmonsBranchDeepRiver Randleman Randleman Randleman (S 2 3 2 9 ) (S2284)(S2275)(S1964) (S231 0 ) (S2113)(S2330) (S2276) (S 2 1 1 8 ) (S2277) (S2278)(S2287)(S1969)(S2115)(S2286)(U 220BUS)(S2116) (S1962 )(S2285)(S2115)(S1963)(S1939)(S1961)(S 1 9 6 5 )(S1936)(U220BUS)(I 73)(100) (175) ( 5 11 )(400)(4185)(4400)(5100)(316)(192)(505)(4562)(517 7 )(4676)(4141)(4872)(1 7 0 ) (1 7 1 ) (60 0 ) (200) (400) (4507) (734 )(4859)(357)(4856)(278) (453)(8200)(8800)(219)(4500)(5000)(4517)(5 2 0 0 )(4600)(4800)(4585)(8300)(5600)(4581)(500) (600)(8053)(5350)(4 4 2 3 ) (2 6 8 ) (300) (298) (1 1 1)(7900)(54 7 5 )(4675)(100)(7700)(217) (398)(4900)(4656)(4 6 6)(44 0 0 ) (300)(4198)( 52 0 0 )(107)(6659)(8381)(1226)(1227)US HWY 220 BUS NN E W S A L E M R D PRICENOBLERD ARCADIA RD PINNACLE DRNEW SALEM RDOLDWALKERMILLRD B R OWN OAKSRDWELLS LNTROLLIN G E R ST OLDGREENSBORORDHUFF C T OAKWOOD TRLM ALLARDDR TEALCTSALEMRID GEDR S A L EM S T H A W T H O RNECT GREENFOREST R D LEROY SMITH DR HI LLI ARDL NLAMBSTMANDARIN CTWOOLLEN DRLAC EWOODCT EFFI E ST INGOLD DRSALEM FOREST ST OLD BELL RD S A L EM HE IGH T S A V EHIGHTOWERDR FREDLINEBERRYRD GLENNWILLIAMS DR J ESSE S MAL L R DLIBRA PL BRISTOL LN KINGS RIDGE RD TROGDON WAY TRL QUEENSWAY SUMMERSET RDSMALL RDCHERRYWOOD RDWALTE R MEADO WSRD SMOKE WOOD RDSTPETERCHURCHRDRANDL E MA NLAKERDADAMSFARMRDINTERSTATEHWY73² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G4d G5a G5c G4b F5f G5d F5e G5r F4h G5n F5bF4g G5b G5c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet P o lec atCreek B u ll RunLittlePolecatCreek Randleman (S2 1 1 1 ) (S2 1 0 6 )(S2 1 13)(S2386) (S2116) (S 2 1 36)(S2116) (S213 7) (2700) (5 1 0 0 )(5447)(4477)(1000) (5466) (2121) (1645)(1600)(4777) (5 3 6 3 )(4737)(1333)(1420)(1712)(5158)(2200) (4 6 1 1 )(1620)(1102)(5001)(54 2 0 )(4672)(5100)(5335)(4000)(4400)(1500)(1300)(5198)(4958)(5510)(1 7 9 5 )(4460)(4 9 4 5) ( 4 3 4 1 ) (4500) (1945)(4800)(2091)(120 3 )(17 0 0)(4984)(4700)(1605)(600) (1198)MAM IE M A YR D RACINERD FREDLINEBERRYRDWEDGEWOOD RDKYLESL NPL AN T A T IO N M A N O R D R RIVEROAKS CT HARVEST VIEW DRSILVERWOOD LNSYLVAN VIEW RD NEWSALEMRDACORN DRBUL L RUNCREEKRDPLAN T A TIO N C TROBINLNHAWKSVIEW RD F REDLI NEBERRYRDEXTVI CTORYJUNCTIONLNNIXONFARMRDSERENITY TRLRIVEROAKSDRCECIL NORMANRDWINDINGTREETRLADAMS WAYROLLING FARM RDB L UEHERONLN JAMES BEESON RDTROGDON CTRY TRLIRVINCTRYRDKYLE SLN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G5d F5b G6c G5b F6F5f G5a G6a G5r G5n G5d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Randleman (S2284) (S23 13)(S2275)(S 2 11 5) (S2115)(S2113)(S2276) (S2277) (S2278)(S2287)(S2286)(488 7 ) (517 7 )(4872)(200)(60 0 ) (500 ) (400) ( 5 00 )(700)(4656)(357)(4900)(5100) (5300 )(5000) (52 0 0 ) (6 0 0 )(5198)(5091)(300)(5350)(300) (298) (54 7 5 )(4900)(4800)PINTA I L C TWELLS LNDRAKE CTHUFF C T TEALCTSALEMRIDGE DR H A WTHORNECT MA L L A R D D ROLD GREENSBORO RDARCADIA R D LA C E WOOD CT EFFI E ST MANDARINC TFREDLINEBERRYRDBRISTOL LN KINGS RIDGE RD QUEENSWAYSUMMERSET RDCHERRYWOOD RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G5n G5c G5a G5d G5r G5b G5n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Polecat CreekRandleman (S 2 3 2 9 ) (S2330) (S 2 1 1 8 )(S2116)(S2115)(S2116) ( 5 11 )(316)(4400)(505)(4562)(4676)(1 7 0 ) (600)(278) (453) (219)(4500)(4517)(4585)(4581)(500) (4 4 2 3 ) (2 6 8 )(217) (500)(4656)(600) WOODSDR TROLLIN GE R S T BROWN O A K S RD OLD GREENSBORO RDOAKWOODTRLS A L EM S T N O RTHWOODSCTSALEM FOREST ST NEW SALEM R D LIBRA PL TROGDON WAY TRL ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G5r G5c G5d F5f G5n F5e F5b G5r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Little Pole ca tC reek (S2 1 0 8 ) (S2273)(S2335)(S2 3 3 8 )(S2271)(S2230)(S2274)(S2380)(S2379) (S2334) (S2355)(S2109)(S2116)(S2114)(S2112)(S2114) (5672)(5528)(5365)(6045)(30 4 3 ) (1700) (1961)(5755)(5950)(2289) (2051)(1900)(1 6 3 7) (2336) (2100) (5300 )(2 6 05) (2500)(2300)(5910)(1 930) (5100)(6084)(6000)(5727)(1800) (5900 )(5902) (26 3 0 )(1800)(58 6 2 )(5900)(5800)(2114) (6019 )(5719)(5704)(3502 )(3300)(2700)(2500)(1744) (2800)(2200)(1873) SURRIE TRL BERRY LN CHAUCERTRLCROATAN TRAIL R DEVELYN LN WA Y N E W H I T E R D BRITTANY TRL CROATAN TRL EXTFREDEASTLNCHEYENNE TRL CHARLESPL S AP LI N G WAY REDCROSSCT TI MBERTRLBETHELCHURCHRDDOTTIECOXDRWEATHERLY DRCHAUCER TRLPROVIDENCE DR PROVIDENCECHURCHRD HUNTING LODGE RDACORNDRQUAKERDR ESSEX TRLCHEROKEE TRLJOHNSTONCTNEW SALEM RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G6a H6c G6c G5b G6b H5d G5d G6d H6d G6a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet (N 22N)(S2443)(S2528)(S2513)(S2403)(S 2 1 1 2 )(S2116)(N 22N)(S2114) (S2108) (S2443) (563 9 )(3368) (4191)(3500)(7004)(8200)( 3 700 ) (30 4 3 ) (3745)(5719)(3461)(5559)(3600 )(54 00) (362 4 ) (367 6 ) (3021) (3612) (2900)(7588)(3400)(3200) (4967)(8000)(3213)(5323)(8219)(5308)(3502)(3371)(2 7 0 0 )(4992)(2775)(7300)(3 9 0 0 )(7697)(2800) (3192) (3000) (310 0 ) OLD RED C R O S S R D NEW SALE M RDJULIAN STNCHWY22NGREE S ON C T R Y R D WAYNE WHITERD RANDOLPH CHURCHRDJOHNST ON CT MOBILE CTMILTONDRCURTISS MITHCIREVERG R EEN CT LOCK HIGHLAND CT UNDERWOODRD BROWNWOOD DR FERGUSON FARMLNCYPRESS LNBEECH TREE DRBETHEL C H U R C H R D KEELY LN MONDARD PROVIDE NC ECHURCHRD HINSHAW FARMRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G6bG6a G7a G6d G7 H6c H7c G6c H6d H6t G6b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet BullRun (S2391)(S2140)(S 2 1 3 8 ) (S2283) (S 2 1 0 6 ) (S2136 ) (S2 1 0 6 )(S2116)(4900)(1645)(5100)(5 4 2 0 ) (5671)(5200)(4 6 6 7 ) (5 3 6 3 )(2 091)(5022)(4945)(4217)(4072)(4 2 0 5 ) ( 1 605 )(4640)(1600)(4400)(4324)(47 2 3)(4904)(4600)(5507) (48 5 7 ) (2 096) (2200)(5249)(51 00) (2700) (4342) (1700)(2500)MACK LINEBERRY RDHARVEST VIEW DR SYLVAN VIEW RD TIMBER TRL RACINERDACORN DR MAMIEMAYRDCRACKLING WOODS LN WINDINGTREETRLMARYROBBINSONRDDAVIDALLREDDRPLUM TREE RDHAW KSVIE WRDPEACEFORESTLNWHITAKERCTRYRDSYLVAN OAKS RDFOREST HAVEN DR N E W SALEM RDJAMES BEESONRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F6 G6c G6a G6dG5d F5b G5b G6b G6c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet BushC re e k(S2138) (S2114)(N 22N)(S2513)(N 22N)(S2445)(S2445)(S 2 4 4 6)(S2381)(6600)(4477)(5507) (3376)(3700)(5671) (2800)(5731)(3503)(4400)(3191)(3422)(3600)(3400) (4 015)(7004)(4200) (2800) (2900)(5927)( 6 300)(6700)(3022)(3660)(3680) (4019)NCHWY22 NM AC K L I NE B ERRYRDBENNY LINEBERRYRD LILLIEWOOD LNPROVIDENCECHURCHRD LINEBERRY LNKIMEFARMRDE X TMAPLEWOODLN WHITAKERCTRYRDKIMEFARMRDANDREWCTRY L NHACKETT LNO A KH IL L D R UNDE R W O O D R D J ESS HACKE TT RDCROOKED CREEK RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F6 G6d G7G6c G6b F7 G6a G7a G6d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Do dsonsLake SandyCreek (S2445 ) (S2516) (S2261)(S2525)(S252 4 ) (S2522) (R 4 2 1 )(S2441)(S2442)(S2407) (S244 3 )(S2442)( U 421)(S2440)(S2518)(S240 7 )(S2444)(S2406)(S2 4 09)(S2261) (6488) (3660)(3118)(9526) (367 6 )(5000)(9 4 16 ) (890 0 ) (9339) (6900)(4616)(41 05) (4 967)(4096)(4494) (5503)(5200)(4084)(4709)(6500)(3690)(9200)(4900)(48 2 6 ) (0 ) (4400) (5700) (110 1 ) (8970) (1 5 7 0 ) (4100) (3785)(3 600)(11 0 0 ) (4418) (6700) (5143)(4400)(4000)(3677) (4776) (5855) (461 4 )(5600)(5100)(6200)(5126)( 4 0 0 0 )(5400)(4300 ) (4903) (4600) (1200)(4057)(120 1 )(3500)(1 3 0 0 ) (1 3 0 1 ) (7044)(3979)(3600)(7000 )(4200)(5223)(7500)(4 5 0 0 )(8100) (1401) (14 0 0 ) SHILOHRD BENNY L INEBERRY RDBROW ERM EADOWRDRANDOLPHCHURCHRD OLD LIBERTY RD FOUST RDRAMSEURJULIANRDCOUNTRY RIDGE RD MEREDELL FA RMRDLORENEAVEFERGUSON FARM LN SHELTONC TR YRDEXTELNORA DRJULIANAIRP ORTRDLAMINALNDEVINEY KIRKMAN DRSAND Y C R E E K D R PHILLIPPIE LNWILL IAMS DA IRY RDBROWNSMEADOWRDGILMORE DR US H W Y 4 2 1STARMOUNTRDUSHWY42 1 HEDGEBERRYLN A N D REW CTRYLNSHE LARDR HERMANHUSBANDRDH O LLOW TREEDR PEA R LFERGUSON RDTROY SMITH RDHOLLOWHILL RDHOOTSHOLL OWRDHOLDERFARMRDCURTIS LNSHELTONCTRYRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G7 F7F6 H8 F8a H7c G7a H7d G6b G6d G8a H6d G8j G7 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet Sandy Creek (S2443) (S2407)(S2502)(S252 4 ) (S2522) (U 4 2 1 )(S2444)(S2442)(S2442)(S244 3 ) (S2407)(S2406) (4614 ) (367 6 ) (3745)(4967)(4600)(6500)(5503)(5200)(110 1 ) (4500)(5400)(110 0 ) (4100) (3785)(4200)(670 0 )(5600)(120 1 ) (12 0 0 )(5100)(4000) (430 0 ) (4903) (7000 ) (5223)HOLDER FARM RDR A N D OL P H C H U R C H R DFERGUSONFARMLN LORENEAVESHI L O H R D JULIA N A I RPORTRDLAMINA LNSAND Y C R E E K D R GILMORE DRRAMSEURJULIANRDUS H W Y 4 2 1 HEDGEBERRYLN SHELTONCTRYRDHOLLOWHILLRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G7 G7a H7c G6b H7d G6d H6t G7a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Liberty Liberty(S2415)(S 1 0 0 6 )(S2539)( S2411 )(S2410)(6 6 0 0 ) (6653) (200) (6 1 6 3 ) (6 7 0 0 )(4897)(700)(300)(5200)(5085)(5 7 0 0 ) (4776) (40 0 ) (6 0 0 0 ) (6 2 4 8 )(3900)(45 6 0 )(5021)N FOSTER STW BROOKW O O D A V E W BUTLER AVE NGREENSBOROSTOL D 4 2 1 R D COOK C O L L I E R R D E X T ISLAND OA K D R PARKS PALMER RDNASHEBOROSTCURTIS INDUSTRIAL DRW BUTLER AVE EXTCOOK COLLIER RDM C P H ERSON FARMDRPEARLFERGUS ONRDFR A N C E S D RBUNTONSWAIMRDYORK MARTIN RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H8 G7 G8a H7d G8b G8j G8c G8k G8n G8o G8a Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet NorthProngRocky R iv e r S ou th P ro n g S tin kin gQuarterCreek(KimesvilleLake)OAK TREE LN WALL FARM DR SNC49 H W YCOUNTY LINE RDLiberty (S 10 06) (S2554)(S2417)(S2419)(5313)(116)(5479)(408) (200)(4558)(5316)(7500)(7386)(9 0 0 ) (7467) (100)(5575)(5366 ) (7453) (421 )(5409)(4700)(4868)(6950) (305) (1 0 0 0 )(5448)(675)(700)(5 0 0 ) (207) (6800 )(800)(5173)(4927)(4900)(5431)(607)(600)(6653) (6800) (5700 ) (5200) (6900)(4600)(4800)(4871)(5079)LIBERTY GROVE RDW BUTLER AVE ALAMANCE LINE DREDG E WO O D D R E BUTLER AVE HUMMINGBIRDLNNGREENSBOROST NC HWY 49 NPI NE K N O LL ST CARDINAL CTOLD 421 RDLONG M E ADOW DRBRI NKL EYCTRYLN BUTLER RDREDBUD LN BARBERDR NASHEBOROSTN FAYETTEVILLE STN GREENBRIAR STBIG T R E E R D RE DBUDLNEXTLOGAN LNHAMILTONDRISLAND OAK DR COWARDPICKARDLN COX LNFARMHOUSERD S TA L E Y S DA IR Y RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H8 G8bG8a G8j G8d G8k G8n G8o G8b Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet RockyR iverLiberty Liberty (S2261)(S2441)(S2429)(R 4 2 1 ) ( S 2434 ) (S2261) (U 4 2 1 )(S2411)(U 421)(S2518)(S2407) (S2433)(3200)(407) (400) (510) (1000) (500)(8970)(800) (610)(400)(700)(3900)(900) (9751)(9 4 16 )(9339)(100)(9526)(300)(4084)(3578)(9200)(3100)(9819) (514 3 ) (4200) (6001)(4000)(6000) (3596) (0) (3309) (10000) (14 0 0 ) (1 5 7 1 ) (14 0 1 ) (1 5 7 0 ) (3 9 0 0 ) (16 2 6 ) (16 2 7 )(3600)(4400)(412)LEONARD DRASH AVE W MOFFITT AVE W BOWMAN AVE W BROWER AV E W STARMOUNT AVE W SWAN NA NOA AVE S KIRKMAN ST ALLISONSTEXT SKI RKMANSTW DAMERON AVEOLD LIBERTY RD T ROY E S T ATE RDKEETERCT S MURPHY STS NEW STS CARTER STN KIRKMAN STS ALLISON STDEVINEY KIRKMAN DRPHILLIPPIE LNHAPPYHI LLSDR STARMOUNTRD BETHANYWAYHERMANHUSBANDRD KIRKMAN ST EXT U S HW Y 4 2 1 BUNTON SW A IM RDCURTIS LN² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G7 F7 F8a G8c G8a G8j G8r G8n F8b G8s G8k G8o G8c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet North P ron g Ro cky R ive r SILKHOPELIBERTYRD STALEYSTORERDLiberty (N 49N)(N 4 9N )(S1006 ) (S2422)(S2426)(S2501) (S2424) (S2 4 2 5 )(197)(421) (353) (558)(3300)(442)(4000)(7169) (237) (538)(6833)(232)(242)(414)(201)(4 5 2 3 ) (700)(163)(361)(7348) (400) (426)(158)(41 52)(600)(200)(150)(3847)(628 ) (632 )(100)(7386)(114)(3900 ) (300)(500) (400)(6865)(7080) (530) (7126) (500) (7600)(3510)(3677)(7420)(4105)(7200)(7000)(3 3 8 7 )CARDIN AL VIE WD R DOGWOO D D R EGRAHAMAVE E HIGHFILL AVE E BROWER AVE E FRAZIER AVE E RALEIGH A V E HINSHAW CTRY RDS COOK STHAMILTONDRGRAHAMSTEXTEBROOKWOODAVE S GREEN SBORO STFOUST ACRES DRE SWANNANOA AVE S MARTIN STSILKHOPERD CANDLE W O O D D R E TEAGUE AVE E STARMOUNT AVE E DAMERON AVEBEAVE RDAM CT NC HWY 4 9 N SVALLEYSTHARDIN CT CARDINAL CT S VALLEY STN RANDOLPH STE KIME AVE E RIDGE AVE DEATON CIR HOL TSTE GRANDVIEW AVEBEAVER DAM R D E LOWE AVE S MARTIN STOLD 421 RD EPATTERSONAVE HIGHFILL ST ISAAC DR T O W N CT RY R D VIRGINIA TRLFL Y N T R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR F8b G8d G8b G8s G8k G8o F8a G8j G8r G8n G8d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Liberty (S1 0 0 6 ) (S2 4 1 0 ) (5 7 0 0 ) (200)(700)(300) (40 0 ) (45 6 0 ) OL D 4 2 1 R D W BUTLER AVE NASHEBOROSTW BUTLER AVE EXT FR A N C E S D R YO R K M A R T I N R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G8a G8j G8k G8nG8c G8b G8o G8j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet SouthProngStinkingQuarterCreek(Kimes vil le Lak e )Liberty (S2419)(S2417)(S1006)(116)(408) (200)(4927)(900)(9 0 0 ) (100)(5575)(700)(421)(4 700)(4868)(305)(1000)(675)(700)(5 0 0 ) (207)(800)(5431)(607)(600)(4600)( 5700 ) (6800) W BUTLER AVE ED G E WO O D D R E B U T LER A V EO AK D ALEAV EBUTLERRDNGREENSBOROSTPINEK N OLL STOLD421RD BRI NKL EY CTRYLN BARBER DR NASHEBOROSTN FAYETTEVILLE STN GREENBRIAR STLOGAN LNHAMILTON DRLIBERTYGROVERDCOWARDPICKARDLN ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G8b G8kG8j G8o G8a G8dG8n G8k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Liberty (S2261) (S2407)(S2411)(118) (124) (603) (600)(700)(631)(616)(322) (224) (228) (800) (610) (310) (700) (230)(200) (232) (300)(330)(204)(606)(600)(510) (440) (10000)(108)(500)(300)(206)(400)(200) (500)(300)(400)(100)(4400) (407) (400) (4200)(3900)W STARMOUNT AVE W BROOKWOOD AVE W BOWMAN AVE SSMITHSTN SMITH STS CAROLINA STS FAIRVIEW STSFOSTERSTW S W A NNANOA AVE W BROWERAVE FRA N C E S D R N FOSTER STN ASHEBORO STS MURPHY STS CARTER STPICKET TCIRN ASHEBORO STS NEW STW LUTHER AVE W MOFFITT AVE LIBERTYPLZS K IRKMAN STN STALEY STN REECE STKEETER CTOLD LIBERTY R D N FOSTER STW RALEIGH AVE W VANCE AVE N KIRKMAN STN REECE STSTARMOUNTRD ASH AVE W MOFFITT AVE BUNTONS W AI M RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G8n G8c G8j G8r G8o G8s G8kG8a G8n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Liberty (N 49N) (N 49N) (S2422)(201)(638)(228) (632) (21 0 )(197)(118) (134) (122) (421)(186)(594)(700)(121) (6 00 )(501)(558) (124)(200) (130) (118) (152) (7100) (139)(442)(110) (116)(4000)(206)(6833)(614)(163)(361) (22 2 ) (200)(100)(220)(426)(158)(4152)(600)(111)(600)(150)(15 0 ) (7126) (500)(400)(100)(114)(300) (400)(6865)(7080) (10 0 )(324)(400)(500)(200)SCOOKSTPINE VALLEY CTN GREENSBORO STW BROWER AVE E GRAHAMAVESGR EENSBOROST E RALEIGH AVE W SWANNANOA A V E W STARMOUNT AV E SASHEBOROSTS CAROLINA STE HIGHFILL AVE W RALEIGH AVE S FAYETTEVILLE STN FAYETTEVILLE STE BROWER AVEN GREENBRIAR STFOREST DRNASHEBOROSTW VANCE AVE HAMILT ONDR FOREST DRW BOWMAN AVE W NEWBERRY AVE S VALLEY STGRAHAM ST EXTCENTER STEBROOKWOODAVE E BROWER AVE MARKET AVE DOGWO O D D R FOUST ACRES DRBEAV ER D AM CT N FAYE T T EV I L LE ST NC HWY 49 N HARDIN C TE SWANNANOA AVE N RANDOLPH STW HIGHFILL AVE W LUTHER AVE E LUTHER AVE N FAUST STE MOFFITT AVE N M YR T L E S T W MOFFITT AVE E NEWBERRY AVE W BROOKWOOD AVE HOL T ST B EAVE R DAM RD REITZEL STCANDLE W O O D D R N DEPOT STS GREGG STN ASHEBORO STS MARTIN STE STARMOUNT AVE HIGHFILL ST E HIGHFILL AVE N TIMBERLEA ST² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G8o G8d G8s G8k G8n G8j G8r G8b G8o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet RockyRiver Liberty Liberty (S2429) (S2261) ( S 243 4 )(S2433)(6503) (1000) (510 )(234) (800)(400)(700)(100)(900)(6000)(300)(200)(10000) (400)(300)(3309 ) (235)(412)CRUTCHFIELD CTRYRD W SIZEMORE AVE S KIRKMAN ST ALL ISONSTEXTW PATTERSON AVES FOSTER STS MURPHY STS CARTER STS NEW STKIRKMAN ST EXT W KIME AVE S ALLISON STW BROWER AVE S FAIRVIEW STS CAROLINA STOLD LIBERTY RD W DAMERON AVE TROY ESTATE RD SIZEMOREAVEEXT ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G8r F8a G8c G8s G8n F8b G8o G8r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Ut near LibertyLiberty (S2426)(S2424)(N 49N)( S1006 )(S2426)(N 49N)(150)(234)(197)(235)(186)(6503) (353)(900)(3300)(530) (218) (6 0 0 ) (110) (7169)(400)(538)(423)(5824)(422)(232)(242)(121) (414)(201)(300)(700) (361)(200)(600)(237)(800)(400) (700 ) (732 ) (500) (7200) (200) (100)(500)(3847)(300) (628 ) (400) (632 ) (7200) (2 1 0 ) (3900 )(200)(100) (300) (530) (500)(3510)(3677)(604)E R A L E I G H A V ES GREGG STS GREENSBORO STS FAYETTEVILLE STSCOOKSTSIZEMORE AVE EXT CRUTCHFIELDCTRYRD E BROWER AVE E FRAZIER AVE S GARDEN STHINSHAW CTRY RDS ASHEBORO STWBROWERAVE EBROWER AVE S MARTIN STSILK HOPE RD EDAMERONAVE W SIZEMORE AVE NC HWY 49 NS VALLEY STS MARTIN STS VALLEY STPINE VALLEY CTE KIME AVE E RIDGE AVE E KIME AVE E TEAGUE AVE E LOWE AVE E GRANDVIEW AVE DEATON CIR E HIGH AVE W FRAZIER AVE W DAMERON AVE S VALLEY ST W PATTERSON AVE W KIME AVE W LEWIS AVE ISAAC DR MAPLEWOODCIR OLD 421 RD EPATTERSON AVES CAROLINA ST² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR G8s F8b G8d G8r G8o F8a G8n G8s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet LANSDOWNE STBLAKE AV W EST M ARKETCENTERDRALBERTSON RD CORNELL DR WOODBINE STOAKLAWN STVANDEVERSTCORNELL DRWENGLISHRD OLDTHOMASVILLERDMANDUSTRY STEASTVIEWPL WESTVIEW P L M CKINLEYPL CORNELL DRBERKLEY STNORTHVIEW STMALTA PL MERIDIAN AV PRINCETON AV VILLA A VOLDSOUTHCT BALSAM AVSOUTH RDGRICLAR STLAMBETH AV WESTVIEWPLWINGOST GRICLAR STSOUTHWEST STBEDDINGTONSTHigh Point HighPoint High Point High Point(O8888)(S1627)(S1668)(S 1 6 2 1 )(S1625)(S1632)(S1624) (S3261)(1300)(1136)(0)(1608)(1111)(1076)(1087)(690)(3 604)(1017)(1771) (17 0 1 )(1705)(3500)(986)(17 1 4 )(1200)(410)(3628) (3600)(1700)(1211)(201)(1216)(226)(3700)OLD THOMASVILLE RDOLDTHOMASVILLERDPROSPECT STBELMAR STSOUTHWEST STB E TH E L D R MISSIONARY CHURCH DR EASTWARD AVE EXT TO W E R A V E CECIL STBERKLEY STBOLES AVE EASTWARD A V E BEVERLY HILLS DRSOUTH RDDIXIE PLBOLIVAR AV E PINEVIEW A V E ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H1k H1l H1oH1n H1p H1k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet W ES TM A RKE TCE N TERD RSTARR DR W GREEN DRFOUST AV TRINITY AVWOODBINE STALBERTSON R D PROSPECTSTBLAKE AV BLANDWOOD DRSTRATTON ST W F A I R F I E L D R D DUNMOR E C TORIENTAVBETHEL DRMENDEN H A L L R D AMHURST AV DUBLIN AVHOLLY STVANBURENST US 29 NUS 29 SEX I T GR E E N US 2 9 S ROWAN AV SADLER CT BENNETT PLDANMAR AV BETHEL DRENTRANCEGREENUSHWY29SE X IT F A I R FI E LD U S HW Y 2 9 N MENDENHALL RDLANE AV U SH W Y29SPROGRESS AV U SH W Y29SBETHAL DR High Point High Point Archdale(S1621)(S1619)(R 29)(S1616)(S1615)(U 29) (17 1 4 )(1803)(1800)(6400)(1206)(1808)(5700)(1705)(1223)(6300)(1143)(1600) (0)(6419)(1608)(1700)(17 0 1 ) (1206)(1585)(6100)(1569)(1235)(1222)PR O S P E C T S TBELMAR STOLDMENDENHALLRDBETHEL D R US HWY 2 9 MENDENHALL PL TO W E R A V E BOWEN DR BLAZING STAR DR GABLE ST ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H1l H2iH1k H1pH1o H2m H1l Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet US HWY 29 NWASHBOARDRD NATIONALHWYW TRIAD BLVD DONVI CDRNATIONAL HWYUS HWY 29 S N ALBERTSON RDALBERTSON RDBALL PARK RD LAKE DR EABBEY CTKENREEDDR SOUTH RD LAKE DR E N FORREST DR LINDA STNATIONALHWYLOWERY DR H A S T Y S C H O O L R D TATEDRKATHLANDAV EBLAIR STBURL K E N N E D Y R D TEENIA ST LAKEVIEWDREPLEASANT GROVE CHURCH RD BASSETT DR PLEASANT DR LAKE DR WE TRI AD B LVD OLD DOMINION WA Y (S1625)(S1627)(5400)(1001) (5716)(201)(6989)(5404)O LDTH O MASVILLERDBETHEL DR EXT US HWY 29 CLAYTON ST PROSPECT CHURCH RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H1n H1r H1o H1s H1k H1n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet SOUTH R D High Point Trinity (S1632)(S1621) (S1624)(S1627)(R 29) (S1610)(S1626)(S2056)(S1628)(S1625)(S1664) (U 29)(S1619)(S1665)(R29)(S1631)(S1685)(S1619)(S1627)(S1663) (U 29)(1451)(1206)(5578)(1400)(1200)(1455)(5587)(2006)(1211)(6900) (6800)(1705)(5841)(6302)(1980) (3900) (0)(5862)(2000) (1840) (6515) (1966) (6821)(6200)(1412)(177 1 ) (7000)(5800)(1000) (3700) (2012)(1500)(6900) (6500)(5500)(3742)(5638)(1300)(201)(5400 ) (6911) (5716) (7000) (3805)(1001)(6000)(5600)(0)(5800)(6989)(5700)(1069)(5616)(5404)(1024)(6600)(1143)(1138)DIXIE PLPROSPECT STBETHEL DR OLDTHOMASVILLERDUS HWY 2 9 ALBERTSON RDCECIL STBEVERLY HILLS DRAU C T IO N R D BOLIVAR AV E BETHELPARKDR PROSPECT CHURCH RD THOMPSON RD ART I S A N A V E CHARITY CHURCH LN MENDENHALLRD BETHEL DR EXT TALLW OODESTATESDRTIACT CLAYTON ST DOGW O O D B L O S S O M C T MIDDLEPOINTRDOAKMONT VIEW RDP R O SPECTCTALBERTSONRDEXT STARFLOWER DR ZELMA BLVD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H1o H1s H1k H1pH1n H1l H1tH1r H1o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet UwharrieRiver Trinity Archdale (S1679) (R 29)(U 29) (S1616)(S1610)(S 1 6 1 0 ) (S1618)(S1617)(S1616)(S1620)(1138) (6200)(6233)(1206)(0)(1143)(6574)(6000) (6 8 0 0 ) (6396) (7 0 0 0) (65 0 0 )(5600)(5700)(6515)PROSPECT STUS HWY 2 9 SUNSETVIEWDREXTOLDMENDENHALLRD MEN D E N H A L L R D SUNSET VIEW DR THOMPSONRDEXT MIDDLE POINT RD CEDAR POST STTHOMPSON RD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H1p H1l H1t H1o H2m H2i H1s H1k H2q H1p Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet H unts For k U N I T Y S T LAKEDRE LAKE DR E LANFORD DR EAST ST SWANEE LNDUN CAN DR RE D O A K C T FALLINGCREEKD RPRESTONCT B LA IR STLOWERY DRPENNY RDMAIDENPARKDRLINDAST RI D G EW A Y D R MEADOWWOOD DRLAKEVIEW DR EPENNY CIRPINE RIDGE CT HILLTOP RDVINE STBELL DR LEAF RIDGE CT TE R R Y D R GARDEN ST MAIDEN PARK DR MEADOWLARKLNALBERTSON RDABBEY CTOAK RIDGE DRMEADOWWOODCTMATTHEWCTCRESTVIEW DRRIDGEWAY RDHAMILTO N C TVINE STBOBO DRBRANDYWINE DR CEDAR BRANCH DRPATRICIA DR CRESTVIEWTERCONRAD STSWAIM D R S AM S D R BROWNING DRCLOVER LNVIVIAN STMEADOW RIDGE DR OAK MEADOW LNKATHLAND AVE PI N EFIEL DPLTrinity Thomasville (S1558)(8123)TURNPIKE R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H1r G1f H1s H1n G1g H1o H1r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet HuntsFork Trinity Thomasville (S1560)(S1558)(S1619)(S163 1 ) (S3149)(S1558) (4863 ) (7300)(5027)(5029)(7500)(5060)(8123) (6600)(5383)(7600)(5500)(5000)(6 9 0 0 ) (7700)(5200)(5187)(8000)(7791)(5100)(5072)TURNP IKE CTTURNPIKE RDWILSON VIEW DRCROTTSDRFIRST HEIGHTS DR SECOND HEIGHTS DRJENNIFER CTPROSPECT STPROSPECTCH URCH RD BLAIRFARM RD JENNIFER CT JESSICADR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H1s H1tH1r G1g H1o G1f H1n H1p G1h H1s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Uw harrieRiver Trinity (S1560)(S1827)(S1561)(S1829)(S3150)(S1828) (S3149)(S3194)(S1 5 5 8 ) (S1610) (6600)(5060)(5029)(5100)(5200)(5000)(5327)(6574)(5318)(6200) (7300) (6100)(5200)(5100)(70 2 1 )(5082)(6300) FIRST HEIGHTS DR BROOK CIRANNEST MEYERS STCROTTSDRREDDICK STHUNTS KNOLL LNMENDE N H A L L R D SHERRIE DR BROOK ST TURNPIKERD JENNIFER CT FARLOW STELLEN AVE² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H1tH1s H1p H2q G1hG1g G2e H1o H2m H1t Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet MuddyCr eekDUNMORE CT SURRETT DRUS 29 SUS 29 NTRINITYAV WFAIRFIELDRD FRALEY RD MENDEN H A L L R D LANE AV DIGBY CTS E LM ST TIMBERSTEXIT GREEN U S 2 9 S UWHARRIE RDENTRANCEFAIRFIELDUSHWY29NPORTER STINLET AV FINCH AV SHORESTEXITSURRE TT USHWY 2 9 N SURRETT CTHENDERSONSTLOGAN STBREVARD RDSILVER CT BEDFORD STFOUST AV BREVARD RDHigh Point High Point Archdale Archdale (0) (6145)(2718)(1204) (1300)(2714)(2221)(2202)(1206)(2219)MENDENHALL PL UWHARRIE RDCORPORATIONDR SURRETT DRGAITHERCTBOWEN DR SHORE ST² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2iH1l H2j H2mH1p H2n H2i Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet CORK TREE LN ARCHDALE RDTYSON STS M A I N S TBREVARD RDEMERSON STBELLEMEADE STCOPELAND AV HOLLEMAN STFRALEYRD E FAIRFIELD RDCRAI G PT TYSONCT SCHIRRA PLKETTERING RD PLAZALNW FAI RFI ELD RD VISTA CIPLAZA CTDANE STROBBINS ST FRANCIS STEARLHAMPLF UL TONPLFELD AV SWATHMORE AV Archdale (3100)(520)(3200)(1005)(400)(600) (300)(500)(3100)BELVA CTDEAN DRGARRELL STKAYE STLAWRENCE DRCALLAHAN STPLAYGROUND RDCORINA CIR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2jH2i H2k H2n H2oH2m H2j Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet NANCE AV GATE ST LIBERTY R D CORKTREE LN BAKERRDMIRIAM AV GR E EN O A K D R FIRST TEE DR ARCHDALE RD GAINES AVGRANVILLE STGILES STHERMAN CTHOPEWELL STE FAIRFIELD RD LAFAYETTEPLTHOMASSTBACO NCT S M A I N S T SWATHMORE AV ERNEST STPAUL STJOINES ST ARTHUR AV BELMONT DR RANCH D R GREENOAKDRN HALL STNIP STTUCK STARCHDALE RDJANICE DRS HALL STJOINER STJANICE DRCRAIGPT WEAVER AVE RALPH DRALPHA STE SWATHMORE AV GAINES AV DI LL ST MARYLANDPL WADSWORTH CT GARNER PL GENE STSPRING BROOK CIKNIGHTDALE AV BRENTWOODSTCHAMBERSSTNORTON ST JOINER STPEGRAM AV JANICEDRGRAYLYN DR Archdale (S 1 0 0 9 )(N 62) (100 )(413) (3200)(100)(3008 ) (102) (3100 )(104)(316)(431) (300)(200) (1 1 6 0 0 ) (300)(209) BR OOKWOO D C IR PETTY STN M A I N S T BAKERRDHAYWORTH STCHESAPEAKELN PLAYGROUND RD DORSETT S T STRATFORD RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2kH2j H2oH2n H2p H2k Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Muddy Creek High Point Trinity Trinity Archdale (S1595)(S3242)(S3241) (S1679) (S1737)(S1612)(S1683)(5800)(2219)(2605)(216) (2221 ) (1204) (5774) ( 1 0 2 ) (333) (400)(200)(300)(5600)(6000)(5861)(2718)(1200)(2402)(2600)(200) (5843) (6000) (500)(203)(5800)(2310)(101)(5721)(6000) (1000) (501) (100)(2609)(2500)(306)(1100) (5700)(5545)(5734)(2400)(2800)(300)SURRETT DRCARDINAL PLKIRK MANCTKINGSFIELDFO REST DRSHORE STNAOLA CTSEALYDR KINGSFIELD CTPARKER ST Z A CHAR Y K E N T D RDANIELPAULDRCIRCLE DREVELYN VIEW DRUWHARRIE RDCORPORATION DR LAND DALE DRCIRCLE DR EX T ARCHDALE BLVD DYLANSCO T T DRGREEN ACRES DRSUNSET VIEW DR EDEN TER JOAN DR OAK KNOLL DRMURRAY CIRCARDINALPL² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2m H2i H2q H2nH1p H1l H2j H1t H2r H2m Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Muddy C r e e k Trinity Archdale Archdale (N 62)(S1597)(S1683)(N 62)(417)(3115)(7600)(5500)(3100)(800)(700)(116)(3100)(600)(717) (5810) (20 1 )(300)(1005)(3200)(102)(3300)(3200)(721)(600)(598)(800)(110)(3202)(3400)(704) (1000) (320 ) (710) (109)(5734)(309)(900) (718) (5400) (9 8 )(412)(700) (400) (400)(407)(350 3 )(100)(500) (101) (601)(1)(107)(300)(1 0 7 )(200)(301)(306) (500)(607)(216) (100)TRINDALE RDSEA L Y D R GARRELLSTNC HWY 62ROCKFOR D D RCORINA CIRPLYMOUTH STCORINA CIRBELVA CTPLAYGROUND RDDEAN DRWEST BROOK CTCALLAHANSTLAWRENCE DRTERRACE TRACE CTEDEN TER ARCHDALE BLVD LAKE DRROSEMARY ST LYNN DRCLOVERDALE DRMEREDITHDRVERTA AVE WYNNEWOOD D R WALNUT GROVE R D HAVENWOOD DR OAK KNOLL DRJERNIGAN PLCLOVERDALE CT ROCKFOR D D R E X T KAYE ST ENG L I S H F A R M R D ELLIOTT ST OFFICEPKW YQUAKERWOOD D R OLDENGLISHFARMRD² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2n H2j H2r H2oH2m H2i H2s H2k H2q H2n Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Mu d d y C r e e k Archdale(N 6 2 )(N 62) (S 1 0 0 9) (S1009) (500) (1 1 8 ) (500) (504) (3600 ) (10600)(431) (1 1 0 0 0 ) (1100)(1700)(1 1 4 0 0 )(406) (200)(230)(1502) (400)(413)(210) (400)(408) (138) (800)(4020)(400)(1 1 3 0 0 )(1300)(308) (3200) (120)(3708)(3502)(3500)(10700)(316)(114)(900) (302) (11 1 0 0 ) (2 2 4 )(32 0 ) (3700)(300)(4097)(236)( 4000 ) (300)(309)(4100 ) (60 0) (3300 )(3701)(3 9 0 0 ) (410) (140)(102)(700)(212) (3500 ) (13 3 ) (306) (3904) (1 1 5 0 0 ) (3 718 ) (11 2 00 ) (1 0 9 0 0 ) (3 0 0 ) (3405 ) (100 )(10 8 0 0 ) ( 42 0 0 )(3600)(203) (10400) (10500) (400) (2 01)(3400)(200) ( 3 8 0 0 ) (4 3 0 0 )(106)(500) (113) (117) (1 0 0 )(200)(106) (132) (108)(100)(100) LYNBROOK DR FRAZIER ST P LU M M ER D R N M A I N S TBAKER RDDAVIDSON ST ENGLEWOOD DR CHE S A P E A K E L N A RCH DA L E R D GOODMANST LIBERTY R D HUDSON STESSEX SQ BRITTANYWAYJULIAN AVE LAURA AVETRINDALE R D CHELSEASQ H AVENWOODDR MISTY LNPURVIS LNW W H ITE D R BARRETT DRROCKLANEDRTRUMAN AVEGREENOAKDRWESTBROOKCTCOLONIAL ST HAYWORTH STKERSEY DR NORTHVIEW PLWYNNEWOOD D R HARRIET ST HATTIE S T SALISBURY STBEARD AVE HAZEL AVEDAV ID S T SPRINGFIELDST LUCK DRSYLVIA STCRAIG DRLIBERTYPL HILLCR E ST LN EDEN TER CARROLL STMA P LE GROVECT MITCHELL STSPR ING STBONNIE P L STRATFORD R D B ROOKW O ODCIRSHA MROCKCTSUNNY LNPETTY STFREEMAN PL FOUNTAIN STCOLUMBUS AVEDALE ST OL DE NGL I SHF ARMRDWEDGEWOOD ST E WHITE DR NORTHEAST DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2o H2s H2k H2pH2n H2j H2tH2r H2o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet I-85 NALDRIDGE RDI-85 SArchdale (S1912 ) (S10 0 9 )(R 85)(I 85)(I 85)(1000 1 ) (132)(2001)(227) (102) (315) (200)(200)(3500)(410)(702)(450 0 ) (901) (701) (300 )(3502)(100 0 0 ) (500) (440 0 )(200)(430 5 ) (700) (102 0 0 ) (1040 0 )(4001)(801) (400) (504) (100 2)(100)(100 4 6 ) ( 2 1 4 ) (814)(3400)(116)(400) (103 0 0 ) (101) (301)(3500)(3505)(200)(626)(3600)(3409)(114)(530 ) ( 1 4 5 ) (403)(301)( 1 3 8 ) (900)(100)(800)(600)( 2 0 1 )(152)(305)(300)(101 0 0 ) (401)(106)(4100)(1 01)(429)(500)(401)(100)(113)(198)(4000)(0)(1144)(1143)(100)(1001)(1000)DELLWOOD STB URGEMEREST DAVIDSON ST JULI AN AVE ALDRIDGERDS MA I N S T WEDGEWOOD ST JEFFERSON CTAS HL A NDS T CHESAPEAKELN ENGLEWOODDR STERLINGRIDGE DRARMSTRONG CTHAZEL AVE GLENDALE DRLYNBROOK DR OAKMONT CIRKNOLLWOOD DRALDRIDGE LN WALL ST DELTA CTROCKLANE DRN M A I N S T RANDBLVD TARHEEL DRLUNAR DR RIVERMEADE DRBROOKHOLLOWLN BALFOURDRHUFF RD CRESCENT DRSMITH LN MARSHALL STAPOLLO CIR FORESTWOOD DR COLUMBUS AVEOAKSPRING LNEASTWIND DRLONITA ST BAINBRIDGE ST PINECREST DR INTERSTATE HWY 85² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2p H2t H2o H3m H2s H2k H3q H2p Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet UwharrieRiver Trinity (S1737) (S3114) (S1610) (S 1 612) (S1610) (S1599)(S1595)(S1595)(S1611)(S1748)(6000)(6011)(5499)(5400)(5200)(5545)(5507)(5600)(5830)(5600)(6038) (6100) (5 5 00)(5417)(6005)(5400)(5900) (5700)(4924)(5800)(5192)(5500)SURRETT DRMENDENHALL RDUWHAR R I E RD JOAN DR BROOK CIR LOIS LN EVELYN VIEW DRDANIELS CIR JOAN DR ANNEST COUNTRYDREAMLNKELLO RD MENDENHALL R D E X T HOWAR D C I R SISTERSLNTRINITYHIGHSCHOOLDR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2qH1t H2r G2e H2m G2f H1p H2n G1h H2q Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Mu d d y C r e e k Trinity ArchdaleArchdale Archdale (S1859) (S1599)(S160 0 )(S1643)(S18 8 1)(N 62)(S1640) (S 1 5 6 4 ) (S1748) (S1603)(N 62)(I 85)(S1597)(S 1 0 0 4 ) (5 5 0 0 ) (5716) (5700) (5374)(5353)(7600)(300)(5253)(6900)(5400)(5100)(100)(6600)(7500)(7100)(5300)(5400)(5 242)(5300) (5800) (5600) (5810)(5229)(6800)(7000)(5409)(6 1 0 0 )(5383)(5200)(5389)(7200)(1401)(1400)(5500)(1 2 8 0 0 ) SE A L Y D RTRINDALE RDLIBBY RDNCHWY62RO B I N W A Y CARRINGTON CTMENDENHALLRDEXT BRAXTON CRAVEN RD SCHOOL R D RIDGE DR T R I N I T Y R D LEACH STBRIANNA PL OLDENGLISHFARMRDTRINIT Y C OLLEGERDBLUEBERRY CTYOUNTS VIEW DR K IMBERLYLNCOLLETTE STROCKFO R D D R RAMPEY STOLDMEADOWB R OO KR D ROSEDALE STHAYWOOD RDME A DOW B R OO K D R EWINGS STYOUNTS STSILER STTRINITY H I G H S C H O O L D R INTERST ATE H WY 8 5ROCKFORDDR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2r G2f H2sH2q H2n G2gG2e H2oH2m H2r Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Muddy Creek Trinity Archdale (S1603) (S1 0 0 4 ) (S1859)(S1607)(I8 5)(S1860)(4751 ) (30 0 ) (470 0 ) (300) (4 3 3 6 )(221)(300) (21 6 ) (4326) (201 ) (1 2 3 0 0 )(200)(200) (43 0 0 ) (10 1) (12209) (5100)(5258)(4 5 5 1 ) (403 ) (12 5 0 0 )(111)(300)(5330)(5000)(4205)(4 5 0 0 )(5341)(202)(500) (12 4 0 0 )(600)(1400) (205) (400)(10)(0)(12 7 0 0 )(1401) (120 4 2)(5300)(100)( 4 4 0 0 )(105)(4097)(5400)(100) (4 6 0 2 )(200)(100)(1 2 2 5 )(1244)DARRRDALFOR D S T BRAXTON C R A V E N R D CHEYENNE D R A R C H D A LE R D TR I N I T Y R D W ESTO N W O O DS CIR MAYNARD DR BALFOUR D R R O E LE E S TBEARDAVESCHOOLRD NO R M A N A V E TRINDALE SCHOOL DRCRAIG DRDON AVE BRANIFFPL LIBBYRD QUAKERLAKE DR BROOKBANKCTCOTTONRDBOULDIN CTBARRETT DRBARWOOD TER RAY AVEFRONTIER STOLD SCHOOL RDIN T E R S T A T E H W Y 8 5 GREY OAKS RDELAINE STOLD SCHOOL RDOLDENGLISHFARMRDTRIND ALESCH OOLDR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2s H2tH2r G2g H2o G2f H2n H2p G2h H2s Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Muddy Creek Archdale(I85)(S10 0 9 )(R 85)(I 85)(101)(100)(4 6 91 )(301)(118)(1001)(430 5 )(500)(114)(101 0 0 )(108)(300)(4089)(202)(402)(1003) (4600)(103)(100) (10 1 0 6 ) (700) (100 0 1 ) (300) (4700 ) (801)(901) ( 4 6 02 ) (450 0 )(301)(4300) (603)(500)(3900)(400) (4100) (10 2 0 0 ) (4200) (4800 )(3700)(100)(468)(3800)(4300) (440 0 ) (200)(100)(1143)(101 0 2 )(1 2 4 4 )(100)(200)(0)(3901)(1144)(4690)(109)(1225)(102)S MA I N S T BILLY AVEJACKIE AVEDELLWOOD STARCHDALE RDBLAIR DRB A LF O U R D R SPRINGWOOD LNBUR G E M E R E S T ROBIN CTROBIN CIRLAKESIDE DRRAND BLVDTARHEELDRROELEE ST ALDRIDGERDC A R O L IN A C T WOOD AVE SEMINOLEDRRENOLA DRAZTEC DRNAVAJO DRROBIN LN TRIN D AL ESCHOOLDRKNOLLWOOD DR DON AVE PAWNEE CTRIVERMEADE DR COMANCHERDINTERSTATE DRAPACHE R D CHEYENNE DRBROOKHOLLOWLNINTERSTATEHWY85 KINVIEW DRROBY DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H2tH2s H2p H3q G2hG2g G3e H2o H3m H2t Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Muddy Creek TaylorBranchBUXENBURY DRBEANE RDGR O VE F O RE ST DR GILBRETHL NWEANT RDSTAFFORDSHIRE DR H A RL OWD R PENMAN RDU S 3 1 1 N U S 3 1 1 S Archdale Archdale Archdale Archdale Archdale Archdale (O9999)(S1916)(S 2 0 0 0 ) ( S1997 ) (O9 9 9 9 )(S1570)(S2001)(S1998) (S1 0 0 9 )(S1999) (S2053)(S1995)(S1996)(S1916)(S1915)(S1920)(S2064)(S2026)(S2014)(S1917 )(S1917)(I 74) (7 1 4 6 ) (4429)(7094)(407)(6300)(7 0 0 0 ) (9 9 3 3 )(202)(7300 ) (3844) (1501)(4 00)(301) (207) (71 1 0 )(5600)(1 0 4 4 3 ) (3871)(6800)(3365)(5745) (3245)(5783) ( 6 7 8 9) (7203)(35 6 1)(1401)(201)(300)(7105)(200)(4500) (37 00)( 6 900) (3100) (640 0)(660 0 )(1 2 0 1 ) (98 0 0 )(602)(6907)(101) (69 0 0 )(7200)(5832)(3296) (3700) (3739) (696 2 ) (546 1 )(101)(6317)(100)(6110)(5819) (2781) (4326) (3363 )(2900)(501)(300)(6090)(5800)(5867)( 6 8 0 0 )(5968)(4600) (6000)(2700)(3084)(6400)(6600)(6106)(100)(6079) (3300)(6100)( 6 9 3 6 )(6200)(6320)(1001)(1000)OAKLEY CT COUNTRYLNWE A NT RDALISON LN HUFFRD MELI S S A C T WILLOW TER EDGEWOOD CTM A E M A T I L D A C T BELGIAN DRHANNER CTALLEN D A LE D R TROTTER CTRY RDPOWELL WAYB U R R WOODDRUS H W Y 311 GAL LOP WA YWATERSEDGEDRS M A I N S T BRADFORD LN MAGNOLIALN TREY LN PRESTONCT WOOD A V E SHARO N D A LE DR SUITSRDTOM HILL RDELK HORNCT TUTTLERDRIDGELNDG DEERFIELD PLSAGEWOODLNOAKRIDGEDR MADDYLN E B B S H O R E D R NEEN E ELNPARKV IEW CT CL Y D E S D A L E D R SANFORD CT DOGWOO D LN ROBERTS RANCH LNAUTUMNHILLCT OAKWAY AMBERWAY RAYMONDGRAYLN CHADWICK D R POOLE RDASHBROOKCIRLINDSAYDR KINLEY TRL ERICA DRHAZELWOOD LNM OSEDRWILLIAMLEEPLPARKDRHILLTOP DRPINEBROOK DRINTERSTATE HWY 74INTERSTATEHWY74² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H3d H3c G3bG3fG3e H3q H3oH3m H2t H2p G2h H3c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet TaylorBranch Mud d y C r e e kBEANE RDGR O VE F O R E ST DR GILBRETHL NH A RL OWD R GROOMETOWN RDFRAZIERMARSHRD(O9999)(S 2 0 0 0 ) ( S1997 ) (S1998)(S1999) (S1925) (S1976) (S2030) (S1978) (S 1 9 2 6 )(S1927)(S2064)(S1926)(S1923)(S1920)(I 74)(S1922)(7 1 4 6 )(7094)(5973)(2216) (3296) (7 0 0 0 ) (7300 )(7105) (3100) (640 0)(8 981)(6907)(6400)(7200) (2646) (8900 ) (1981) (8500) (2211)(2724)(6200)(6800)(6300)(2900)(8100)(6100)(2900) (2613) (2781)(6558)(2600)(2300)(78 2 5) (3084)(8300)(6200)(2700)(6151)(6586)(6900)(91 0 0 ) (8600)(6500)(1000)(2700)(1001)(6400)MADDY LN MUDDYCREEKRDCOLTRANE MILL RD TUTTLE RDB U R R WOODDRHOWARD RUSSELL RD EB B S HO R E D R NEEN E ELNHARLOWRDROBERTS RANCH LNHYDEAWA YLN EBENEZER CHURCH RD MCNEILLRDROBCRUTHISRDCANTER RDBRANSONMEADOWSRDJACK WALL LNW AL DENLNKINLEY TRL HOHNRDWILLIAMLEEPL RAYMO N DGRAY LN REDROBINLNFRAZIERMARSHRDINTERSTATE HWY 74INTERSTATE HWY 74 ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H3dH3c G3b H4c G4aG3f H4q H3o H3d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet WATERBURYDR BUXENBURY DRWATERBURY DR STAFFORDSHIRE DR I-85 SI-85 NCHANTERELLE DRWEANT RDArchdale Archdale Archdale Archdale(I 85)(O9999)(S2001)(S1912 ) (S20 0 2 )(S1916)(S1995)(S1996) (S1915 )(S2014)(S1916)(7037)(1000)(4429) (400) (406) (407)(6650) (403)(6700)(4000) (4300)(1001)(207) (7110)(200) (1202 ) (1501) (6800)(1101)(6 7 8 9)(300)(201)(7203 ) (2001)(400)(300) (4500)(1102)(1 3 0 1 )(6600) (2101)(429)(101) ( 6 900 ) (1401) (530 ) (3700)(1001)(1 2 0 1 ) (4100) (3739) (69 6 2 )(6317)(100)(6110)(300)(4326) (200)(5867)(4200)(4600) (100)(100)(6400)(6100)(6 3 2 0 ) WEAN T R DINTERSTATE HWY 85HUFF RD STERLINGRIDGE D RSIMMONS CREEK CTCENTER POIN T E C T WILLOW TER HANNER CTALLENDALE DRJAC O BCT CRESCENT DR KNOLLWOOD DR ANNA CTH O P E C T BYRONLNBRADFORDLN DOGWOODLNTARHEEL DRR IDG E LNDG DOVEMEADOWSDRSHADYOAKLN OAK RIDG E D R BAILEYSWAYSAGEWOODLNBRIGHTLEAF CT AUTUMNHILLCTALDRIDGERD OAKWA Y AMBERWAY ALDRIDGE LN CHADWICK DR ASHBROOKCIRASHBROOK CIRHOPEVALLEYDRPINEBROOK DR² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H3c H3mH2p H3qH2t H3m Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet TaylorBranchBEANE RDGROVE FOREST D R SLEEPYHOLLOWDRGILBRETHLN H A RL OWD RWINCR EST DR ( O 9 9 9 9 ) (S1920)(O9999)(S1 997 ) (S 2 0 0 0 )(S1999)(I 74)(S1998) (S1926)(S1920) (7 1 4 6 ) (3296)(7094)( 7 0 0 0 ) (6800 )(1000)(7300 ) (8900)(7105) (6400) (6900 ) (3100) (8 9 8 1 )(6907)(7200)(1001)(2900)(6586)(910 0 )(2700) TUTTLE R D BURRWOODDRHAR L O W R D NEENEELN EBB SHORE D RROBERTS RANCH LNINTERSTATE HWY 74RED ROBIN LNTUTTLE RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H3d H3o H3c H3o Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet MuddyCreek Archdale (S1917) (S 1 0 0 9 ) (200) (4600) (567 0 ) (4911 )(400)(5007) (9 9 3 3 )(300)(202)(1 0 4 4 5 ) (10 2 5 0 )(5745) (3844) (4059)(5008)(102)(4041)(4 9 01) (3936)(5700)(4003) (9 9 0 0 ) (301) (1202)(130 1 )(5783) (1003)(105)(10 2 0 0 ) (3966)(201)(1401)(218) (5000)(1101)(300)(37 00)(4089) (98 0 0 )(5100)(2 0 1 )(5819)(5101)(602)(6100)(300)(200)(1 0 4 4 3 )(104)(101)(3871)(101)(10 3 0 0 ) (10400)(200)(3745) (4809) (1 0 4 2 9 )(106)(501)(300)(100)(1001)(4690)(108)(5800)(100)M A E M A T I L D A C T TREY LN KNOLLWOOD DR MELI S S A C T EDGEWOOD CTBELGIANDRCOUNTRYCT POWELL WAYMACON D RCOTTAGE CTUS H W Y311TARHEEL DRHILLSIDE CTGAL LOP WA YWATERSEDGEDRS M A I N S T SUITS R D COUNTRYLNSPRUCEWOOD CTSAGEWOODLN WOOD AVEMA G N O LI A L N TOM HILL RDCOURTLANDLNE L K H ORNCT ROBIN LN DEERFIELD PLBYRONLNOAKLEY CT ALISON LN GREGGSTPAR K V I EW CT CL Y D E S D A L E D R VILLAGE LNAPACHERDPINEBROOK DRSHEAN DRFRIENDS LNLINDA DRLINDSAY DRLOCKHART STDOVEMEADOWSDRBRADFORDLNROBY DRLAKESIDE DR MOSE DRPARK DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H3q H3c H2t G3e H3m G3f H2p G2h H3q Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet DeepRiverFRAZIERMARSHRDTOMBALL RDCOLTRANEMILLRD(S1921) (S193 5 )(S1924)(S1925) (S 1 9 2 6 ) (S2039)(S1928)(S1934)(S2044)(2200)(7300)(1863) (7 8 0 1 )(7229)(9 0 3 0 ) (7 5 0 0 ) (1900) (2613)(7322)(1800) (6766) (1200)(6219)(7 7 2 9 )(1300)(6300) (1255)(7372)(1100)( 9 3 0 0 ) (2000) (9 1 5 3 )(6965)(929)(6400)(1981) (7 8 2 5 ) (6800) (9500)(7473)(6400)(2216) (1 385)(1400)COLTRANEMILLRD CEDARSQUARERDDEAN VIEW DR H A R L O W R D RI VERMI LLRDFOSTER VIEW DR COX VIEW DR HEDGECOCKRD RED OAK LN TOM BALL RDHOCKETTDAIRYRD LEWIS DAVIS RDED M ONDSTRLHEARTLA N D D R DONNYB RO O K R DLORIENCHARTERDR STEED RD H YD E AW AYLNEBENEZERCHURCHRDBRANSONMEADOWSRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H4c G4a H3d H4d G4bG3b H4q H4c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Deep River I 73 SHODGINFARMRD SENEPOLERDC EDARVAL L E Y D RDOWNSFIELD RDROOSTERLN CEDARRIDGERD I 73 N(S1986)(S2008)(S2010)(S2009)(S20 0 7 )(S2038)(S1938) (S 20 39) (S1937) (S1985) (S1938) ( S 1 0 0 7 )(S2016)(I 73)(500) (700) (6980)(11200)(1 10 0 )(6944)(174)(7041 ) (10300 ) (7 2 0 6)(10900)(7300)(9 1 5 3 ) (7346)(7200)(65 6 1 ) (405) (7189) (9 0 3 0 ) (40 0 ) (300) (600)(10971)(6 4 0 0 )(800) (1200)(971) (100)(10604 )(7100)(6682)(1001)(1000)ROCKETTRD DEERFIELD CT R Y R D RANDLEMANRDCLODFELTER TRL COLONIALLOOP OLDHOCKETTLNEXT SYCAMORE DRCOLONIAL LNDO NNYBRO O KRD VIOLET RIDGE RDMIDWAY FOR R E S T D R OLDHOCKETTL N VERMONT DRHERITAGE LNRI V E R MILL R D OLDROCKETTRDMAGNOLIA LNBIRCH DRSTANTON FAR M RDPOWER LINE RDHOCKETT DAIRY RD HUBBARDLN H O C K E T T TRLLABRADOR DRINTERSTATE HWY 73² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H4d H5cH4c G4bG4a G5a H4p H4d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet I 73 SCEDARVA L L E Y DR ROOSTERLN CEDAR RIDGE RD I 73 N(S1986)(S2008)(S2010)(S2011)(S2009)(S2007 )(S1937) (S1985)(S1007)(S2016)(I 73)(338)(11200)(600) (500) (700)(10900)(174)(7300)(100) (7346)(7200)(71 8 9 )(7100)(400) (300)(10971)(7100)(1001)(1000)ROCKETTRD RANDLEMAN RDCOLONIAL LOOP SYCAMORE DRCOLONIAL LNMIDWAY FO R R E S T D RVERMONT DRHERITAGE LNOLDROCKETTRDMAGNOLIA LNBIRCH DRHUBBAR D LN POWER LINE RDINTERSTATE HWY 73² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H4d H4p H5c H4p Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet (S1921)(S1924)(S2043)(S1928)(S 1 9 2 6 ) (S1 9 2 5 ) (S1934)(S1928)(2200)(7277)(7300)(1863)(7229)(7 8 0 1 ) (7 5 0 0 ) (1900)(7322)(1800) (7 7 2 9 )(6300) (2000)(7372)(6400) (7 8 2 5 ) (1 9 8 1 ) (2216) (1385)(7473)COLTRANE MILL RD CEDARSQUARERDTOMBALLRDDEAN VIEW DR H A R L OW R D FOSTER VIEW DR COX VIEW DR RED OAK LN E D M O N DSTRLHEARTLA N D D RHYDEAWAYLN EBENEZERCHURCHRD STEEDRD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H4c H4q G4a H3d G3b H4q Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Polecat Creek NC 62 E BRANSONMILLRDDAVIS MILL RDRANDLEMAN RD CEDAR RIDG E R D SHELLFORD DRCENTR E D R NORFOLKRD PRIVATE D R (S2101)(S1007)(S2101)(S2280)(S2102)(S2 1 0 0 ) (S1007) (S2350) (S23 5 2 ) (S2351 )(10900)(6800)(414)(774)(801)(11300)(11200)(7055)(730 )(685)(6900)(6 8 1 4 )(344)(11 0 0 )(400)(5 0 0 )(7000)(39 9 ) (6300 ) (1 0 6 0 4 )(1400)(6400)(6 0 0 )(100)(838 )(10971)(1245)(900) (19 2 ) (100) (10300) (754)(7000)(948)(6 500) ( 6 776 ) (6613 ) MIDWAY FO R R E S T D RRANDLEMAN RDHIDDENLNRANDLEMAN RD BRANSON MILL R D SHARON LN MILLIK A N W A Y MASONCIRLABRADOR D R LAWRENCE FA R M L N KERR DR H Y ATTD R BANTAM RD ATLAS DR FARLEY DRHIDDEN LN EXTDEERFIELDCTRYRD LOWE DRGEORGIADRCLODFELTER TRL WILLIAMS CTKEL L Y COLTRANE DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H5c G5a H5d G4b G5b H4d H4p H5c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet PolecatCreekM IL L C R OFT RD BANTAMRDWHIT T H U NT R DHUNT RD NC62E BULL RUSH RDWADEHOCKETTCTS H UNTFORE ST C T DESTINYJORDHOCKETTRD(S2302)(S2366)(S2318)(S2230) (S2304) (S2303)(S2106)(S 2 1 0 4)(S2375)(S2102)(S2105) (S2103) (8000)(6000)(90 0 ) (2237) (6 3 0 0 )(8300)(6254)(8500)(6800)(6900)(60 5 3 )(6800)(8800)(8400)(7000)(6634)(1600) (6700)(6 2 0 0 ) (17 0 0 )(8700)(6100)(6 6 0 0 ) (180 0 ) (122 6 ) (11 0 0 ) (6500) (2097)(8544)( 6 7 1 1)(6743)(2000) (6092)(6500)(1344)(1328)(15 0 5 ) RA V E N C T RACINE RDCHAUCER TRLHIDDENLNEZRA DRB A N TA M RD WHITTHUNTRD Q UAILHO LLO W D R CARRIAGECR OSSIN GDR BERRYLNTAYLORWOODSLN FAL C O N D RJENNIFER DRSUSSEX TRLHIDDEN LN EXTRAYLEFARMCTB L U E R ID G E R D SHARON LN H O C K E T T C T R Y L N PATRICIA DR RAYLEFAR M R DAILEENDRCAMPBELL RDWALDENPOND RD M AP LEGATELNGREGSON RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H5d H6cH5c G5bG5a G6a H5d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet Little Po leca tC re e k APPO MATTOXRD MILLCROFTRD MANTLERDMILLCROFTCTCHARNEL LNMASON R D BULL RUSH RDOLD POST RDSECURITY MI L L S R D OLD CLIMAX RDRACINERDMCCLELLANRDFUZZY HOLLOW DR ALSTON DRHUNTING LODGE RDNC 62 E BETHLEHEMCH UR C H RD(S2 3 8 8)(S2373)(S2106)(S2364)(S2366)(S2392)(S2108) (S2368) (S2 1 0 8 ) (S2107)(S2109)(6084)(17 0 0 ) (2237 )(2308)(2200)(2441)(8700)(2060)(5900)(6063)(6343)(2244)(2000)(9000)(9218)(6000)(6500)(1800) (2013)(2 300 ) (2604)(1970)( 2335)(8800)(6600)(9100)(5910)(5950)(2467) (30 4 3 ) (2900)(6045)(2694)(2600) (1996) (2100)(6200)CHAUCER TRLBERRY LNMAPLEGATE LNWAYNE WHITE RD W ILL O W M EADOWSDRRACINERDWILLOWCHAP EL CT MAYFLOWER DR HUNTINGLODGERDWEEPING WILLOW CTPROVIDENCEDRMAPLEGATELNCEDAR MEADOWS CT DOTTIECO X DR WILLOW SPRINGS DRCARRIAGE CROSSINGDR WEATHERLYDRFREDEASTLNEV ELY N LNBRIAROAK DR OLD CLIMAX RD ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H6c G6a H5d H6d G5b G6b H6c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet SandyCreekClimaxCr(LittleAlamanceCr)(QuakerLk.)Little PolecatCreek NC 62 E US 421 NRADER CTRILEY LN WHITETAIL DRWOL F DEN CT US 421 S ELKSFOREST DRMONNETTRD LEDBETTERRDOFFRAMPDEER GLEN CTN C 2 2 US 421 HWY ALSTONDR ONR AMP BIG BUCK RD O N RA M P MEADOW VISTA WAY OLDCLIM AX RD HEMPHILLRDOFF RAMPMCNEIL L R D RADERDR (S2 5 2 6 )(S2528)(S2529)(S2368) (S2527) (S2530)(S2401)(S2532)(S2400)(S2403)(S2110)(N 22N) (S2402) (3400)(8500) (56 0 0 )(3461)(3470) (3443) (30 4 3 )(3600)(3615)( 3 700 ) (3414) (3293)(6000)(6195)(5639)(3300) (57 0 0 ) (3200) (8219 )(6100)(6070) (3620) (35 0 0 )(3644 )(90 0 0 ) (2878)(8600)(5800) (3100) O LD REDCRO SSRD PIEDMONT ESTATESRD N C H WY 2 2 NSPAINHOUR STGREESON CTRY RD WA Y N E W H I T E R D CURTIS SMITH CIRJULIANS TPEACH STPIEDMONT STBRIAROAK DR NANCE CTRY DR GRAPEVINE DRFRANK LNLEDBETTER RDLANCASTER LN RANDOLPH MEADO W RDPEPPERIDGEWAY HAROLDMEADOW RDEXT MCCLINTOCK RD REDM A PLETRL ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H6d H7cH6c G6bG6a G7a H6t H6d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet SandyCreek (S2400)(S2528)(S2531)(S2 5 26) (S2 5 2 7 )(S2532)(S2403) (S2402) (5 6 0 0 )(3461)(3600)(3500)(3470) (3443)(3600)(3414)(3615)(3293) ( 3 7 00 ) (3300)(6000)(5639)(60 7 0 ) (57 0 0 )(6100)(3620) (35 0 0 )(3644) (3100)(5800)OLD RE D CR OSS R D SPAINHOUR STMOBILE CT PIEDMONT ESTATES RD GREESON CTRY RD CU RTISSMITHCIRJULIANSTNANCE CTRY DR LANCASTER LN GRAPEVINE DRFRANK LNHAROLDMEADOWRDEXT RA N D O L P H M E A D O W R DPEPPERIDGE WAYRED MAPLE TRL ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H6d H6t H7c G6b G7a H6t Date: 5/25/2022 1 inch = 0.13 miles 1 inch = 660 feet Sandy CreekUS 42 1 N NC 62 E LIBERTYRD OLD SECONDST FOLGERSMILL R DUS 421 S ONRA MP MILLHOLLOW CTOLDJULIANRDFLINCHUM AVES N EW G A R D EN R D FOLGERSCT B U R R O W RDSK Y L I N E A V EOFFRAM P JAYLEEPL COLONIALTRADINGPATHBIG BUCK RD O N R A M P NC 62 EBULB RDUS 421 HWYUS 42 1 HW Y (O8888)(S25 1 7)(S2403)(S2502)(S2520)(S2407) (S1006) (S2405) (S2 4 0 4 ) (S2523) (S2515) (U 4 2 1 )(7500)(7310)(5964 )(7986)(6100)(5900)(4200)(5223)(7800)(92 0 0 )(5920)(6120)(8994) (5300)(6000)( 5 700 ) (182 0)(6070) (700 0 ) (5977)(91 0 0 ) ( 5 5 0 3 )(8003)(4059) (3989)(8200)(4387)(5681)(5800)(7600) (8705)(5788)(4284) (57 0 0 ) (3644) (1001)(1000) (4500) (110 0 ) (11 0 1 ) HAROLD M EADO W RD JULIANAIRPORTRDO LD R E D C R O SSRDHOLLOWHILLRDSHILOH RD OLD 421 RD THIRDBST BULB RD HAROLDMEADOWRDEXT RANDOM WOODSRD SHOOTING STAR DRDEVINEYRD CRUTCHFIELD FARM R DEARL TRLFOLGER R D CALHOUN DR US H W Y 4 2 1 WOODVERY DR ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H7c G7a H7d G7G6b H6d H6t H7c Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet D o d s ons La keSMITHWOODRD BOBBYJEANRDNC62E OLD 421RD BOW M AN DAIRYRDBOBBYJEANRD(S2504)(S2413) (S1006)(S2409)(S1006)(7217)(8400)(5126)(8432) (5800)(5500)(5584)(5600)(8500)(8705) (7500)(5442)(7800)BOBBY JEAN RDOLD 421 RD TROY SMITH RDMACEDO N I A L O O P R DBOWMAN DAIRY RD KIMREY LN OLD 421 R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H7d H8 G7 H7c G7a G8a H7d Date: 5/25/2022 1 inch = 0.25 miles 1 inch = 1,320 feet NorthProngRo c k y R iv e rSou th P ro n gS tinkin gQu arter Creek(KimesvilleLake)RIP R D SMITHWOODRD ALAMANCECOUNTYLINERDLOWEMAILRDJE W E L L L NCOLT RANETRCOUN T Y LI N E R DWW LNLINCOLN DR R IC H LAN D C H U R C H RDLAKE JUNO RDBOWMAND A IR Y R D C OUNTYLINERDCHASE FO RD RD PARKVIEW R D CROWFLIGHT RDKIMESVILLERDSTALEYLAKERDHUMBLE RDLAYTON RD Liberty (S 1 0 0 6 )(S2419)(S2554)(S2415)(S 2 4 1 4 )(S2542)(S2504)(S2417)(S2418)(S2410)(6 6 0 0 ) (5969) (7600 )(5409)(5 7 0 0 ) (6950) (7344) (7100) (6 1 6 3 )(4600)(5448)(4897)(5085)(5173)(7200)(5316)(490 0) (6800) (6200) (6 0 0 0 ) (4776)(4800)(5500)(5079)(7500) (5500) (6 7 0 0 ) (536 6 ) (5200) (6653) (6 2 4 8 ) (6900)(5400)(7400)(5200)(5800)(4871)(7000)(6400)(5021)LIBERTYGROVERDALAMANCE LINE DROLD 421 RD COOK C O L L I E R R D E X T REDBUDLN BUTLER RDCURTIS INDUSTRIAL DR MC P HE RSON FARMDRBIG T R E E R D RICHLANDCHURCH RD PEARLFERGUSO NRDSTALEYSDAIR Y RDGYPSYROSEDRPARKSPALMERRDTRAILSE NDRDLONGME ADOWDRCOXLN ISLAND OAKDR FARMHOUSE RDL A K E J UNORDCOOK COLLIER RDMACEDONIALOOP RD YORKM A R T IN R D ² THIS MAP WAS PREPARED BY RANDOLPH COUNTY, NC FOR THE COUNTY'SINTERNAL USE. RANDOLPH COUNTY, ITS AGENTS AND EMPLOYEES MAKE NO WARRANTY AS TO THE CORRECTNESS OR ACCURACY OF THE INFORMATIONSET FORTH ON THIS MAP, WHETHER EXPRESSED OR IMPLIED, IN FACT OR IN LAW, INCLUDING WITHOUT LIMITATION THE IMPLIED WARRANITES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. MAP IS BASED ON STATE PLANE COORDINATE SYSTEM IN 1983 DATUM. RANDOLPH COUNTYSTREET NETWORK SCALE: OR H8 G7 H7d G8a G8b G8j H8 Date: 5/25/2022 1 inch = 0.5 miles 1 inch = 2,640 feet APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-1 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP ABBY LN 200 - 566 D4a 27205 ABIGAIL DR 6500 - 6858 G1t 27370 ABNER RD 5700 - 7406 A3 27205 ACADEMY RD EXT 1100 - 1836 E6b 27248 ACADEMY ST 670 - 1354 E6b 27248 ACADEMY ST 100 - 812 E6o 27248 ACADEMY ST 670 - 812 E6p 27248 ACCESS RD 0 - 0 F5i 27317 ACORN DR 1600 - 1723 G5d 27317 ACORN DR 1600 - 1967 G6c 27317 ACORN DR 1800 - 1967 G6a 27317 ACORN RDG 3000 - 3310 E6r 27248 ACORN RDG 3000 - 3310 E6s 27248 ACTS TEMPLE DR 100 - 163 G5a 27317 ADAMS FARM RD 6659 - 8548 G4b 27317 ADAMS FARM RD 6659 - 7554 G4d 27317 ADAMS RD 100 - 334 G5a 27317 ADAMS RD EXT 5500 - 5544 G5a 27317 ADAMS WAY 4341 - 4500 G5b 27317 ADAMS WAY 4341 - 4500 G5d 27317 ADMIRAL DR 300 - 305 E7q 27316 AILEEN DR 6500 - 6637 H5d 27313 AKINS ST 2119 - 2200 E4a 27205 AKINS ST 2119 - 2200 E4c 27205 ALAMANCE LINE DR 5409 - 5497 G8b 27298 ALAMO CT 5368 - 5400 G2c 27370 ALAMO DR 3200 - 3461 G2c 27370 ALAMO DR 3200 - 3344 F2a 27370 ALBEMARLE RD 600 - 1099 D4o 27205 ALBEMARLE RD 500 - 861 D4p 27203 ALBERT MARTIN RD 100 - 229 D6b 27248 ALBERTSON FARM RD 5204 - 5500 G2j 27370 ALBERTSON RD 5578 - 5758 H1o 27263 ALBERTSON RD EXT 6911 - 6995 H1o 27263 ALBERTSON VIEW ST 5400 - 5437 G2f 27370 ALDRIDGE LN 112 - 116 H2p 27263 ALDRIDGE LN 100 - 228 H3m 27263 ALDRIDGE RD 100 - 581 H2t 27263 ALEXANDER CT 300 - 364 C4p 27205 ALEXANDRIA DR 4189 - 4300 G2l 27370 ALEXANDRIA DR 3982 - 4300 G3i 27370 ALFORD ST 4687 - 4800 G2g 27370 ALISON LN 100 - 315 H3q 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-2 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP ALLEN CT 1421 - 1600 C3b 27205 ALLEN DR 4500 - 4704 G4c 27350 ALLEN VESTAL RD 1228 - 1400 F5d 27317 ALLENDALE DR 6400 - 6908 H3m 27263 ALLIE LN 100 - 357 D6b 27248 ALLISON ST EXT 510 - 531 G8r 27298 ALLRED CIR 4100 - 4198 F4k 27317 ALLRED CIR 4100 - 4198 F4l 27317 ALLRED HEIGHTS DR 4027 - 4200 G3s 27350 ALLRED HEIGHTS DR 4027 - 4200 F3b 27350 ALLRED ST 100 - 295 E6o 27248 ALLRED WAY 200 - 377 F5m 27317 ALLREDVIEW AVE 200 - 284 E7n 27316 ALLWOOD DR 3500 - 3563 G3j 27370 ALPINE DR 4752 - 4800 G2f 27370 ALPINE DR 4657 - 4800 G2j 27370 ALTON DR 3087 - 3200 F6 27248 AMBER WAY 3700 - 3766 H3m 27263 AMELIA CT 1833 - 1842 E4p 27203 AMICK LN 4900 - 4998 F7 27298 AMITY RD 600 - 1060 D4h 27203 ANCHOR DR 100 - 280 D4t 27205 ANDERSON DR 900 - 1008 E5f 27317 ANDREW CTRY LN 3600 - 3845 G7 27233 ANDREW CTRY LN 3600 - 3845 G6d 27233 ANDREW HUNTER RD 100 - 837 E6r 27248 ANDREW HUNTER RD 800 - 1085 E6s 27248 ANDREW HUNTER RD 100 - 258 D6f 27203 ANDREW HUNTER RD 900 - 1477 E6o 27248 ANDREW JACKSON TRL 3100 - 3124 E6r 27248 ANDREW JACKSON TRL 3100 - 3124 E6s 27248 ANGEL FIRE TRL 1000 - 1149 B5 27341 ANGUS TRL 471 - 500 E5i 27317 ANNA CT 101 - 107 H3m 27263 ANNE ST 6100 - 6160 H2q 27263 ANNS CT 600 - 1100 D5q 27205 ANNS CT 700 - 915 D5r 27205 ANTHONY CT 236 - 300 C4h 27205 ANTIOCH CHURCH RD 5300 - 7512 B7 27341 ANTIOCH CHURCH RD 6690 - 8042 A7 27341 ANTIOCH CHURCH RD 7600 - 8042 A8 27341 APACHE RD 100 - 210 H2t 27263 APACHE RD 200 - 210 H3q 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-3 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP APACHE TRL 2600 - 2767 F3d 27350 APOLLO CIR 100 - 165 H2p 27263 APPALOOSA TRL 1200 - 1336 C4i 27205 APPLE TREE RD 1600 - 1728 A4 27205 APPLEGATE LN 200 - 273 E3c 27205 APPLEWOOD RD 3475 - 3900 F5f 27317 APPLEWOOD RD 3475 - 3900 F5j 27317 APRIL LN 700 - 791 D4t 27205 ARABIAN DR 1100 - 1386 C4i 27205 ARABIAN DR 1100 - 1154 C4j 27205 ARBOR DR 3800 - 3927 G3i 27370 ARBOR DR 3800 - 3927 G3j 27370 ARCADIA RD 100 - 335 G5c 27317 ARCADIA RD 300 - 335 G5n 27317 ARCHDALE BLVD 100 - 538 H2n 27263 ARCHDALE BLVD 500 - 538 H2m 27263 ARCHDALE RD 3008 - 3204 H2k 27263 ARCHDALE RD 3200 - 4325 H2o 27263 ARCHDALE RD 9200 - 10191 G3m 27370 ARCHDALE RD 9200 - 9429 G3q 27370 ARCHDALE RD 4300 - 4630 H2s 27370 ARCHDALE RD 4602 - 4704 H2t 27370 ARCHDALE RD 10001 - 11146 G3i 27370 ARCHDALE RD 4800 - 11400 G2h 27370 ARCHDALE RD 10700 - 11146 G3e 27370 ARCHIE NEWSOM RD 3100 - 3372 B5a 27205 ARDEN CT 5045 - 5100 E7o 27316 ARDEN RD 6900 - 7054 G1k 27360 ARLINGTON DR 2900 - 2937 D6f 27205 ARLINGTON DR EXT 3000 - 3120 D6f 27205 ARMADILLO DR 700 - 769 D4s 27205 ARMADILLO DR 700 - 769 C4g 27205 ARMFIELD AVE 200 - 435 D4p 27203 ARMSTRONG CT 100 - 205 H2p 27263 ARNETTE DR 5400 - 5558 G3e 27263 ARNOLD ST 900 - 950 D4k 27203 ARROW HEAD RD 300 - 316 E7n 27316 ARROW ST 4500 - 4559 E6t 27316 ARROW WOOD RD 1200 - 1721 D5m 27205 ARROW WOOD RD 1600 - 1721 D5q 27205 ARROWSTONE DR 1072 - 1200 D3d 27205 ART BRYAN DR 100 - 419 E4h 27203 ART BRYAN DR 100 - 419 E5e 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-4 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP ARTHUR ST 100 - 125 E4t 27203 ARTHUR ST 100 - 125 E5q 27203 ARTHURS CT 3707 - 3800 D6b 27248 ARTISAN AVE 5700 - 5736 H1o 27263 ASBILL LN 5600 - 6024 B7 27341 ASCOT DR 3464 - 3600 G1o 27370 ASH AVE 407 - 605 G8n 27298 ASHBROOK CIR 5867 - 6391 H3m 27263 ASHBROOK VIEW LN 1600 - 1813 C4c 27205 ASHBROOK VIEW LN 1700 - 1813 C4o 27205 ASHDOL ST 800 - 921 D4k 27203 ASHEBORO ST 200 - 306 F8t 27355 ASHEFORD CT 900 - 1000 D4a 27205 ASHETON DR 6071 - 6200 E1 27370 ASHETON DR 6071 - 6200 E2a 27370 ASHEWOOD CIR 700 - 1810 E5e 27203 ASHEWOOD CIR 100 - 1810 E5i 27203 ASHLAND ST 100 - 646 H2p 27263 ASHLEY ST 110 - 1530 E5q 27203 ASHMONT CT 401 - 439 D4s 27205 ASHWORTH CT 100 - 113 G2h 27370 ASHWORTH DR 100 - 120 G2h 27370 ASHWORTH RD 1000 - 1135 D3d 27205 ASHWORTH RD EXT 1200 - 1316 D3d 27205 ASHWORTH VIEW DR 1131 - 1214 C4f 27205 ASHWORTH VIEW DR 1193 - 1214 C4e 27205 ASPEN CT 249 - 264 E4l 27203 ASTEROID RD 3700 - 3801 D3a 27205 ATLANTIC AVE 100 - 466 D4p 27205 ATLAS DR 400 - 455 H5c 27317 AUCTION RD 6600 - 7068 H1o 27263 AUMAN AVE 200 - 382 C4h 27205 AUMAN CLAY RD 100 - 210 B5a 27205 AUMAN FARM RD 6034 - 6284 A5 27341 AUMAN ST 100 - 250 A5j 27341 AUTUMN ACRES LN 2900 - 3105 G1t 27370 AUTUMN ACRES LN 2900 - 3105 F1b 27370 AUTUMN HILL CT 101 - 116 H3m 27263 AUTUMN LN 1200 - 1282 C5j 27205 AUTUMN RIDGE DR 2080 - 2200 D8 27316 AUTUMN WOOD LN 1362 - 1631 C4e 27205 AUTUMN WOODS CT 6500 - 6630 F1b 27370 AVANTI DR 1000 - 1169 C5 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-5 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP AVONDALE AVE 600 - 1041 D5m 27203 AVONLEA LN 800 - 837 F5f 27317 AYCOCK ST 1430 - 1441 E5j 27203 AYCOCK ST 1430 - 1441 E5k 27203 AZALEA DR 1 - 110 F5f 27317 AZALEA LN 3800 - 3873 G1p 27370 AZEL DR 1696 - 1800 F4a 27350 AZTEC DR 400 - 505 H2t 27263 B B TRL 1500 - 1653 C5f 27205 B B TRL 1500 - 1653 C5 27205 BACHELOR CREEK RD 3600 - 6152 B6 27341 BACHELOR CREEK RD 5600 - 6152 A6 27341 BACK CREEK CHURCH RD 100 - 508 D3b 27205 BACK CREEK CT 1700 - 1847 E4s 27205 BACK CREEK RD 100 - 905 D3b 27205 BACK CREEK RD 714 - 1285 E3d 27205 BACK CREEK TER 100 - 432 D3b 27205 BACK ST 100 - 216 F5i 27317 BADIN LN 1500 - 1654 C3b 27205 BAILEY RD 1775 - 2200 C4c 27205 BAILEY RD 2028 - 2200 C4s 27205 BAILEYS WAY 101 - 1506 H3m 27263 BAINBRIDGE ST 100 - 115 H2p 27263 BAKER FARM RD 3985 - 4300 G3d 27350 BAKER FARM RD 3985 - 4300 F3b 27350 BAKER RD 100 - 136 H2k 27263 BAKER RD 100 - 103 H2o 27263 BALDWIN DR 3226 - 3300 F4d 27317 BALDWIN DR 3226 - 3300 F4p 27317 BALFOUR DR 300 - 506 H2s 27263 BALFOUR DR 114 - 307 H2t 27263 BALFOUR DR 114 - 120 H2p 27263 BALSAM ST 1824 - 1900 D5b 27205 BANK ST 2443 - 2569 E4h 27203 BANNER WHITEHEAD RD 1900 - 2874 G3d 27350 BANNER WHITEHEAD RD 1900 - 2539 G4c 27350 BANTAM RD 1100 - 1707 H5d 27313 BANTAM RD 900 - 1225 H5c 27313 BARBARA LN 3400 - 3469 G1t 27370 BARBER DR 305 - 327 G8k 27298 BARBER ST 215 - 234 E4t 27203 BARBERRY CT 3000 - 3056 D6a 27205 BARCLAY PL 2100 - 2119 E5j 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-6 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP BARKER DR 1200 - 1541 G5b 27317 BARKER ST 100 - 215 F5i 27317 BARKLEY ST 4569 - 4600 G2k 27370 BARKWOOD RD 1100 - 1198 E5k 27317 BARRETT DR 4020 - 4128 H2o 27263 BARRETT DR 4097 - 4209 H2s 27263 BARWOOD TER 100 - 139 H2s 27370 BARWOOD TER 100 - 139 G2g 27370 BAY DOE ST 4000 - 4134 E6t 27316 BAY LEAF CT 928 - 941 D5e 27203 BAYBERRY DR 3011 - 3130 F3a 27350 BEANE CTRY RD 6200 - 6606 A4 27205 BEANE RD 7094 - 7096 H3c 27263 BEANE ST 200 - 279 D5k 27205 BEARD AVE 200 - 230 H2s 27263 BEARD AVE 100 - 219 H2o 27263 BEAU CT 4600 - 4727 E2b 27370 BEAUMONT DR 3900 - 4227 G3q 27350 BEAUMONT DR 3900 - 3962 F3a 27350 BEAVER DAM CT 300 - 547 G8o 27298 BEAVERCREEK RD 3300 - 3441 F5m 27317 BECK CTRY DR 3100 - 3144 F5o 27317 BECK FARM RD 6700 - 6956 A6 27341 BECK FARM RD 6700 - 6956 A7 27341 BECKERDITE RD 2918 - 4390 F3d 27350 BECKERDITE RD 1800 - 2797 F4a 27350 BECKERDITE RD 2700 - 3039 F4c 27350 BECKERDITE RD 3818 - 4665 F3c 27350 BEECH CIR 3719 - 3845 G3n 27370 BEECH TREE CT 1448 - 1600 G4c 27350 BEECH TREE CT 1448 - 1600 F4a 27350 BEECH TREE DR 5308 - 5500 G6b 27233 BEECH TREE PL 1100 - 1167 E5n 27203 BEECH TREE PL 1100 - 1167 E5d 27203 BEECHWOOD CT 2179 - 2200 D3d 27205 BEECHWOOD DR 2300 - 2548 E3d 27205 BEESON CT 3062 - 3100 F3c 27350 BEESON FARM RD 3700 - 4971 F4a 27350 BEESON FARM RD 2800 - 3436 F3c 27350 BEESON FARM RD 3351 - 4853 F3b 27350 BEESON FARM RD 3351 - 3436 F3d 27350 BELGIAN DR 101 - 402 H3q 27263 BELGIAN DR 101 - 121 G3e 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-7 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP BELL AVE 100 - 111 F5i 27317 BELL SIMMONS RD 100 - 382 C4k 27205 BELL SIMMONS RD 100 - 382 C4l 27205 BELLAWOOD DR 6424 - 6918 G1k 27370 BELLAWOOD DR 6516 - 6715 G1l 27370 BELLS GROVE RD 6495 - 8456 A1 27239 BELMAR ST 1700 - 1820 H1l 27260 BELMONT DR 7200 - 7358 G1n 27370 BELMONT DR 7100 - 7284 G1o 27370 BELO RUSH DR 3200 - 3274 G3b 27263 BELO RUSH DR 3200 - 3274 G3k 27263 BELVA CT 3100 - 3107 H2j 27263 BELVA CT 3100 - 3107 H2n 27263 BEN LAMBETH RD 1201 - 1500 D3c 27205 BEN LAMBETH RD 1201 - 1500 D3d 27205 BENJAMIN RD 4880 - 5100 A7 27341 BENNETT FARM RD 100 - 230 A5f 27205 BENNETT RD 5200 - 7363 A7 27341 BENNETT RD 7100 - 8984 A8 27341 BENNETT ST 600 - 833 E5m 27203 BENNY LINEBERRY RD 2800 - 4052 G6d 27233 BENNY LINEBERRY RD 3660 - 4052 F6 27233 BENSON FOX DR 100 - 199 B5a 27205 BENT OAK AVE 5600 - 5644 E7l 27316 BENT OAK AVE EXT 5563 - 5600 E7l 27316 BENT RIDGE RD 4400 - 7742 B7 27341 BENTLEY DR 4000 - 4239 F4l 27317 BENTON RD 1700 - 1776 E4e 27350 BENTON RD EXT 1800 - 1925 E4e 27350 BERG ST 788 - 918 D4o 27203 BERKLEY LN 1800 - 2357 E4s 27205 BERKLEY PL 1900 - 1952 E4o 27205 BERKLEY PL 1900 - 1952 E4s 27205 BERKLEY ST 410 - 414 H1k 27260 BERRIE PL 1069 - 1100 E4s 27205 BERRY LN 1600 - 1929 H5d 27313 BERRY LN 1800 - 1929 G5b 27313 BERRY LN 1800 - 2029 G6a 27313 BESCHER CHAPEL RD 100 - 948 E2c 27370 BESCHER CHAPEL RD 100 - 2338 D2 27370 BESCHER CHAPEL RD 2100 - 3481 D1 27239 BESCHER CHAPEL RD 2400 - 3481 C1 27239 BESSIE BELL RD 2500 - 2634 C3a 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-8 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP BETHANY CHURCH RD 3300 - 4583 F5b 27248 BETHANY CHURCH RD 3300 - 3592 F5o 27248 BETHANY CHURCH RD 4400 - 4583 F6 27248 BETHANY WAY 6001 - 6200 G8c 27355 BETHEL CHURCH RD 2200 - 3113 G6a 27313 BETHEL CHURCH RD 2700 - 3113 G6b 27233 BETHEL DR 1771 - 2020 H1o 27260 BETHEL DR 1700 - 1838 H1k 27260 BETHEL DR 1700 - 1770 H1l 27260 BETHEL DR EXT 3805 - 3914 H1n 27260 BETHEL DR EXT 3700 - 3914 H1o 27260 BETHEL FRIENDS RD 2500 - 2571 C5 27205 BETHEL FRIENDS RD 2500 - 3349 C6a 27205 BETHEL LUCAS RD 1720 - 3282 A4 27205 BETHEL PARK DR 3900 - 3927 H1o 27260 BETSY LN 1300 - 1470 E4a 27317 BETTS ST 100 - 139 D4h 27203 BETTY MCGEE DR 2100 - 2241 C3b 27205 BETTY MCGEE DR 2200 - 2241 C3d 27205 BEULAH CHURCH RD 6400 - 6727 A8 27208 BEVAN DR 2134 - 2300 F1b 27370 BEVERLY HILLS DR 1211 - 1291 H1k 27260 BEVERLY HILLS DR 1211 - 1291 H1o 27260 BIG BUCK RD 1820 - 1896 H7c 27283 BIG CTRY DR 4493 - 4700 C2 27205 BIG LEAF RD 4000 - 4141 A3 27371 BIG OAK WAY 5767 - 5847 G5a 27317 BIG TREE RD 6800 - 6920 G8b 27298 BILLY AVE 101 - 114 G2h 27263 BILLY BRADY RD 5698 - 5900 B8 27208 BILLY COLTRANE DR 700 - 754 E6n 27248 BILLY COLTRANE DR 700 - 754 E6r 27248 BILLY CRANFORD LN 1270 - 1300 C4k 27205 BILLY CRANFORD LN 1270 - 1300 C4l 27205 BILLY LEE RD 4606 - 4700 G2j 27370 BILLY LEE RD 4606 - 4700 G2k 27370 BILLY WALKER RD 1200 - 1569 C4e 27205 BILLY WALKER RD 1100 - 1316 D4c 27205 BINGHAM LOFLIN RD 3000 - 3469 C2 27205 BIRCH BARK LN 2355 - 2375 E5e 27317 BIRCH BARK LN 2355 - 2375 E5i 27317 BIRCH DR 7200 - 7296 H4p 27317 BIRCHWOOD CT 100 - 108 G2h 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-9 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP BIRDIE PL 353 - 400 C4t 27205 BIRDS VIEW RD 5200 - 5326 G5b 27317 BIRKHEAD ST 100 - 129 D4p 27203 BLACK MTN RD 3957 - 4500 B2 27205 BLACK OAK CT 6578 - 6600 F1b 27360 BLAIR CT 100 - 228 G3e 27263 BLAIR DR 100 - 323 G2h 27263 BLAIR DR 100 - 107 G3e 27263 BLAIR DR 301 - 323 H2t 27263 BLAIR FARM RD 5187 - 5300 H1s 27263 BLAZING STAR DR 6100 - 6170 H1l 27263 BLUE HERON LN 1203 - 1400 G5d 27317 BLUE QUARTZ DR 6600 - 6772 E1 27360 BLUE RIDGE RD 6200 - 6279 H5d 27313 BLUE VIOLET DR 238 - 306 F4p 27317 BLUE VIOLET DR 238 - 341 F5m 27317 BLUEBERRY CT 5500 - 5541 H2r 27370 BLUEBILL LN 1800 - 1865 E3a 27205 BLUEBIRD LN 1506 - 1600 E4c 27205 BOB KIVETT RD 100 - 277 E6q 27203 BOB KIVETT RD 100 - 277 D6e 27203 BOBBY JEAN RD 7217 - 7243 H7d 27283 BOBBY MORAN DR 100 - 247 B5c 27205 BOBCAT TRL 2663 - 2800 E4g 27317 BOBCAT TRL 2663 - 2800 E4k 27317 BOBWHITE LN 1569 - 1619 E5u 27203 BOGEY LN 1800 - 1850 D4t 27205 BOGGS TRL 4631 - 4900 F7 27298 BOLES AVE 3600 - 3687 H1k 27260 BOLING DR 1300 - 1325 E5q 27203 BOLING DR 1300 - 1325 D5e 27203 BOLIVAR AVE 3700 - 3820 H1k 27260 BOLIVAR AVE 3700 - 3820 H1o 27260 BOMBAY SCHOOL RD 6000 - 6433 B1 27239 BONDURANT RD 200 - 256 C4o 27205 BONITA LN 1300 - 1345 C4e 27205 BONITA ST 1208 - 1300 C4e 27205 BONKEMEYER CTRY TRL 600 - 665 E5i 27317 BONKEMEYER CTRY TRL 600 - 665 E5j 27317 BONKEMEYER DR 500 - 614 E5i 27317 BONKEMEYER DR 500 - 1036 E5j 27317 BONNIE DEWEESE RD 129 - 129 E1 27360 BONNIE PL 100 - 199 H2o 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-10 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP BOOKER T WASHINGTON AVE 500 - 785 D5e 27203 BOOKER T WASHINGTON AVE 500 - 634 D5i 27203 BOOKER T WOMBLE RD 500 - 613 F4l 27317 BOONE FARM RD 600 - 1247 A5 27205 BOONE FARM RD 800 - 1247 A4 27205 BOONE ST 100 - 218 A5k 27341 BORDEAUX DR 4200 - 4279 G1l 27370 BORDEAUX DR 4223 - 4279 G1k 27370 BOROUGH AVE 100 - 402 A5f 27341 BOROUGH AVE 163 - 701 A5a 27341 BOSSONG DR 200 - 370 D4k 27205 BOSSONG DR 229 - 370 D4g 27205 BOULDER CT 2600 - 2635 G3b 27263 BOULDER DR 5726 - 5999 G3b 27263 BOULDIN CT 100 - 125 H2s 27370 BOUNDARY DR 503 - 737 E5e 27317 BOUNDARY DR 451 - 633 F5q 27317 BOWEN DR 1206 - 1251 H1l 27263 BOWEN DR 1206 - 1251 H2i 27263 BOWERS CREEK RD 3096 - 3300 F5m 27317 BOWERS CREEK RD 3096 - 3300 F5q 27317 BOWERS LN 300 - 570 F5m 27317 BOWERS LN 525 - 806 F5n 27317 BOWERS MEADOW DR 700 - 761 F5n 27317 BOWMAN AVE 3800 - 4620 F4l 27317 BOWMAN AVE 3800 - 4111 F4d 27317 BOWMAN AVE 3800 - 4111 F4p 27317 BOWMAN DAIRY RD 5500 - 5596 H7d 27298 BOWMAN LOOP DR 5300 - 5409 G3k 27263 BOYD AVE 100 - 171 D4t 27205 BOYD DR 100 - 280 A5k 27341 BOYLES DR 502 - 700 B4 27205 BRAD RD 4300 - 4362 G3d 27350 BRAD RD 4300 - 4362 G3s 27350 BRADFORD LN 1302 - 1309 H3m 27263 BRADFORD LN 1001 - 1035 H3q 27263 BRADSHER CT 1 - 10 F5e 27317 BRADSHER CT 1 - 10 F5f 27317 BRADY AVE 700 - 748 D4o 27203 BRADY AVE 600 - 748 D4p 27203 BRADY ST EXT 341 - 1226 E7a 27316 BRADY ST EXT 158 - 1226 E7n 27316 BRADY ST EXT 158 - 202 E7r 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-11 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP BRANCHVIEW WAY 5096 - 5221 C2 27239 BRANCHWATER RD 700 - 787 D3d 27205 BRANCHWOOD DR 1400 - 1464 C3b 27205 BRANCHWOOD DR 1400 - 1464 C4e 27205 BRANDON LN 100 - 119 G2h 27370 BRANIFF PL 101 - 205 H2s 27263 BRANSON DAVIS RD 4400 - 4814 F4a 27350 BRANSON DAVIS RD 4700 - 6114 G4c 27350 BRANSON DAVIS RD 5800 - 6547 G4a 27350 BRANSON MEADOWS RD 6800 - 7062 H4c 27263 BRANSON MILL RD 100 - 413 G5a 27317 BRANSON MILL RD 344 - 1479 H5c 27317 BRANTLEY DR 300 - 373 B4b 27205 BRANTLEY GORDON RD 5400 - 7571 C1 27239 BRANTLEY GORDON RD 5200 - 5941 C2 27239 BRASSIE CT 2600 - 2626 C4t 27205 BRAXTON CRAVEN RD 5300 - 5646 H2r 27370 BRAY BLVD 400 - 420 D4t 27205 BRAY BLVD 421 - 467 D4t 27205 BRAY BLVD 741 - 1000 C4h 27205 BRECKENRIDGE DR 1 - 110 G1f 27360 BRECKENRIDGE DR 100 - 120 G1g 27360 BRECKENWOOD CT 800 - 967 E5d 27203 BRECKENWOOD CT 800 - 967 E5s 27203 BREEZE HILL RD 600 - 1035 D4o 27203 BREEZE HILL RD 600 - 920 D4k 27203 BREEZEWAY CT 1000 - 1014 D4o 27203 BRENTWOOD CT 600 - 605 D5e 27203 BREVARD DR 1589 - 1700 E4s 27205 BREWER ST 400 - 1022 D5i 27203 BREWER ST 200 - 423 D5e 27203 BREWER ST 200 - 316 D4h 27203 BRIANNA PL 5100 - 5136 H2r 27370 BRIAR PATCH LN 2600 - 2873 F1g 27360 BRIARCLIFF DR 1100 - 1581 D5n 27205 BRIARCLIFF DR 1407 - 1581 D5d 27205 BRIARCLIFF RD 4200 - 4379 G1k 27360 BRIAROAK DR 2600 - 2770 H6c 27233 BRIAROAK DR 2600 - 2770 H6d 27233 BRIDGE POINT DR 2945 - 2994 F3a 27350 BRIDGE POINT DR 2900 - 2994 F3c 27350 BRIDLEWOOD DR 6900 - 7247 G1o 27370 BRIGHT STAR LN 4200 - 4275 B2 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-12 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP BRIGHTLEAF CT 100 - 114 H3m 27263 BRILES DR 912 - 1500 C4e 27205 BRILES DR 1337 - 1500 C4i 27205 BRILES MEADOW RD 5900 - 6485 E1 27370 BRILES MEADOW RD 5900 - 6275 E2c 27370 BRILES MEADOW RD 5900 - 6275 D2 27370 BRINKLEY CTRY LN 4700 - 4752 G8k 27298 BRINTON PL 4465 - 4500 E7m 27316 BRINTON PL 4465 - 4500 E7n 27316 BRISTOL LN 300 - 411 G5n 27317 BRITT AVE 700 - 791 D4o 27203 BRITT AVE 700 - 791 D4p 27203 BRITTAIN ST 100 - 418 E5q 27203 BRITTANY LN 100 - 107 F5i 27317 BRITTANY TRL 1700 - 2169 G5b 27313 BRITTANY TRL 1700 - 2169 G6a 27313 BRITTANY WAY 100 - 1710 H2o 27263 BROAD OAKS ST 2902 - 3000 E6r 27203 BROAD ST 366 - 377 E7n 27316 BROAD ST 366 - 377 E7r 27316 BROKAW DR 5354 - 5500 G2c 27370 BROKEN OAK RD 3200 - 3527 G2c 27370 BROKEN OAK RD 3200 - 3432 F2a 27370 BRONZIE LAWSON RD 2760 - 2823 G3b 27263 BRONZIE LAWSON RD 2794 - 3000 G3k 27263 BROOK CIR 5100 - 5253 H1t 27263 BROOK CIR 5000 - 5188 G1h 27263 BROOK CIR 5200 - 5253 H2q 27263 BROOK CIR EXT 6090 - 6200 G1h 27263 BROOK CIR EXT 6090 - 6200 G2e 27263 BROOK DR 1700 - 2058 D4t 27205 BROOK ESTATES RD 600 - 646 F5m 27317 BROOK ESTATES RD 600 - 744 F5n 27317 BROOK ST 6200 - 6283 H1t 27263 BROOKBANK CT 100 - 125 H2s 27370 BROOKDALE DR 1101 - 1723 D5m 27205 BROOKDALE DR 4911 - 5100 G2f 27370 BROOKDALE DR 1400 - 1723 D5q 27205 BROOKDALE RD 2759 - 2880 E6r 27203 BROOKGREEN RD 5102 - 5294 E7o 27316 BROOKHAVEN RD 5360 - 5463 D7b 27316 BROOKHOLLOW LN 100 - 212 H2t 27263 BROOKHOLLOW LN 100 - 124 H2p 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-13 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP BROOKLEIGH CT 100 - 115 G2h 27370 BROOKLYN AVE 1900 - 2025 E7r 27316 BROOKLYN AVE 2059 - 2078 D7e 27316 BROOKLYN AVE 2000 - 2060 E7q 27316 BROOKLYN AVE EXT 823 - 1492 D7e 27316 BROOKLYN AVE EXT 925 - 1492 D7a 27316 BROOKSDALE RD 6800 - 7111 F8a 27355 BROOKSDALE RD 6800 - 7111 F8b 27355 BROOKSHIRE CT 2100 - 2231 F3d 27350 BROOKSHIRE RD 400 - 524 F4l 27317 BROOKSIDE CT 3007 - 3100 D3a 27205 BROOKSIDE DR 300 - 359 D4l 27203 BROOKSIDE DR 300 - 359 D5i 27203 BROOKVIEW CIR 413 - 420 E7r 27316 BROOKWAY RD 50 - 100 D4o 27205 BROOKWOOD ACRES DR 4000 - 4391 F4k 27317 BROOKWOOD ACRES DR 4329 - 4391 F4l 27317 BROOKWOOD ACRES DR 4000 - 4327 F4d 27317 BROOKWOOD CIR 100 - 2699 H2o 27263 BROOKWOOD DR 400 - 579 D5e 27203 BROOKWOOD ESTATES RD 4199 - 4300 G3s 27350 BROWER MEADOW RD 2900 - 3848 F7 27355 BROWER MEADOW RD 3500 - 5958 G7 27355 BROWER MILL RD 3200 - 4550 A7 27341 BROWER MILL RD 2139 - 3888 A6 27341 BROWERDALE RD 7403 - 7700 D8 27344 BROWERS CHAPEL RD 100 - 520 D5m 27205 BROWERS CHAPEL RD 1463 - 1800 D5n 27205 BROWERS CHAPEL RD 398 - 1105 D5q 27205 BROWERS CHAPEL RD 600 - 1674 D5r 27205 BROWN HOUSE RD 5454 - 5500 G2c 27370 BROWN LOOP 4200 - 4360 F4k 27317 BROWN OAKS RD 3900 - 4422 F5f 27317 BROWN OAKS RD 4400 - 4550 G5r 27317 BROWN ST 4933 - 5000 G2f 27370 BROWN TRL 565 - 700 D5q 27205 BROWNLOW LN 3600 - 3810 A3 27371 BROWNMIRE DR 653 - 700 D5q 27205 BROWNS CROSSROADS RD 100 - 2072 E8 27355 BROWNS CROSSROADS RD 1867 - 2072 F8t 27355 BROWNS MEADOW RD 4900 - 5108 H7d 27298 BROWNSTONE HILLS DR 1482 - 1600 D5d 27205 BROWNWOOD DR 3200 - 3519 G6b 27233 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-14 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP BRUBAKER LN 2800 - 3066 D3d 27205 BRUCE PUGH RD 2000 - 3138 F6 27248 BRUSH CREEK RD 6300 - 7242 B8 27208 BRYAN AVE 822 - 921 D4p 27203 BUCK FORD RD 1400 - 1770 B4 27205 BUCK LN 1100 - 1205 F4a 27350 BUCK LN 1100 - 1205 F4c 27350 BUCK MOUNTAIN TRL 2603 - 2700 E3b 27350 BUCKHORN DR 2608 - 2787 F5q 27317 BUCKHORN DR 2608 - 2787 F5r 27317 BUCKHORN DR 2608 - 2787 E5f 27317 BUFFALO FORD RD 3458 - 5436 D6d 27205 BUFFALO FORD RD 2400 - 3781 D6c 27205 BUFFALO FORD RD 5080 - 6287 D7 27316 BUFFALO FORD RD 6400 - 6768 C7 27316 BUFFALO TRL 2501 - 2600 D7 27316 BUGATTI AVE 1800 - 1820 C5 27205 BUIE LN 100 - 135 E6o 27248 BUIE LN EXT 100 - 175 E6o 27248 BUILDERS DR 3037 - 3100 G1s 27360 BULB RD 5700 - 5764 H7c 27283 BULL RUN CREEK RD 3700 - 4776 F5b 27248 BULL RUN CREEK RD 4460 - 4832 G5d 27317 BULLA ST 100 - 113 D4p 27203 BULLINS LN 100 - 178 B5c 27205 BUMPAS RD 2500 - 3227 F8a 27355 BUNDY DR 3400 - 3458 G3j 27263 BUNTING RD 817 - 1331 D4k 27205 BUNTING RD 1000 - 1331 D4a 27205 BUNTON SWAIM RD 3900 - 4675 G8a 27298 BUNTON SWAIM RD 3900 - 4675 G8c 27298 BUNTON SWAIM RD 3900 - 4675 G8n 27298 BURGEMERE ST 4305 - 4411 H2t 27263 BURGEMERE ST 4305 - 4399 H2p 27263 BURGESS CATTLE DR 7100 - 7435 D8 27344 BURGESS FARM DR 6015 - 6300 E8 27316 BURGESS FARM DR 6015 - 6080 E7d 27316 BURGESS FARM DR 6081 - 6300 D8 27316 BURGESS KIVETT RD 6300 - 8064 D8 27316 BURGESS KIVETT RD 6300 - 6838 E8 27316 BURGESS ST 100 - 109 F4h 27317 BURGESS ST 1814 - 1834 E5n 27203 BURMIL RD 1700 - 1819 E4p 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-15 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP BURNEY MILL RD 4513 - 6400 A2 27239 BURNEY MILL RD 6495 - 6600 A1 27239 BURNEY RD 300 - 976 A5a 27205 BURNEY RD 100 - 819 A5f 27205 BURNEY RD 820 - 3060 A4 27205 BURNS FARM RD 700 - 800 D6a 27205 BURNS ST 100 - 223 D4l 27203 BURNS ST 200 - 223 D5i 27203 BURRELL ALLEN RD 4800 - 5671 B2 27239 BURROW RD 5300 - 5310 H7c 27283 BURRWOOD DR 6800 - 7024 H3o 27263 BUSH CREEK DR 1864 - 2000 E6a 27248 BUSH ST 350 - 365 E7r 27316 BUTLER RD 4868 - 5078 G8k 27298 BUTLER RD 4927 - 5639 G8b 27298 BUTLERS CHAPEL RD 1033 - 1392 E6b 27248 BUTLERS CHAPEL RD 1033 - 1392 E6o 27248 BUTTERFLY TRL 2555 - 2595 E5f 27317 BUTTKE DAIRY LOOP 5297 - 5391 G4d 27317 BYRD HOUSE RD 2928 - 3200 F8a 27355 BYRD LN 3238 - 3300 F2b 27350 BYRON LN 1001 - 1116 H3q 27263 BYRON LN 1101 - 1210 H3m 27263 C C SQUARE RD 4907 - 4948 E7n 27316 C C SQUARE RD 4907 - 5000 E7o 27316 CABLE CREEK RD 500 - 1456 D3d 27205 CABLE FARM TRL 7000 - 7268 H5c 27317 CAGLE LOOP RD 900 - 1533 A5 27341 CAGLE ST 400 - 416 F4l 27317 CAIN CT 5100 - 5140 G2f 27370 CALHOUN DR 4500 - 4783 H7c 27298 CALLAHAN ST 1005 - 1017 H2j 27263 CALLAHAN ST 1009 - 1017 H2n 27263 CALLICUT ST 400 - 471 D5i 27203 CALLICUTT HENLEY RD 1706 - 2078 C4j 27205 CALLICUTT HENLEY RD 1849 - 2078 C4c 27205 CALLIE DR 100 - 149 A5 27341 CALVARY WAY 6402 - 6500 F1 27360 CALVERT ST 4484 - 4563 G2k 27370 CAMDEN CT 1045 - 1100 E5r 27203 CAMELLIA LN 818 - 900 F5r 27317 CAMELOT DR 1100 - 1214 E5q 27203 CAMERON CIR 4800 - 4966 E2d 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-16 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP CAMERON CT 4201 - 4208 G2h 27370 CAMERON CT 3766 - 3800 G1o 27370 CAMERON DR 200 - 320 E2d 27205 CAMERON PL 200 - 255 E2d 27205 CAMP MUNDO VISTA TRL 2800 - 3143 E3b 27350 CAMP NAWAKA RD 3800 - 4031 F5b 27317 CAMP NAWAKA RD EXT 4040 - 4124 F5b 27317 CAMP ST 300 - 320 E7m 27316 CAMP ST 300 - 320 E7q 27316 CAMPBELL RD 6743 - 6904 H5d 27313 CAMPFIRE RD 3962 - 3992 F5b 27317 CANAAN CHURCH RD 6600 - 7268 C1 27239 CANAAN CHURCH RD 6900 - 7268 D1 27239 CANDLEBROOK DR 5100 - 5320 A5a 27205 CANDLEWOOD DR 122 - 533 G8o 27298 CANE MILL RD 2800 - 3746 C6c 27205 CANNON CT 300 - 351 D4g 27205 CANNON CT 300 - 351 D4k 27205 CANNON HEIGHTS DR 900 - 1139 C4f 27205 CANOY DR 1821 - 1940 E4p 27203 CANOY FARM RD 700 - 1313 E7d 27316 CANOY FARM RD 761 - 1313 D7b 27316 CANTER DR 3500 - 3956 G1n 27370 CANTER LN 2300 - 2459 G3b 27263 CANTER RD 5700 - 6371 G3b 27263 CANTER RD 6200 - 6685 H3d 27263 CANTERBURY TRL 1200 - 1540 D5n 27205 CAPEL ST 2200 - 2200 E7r 27316 CARAWAY CT 1900 - 2005 E4e 27350 CARAWAY DR 1800 - 2130 E4e 27350 CARAWAY MTN RD 5100 - 5498 E3b 27350 CARAWAY MTN RD 4765 - 5498 F3c 27350 CARAWAY MTN RD 4765 - 5498 F3d 27350 CARAWAY MTN RD 3400 - 4337 E3d 27205 CARAWAY SPRINGS TRL 1361 - 2700 E3b 27350 CARAWAY SUMMIT TRL 1361 - 1600 E3d 27350 CARAWAY TRL 3624 - 3800 F3a 27350 CARDINAL CT 7467 - 7500 G8b 27298 CARDINAL CT 7467 - 7500 G8d 27298 CARDINAL PL 100 - 116 H2m 27263 CARDINAL ST 628 - 700 D4s 27205 CARDINAL VIEW DR 4523 - 4581 G8b 27298 CARDINAL VIEW DR 4500 - 4557 G8d 27298 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-17 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP CARL ALLRED RD 1904 - 2223 E5b 27248 CARL ALLRED RD 1904 - 3661 E6a 27248 CARL ALLRED RD 3342 - 3661 F6 27248 CARL ALLRED RD 3342 - 3661 F6c 27248 CARL BRADY RD 5900 - 7106 B8 27208 CARL COX RD 6100 - 6809 B8 27208 CARL DR 2152 - 2331 E4h 27203 CARL DR 2000 - 2331 E4l 27203 CARL LEE DR 7377 - 7500 E1 27292 CARLISLE AVE 100 - 116 F5e 27317 CARLISLE AVE EXT 200 - 221 F5e 27317 CARLTON DR 3900 - 4188 F3a 27350 CAROLE DR 3700 - 3886 F3a 27350 CAROLINA AVE 100 - 301 D4h 27203 CAROLINA AVE 100 - 301 D5e 27203 CAROLINA CT 100 - 103 H2t 27263 CAROWOOD DR 800 - 859 C4f 27205 CARRIAGE CROSSING DR 6600 - 6715 H6c 27313 CARRIAGE HOUSE CIR 3900 - 4058 G1p 27370 CARRIAGE LN 300 - 366 D5n 27205 CARRIAGE PL 3566 - 3600 G1o 27370 CARRIAGE WAY RD 80 - 151 D4a 27205 CARRINGTON CT 5400 - 5513 H2r 27370 CARRINGTON LN 1001 - 1005 H2p 27263 CARROLL ST 3904 - 3910 H2o 27263 CARSON RD 1300 - 1414 D4h 27203 CARTER ST 800 - 812 E7r 27316 CASCADE AVE 600 - 658 D4h 27203 CASHATT RD 4700 - 5128 F2d 27370 CASHATT RD 4700 - 4893 E2b 27370 CASPN DR 200 - 219 D4p 27203 CASSADY RD 3100 - 3208 B6b 27341 CASTLEROCK RD 1000 - 1054 F5n 27317 CASTLEROCK RD 1000 - 1130 F5o 27317 CATHERINE WAY 2940 - 3000 F3c 27350 CATHERINE WAY 2940 - 3000 F3d 27350 CAUDLE ESTATE DR 500 - 776 F5q 27317 CAUDLE ESTATE DR 500 - 776 F5r 27317 CAUDLE FARM LN 3200 - 3467 F5b 27248 CAUDLE RD 645 - 1437 F5m 27317 CAUDLE RD 100 - 183 F4d 27317 CAUDLE RD 141 - 972 F5q 27317 CAUSEY DR 383 - 400 E5e 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-18 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP CAVINESS RD 8300 - 8403 A8 27325 CECIL NORMAN RD 4958 - 5100 G5d 27317 CECIL ST 1200 - 1246 H1k 27260 CECIL ST 1200 - 1246 H1o 27260 CECIL VIEW LN 5900 - 6089 G5a 27317 CECYLIA CT 262 - 290 F5q 27317 CEDAR BRADY LN 1500 - 1624 E6a 27248 CEDAR CREEK DR 973 - 1300 E4c 27205 CEDAR CREEK DR 630 - 1300 D4a 27205 CEDAR DR 4400 - 4448 G3r 27350 CEDAR FALLS CHURCH DR 2200 - 2255 E6m 27317 CEDAR FALLS RD 929 - 1047 D5i 27203 CEDAR FALLS RD 2300 - 3235 E6n 27248 CEDAR FALLS RD 2300 - 2608 E6m 27248 CEDAR FALLS RD 3078 - 3235 E6o 27248 CEDAR FOREST RD 3300 - 3983 E6b 27248 CEDAR GROVE DR 1500 - 1630 C4l 27205 CEDAR GROVE DR EXT 1400 - 1515 C4l 27205 CEDAR GROVE RD 1400 - 1734 C4l 27205 CEDAR GROVE RD 1600 - 1734 C4k 27205 CEDAR HILL CT 6200 - 6210 G1h 27370 CEDAR LN 6100 - 6332 G4a 27317 CEDAR LODGE RD 329 - 400 D5k 27205 CEDAR MEADOWS CT 2013 - 2100 H6c 27313 CEDAR POST ST 5600 - 5796 H1p 27263 CEDAR RD 1900 - 2075 E5m 27203 CEDAR ROCK MTN RD 1700 - 2148 B3 27205 CEDAR RUN DR 100 - 335 G5a 27317 CEDAR SPRINGS RD 3687 - 3900 F5f 27317 CEDAR SPRINGS RD 3687 - 3869 F5b 27317 CEDAR SPRINGS RD 3687 - 3869 F5j 27317 CEDAR SQUARE RD 6500 - 7228 G4a 27263 CEDAR SQUARE RD 6000 - 6778 G3b 27263 CEDAR SQUARE RD 5400 - 6386 G3k 27263 CEDAR SQUARE RD 7473 - 7762 H4c 27317 CEDAR SQUARE RD 7229 - 7762 H4q 27317 CEDAR TRL 3400 - 3560 G1r 27360 CEDAR TRL 3500 - 3678 G1n 27360 CEDAR WOOD DR 5100 - 5444 F2a 27370 CEDAR WOOD DR 5100 - 5246 F2b 27370 CEDAR WOOD PL 1100 - 1250 E5r 27203 CEDAR WOOD PL 1100 - 1250 E5s 27203 CEDAR XING 100 - 124 G3m 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-19 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP CEDARBERRY RD 6500 - 6646 G1h 27370 CEDARBERRY RD 6500 - 6550 G1l 27370 CEDARDALE CT 2409 - 2428 E5e 27317 CEDARDALE ST 4900 - 4970 G2g 27370 CEDARWOOD CT 2195 - 2300 D3d 27205 CEEBEE DR 3600 - 3625 G3f 27263 CELESTE LN 500 - 519 E5m 27203 CENTER CROSS CHURCH RD 1400 - 2428 A4 27205 CENTER POINTE CT 400 - 412 H3m 27263 CENTER ST 122 - 147 G8o 27298 CENTER ST 800 - 985 D4p 27203 CENTRAL FALLS RD 900 - 1000 E5n 27203 CENTRAL FALLS RD 700 - 907 E5m 27203 CENTRAL PIEDMONT CT 100 - 113 F4l 27317 CENTRAL PIEDMONT CT 100 - 113 F4p 27317 CENTURY LN 6300 - 6408 F1b 27360 CHADWICK DR 3739 - 3799 H3m 27263 CHAMBERLIN DR 1010 - 1200 E4c 27205 CHAMBERLIN DR 900 - 1200 D4a 27205 CHAMPAGNE DR 2000 - 2055 E4l 27203 CHANEY RD 200 - 823 D6f 27205 CHANEY RD 700 - 1205 D6a 27205 CHANEY RD 1086 - 1205 D6b 27205 CHANTERELLE DR 0 - 7233 H3m 27263 CHAPEL HILL CHURCH RD 7200 - 8593 A1 27239 CHAPELGATE LN 1100 - 1147 D4g 27205 CHAPELWOOD RD 1621 - 1900 D1 27239 CHAPELWOOD RD EXT 1549 - 1600 D1 27239 CHAPSWORTH DR 6965 - 7367 G1o 27370 CHARITY CHURCH LN 6800 - 6857 H1o 27263 CHARLES AVE 100 - 490 D4t 27205 CHARLES MTN RD 6900 - 8016 A1 27239 CHARLES MTN RD 6900 - 7225 B1 27239 CHARLES PL 2051 - 2100 G6a 27313 CHARLIE HARRIS RD 6200 - 6617 E1 27370 CHARLOTTE CHURCH RD 1144 - 1200 E4c 27205 CHARMIN DR 800 - 844 D4s 27205 CHARTER OAKS DR 500 - 1083 F5f 27317 CHARTER PL 5 - 11 G1f 27360 CHARTIER CT 851 - 900 E4o 27205 CHARTWELL LN 1736 - 1800 F5d 27317 CHASE RD 500 - 562 E1 27360 CHATEAU DR 4200 - 4220 G1k 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-20 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP CHATHAM VIEW RD 200 - 520 E8 27316 CHAUCER TRL 5365 - 6200 G5b 27313 CHAUCER TRL 6084 - 6200 H5d 27313 CHECKMARK RD 7200 - 7689 A1 27239 CHEDDINGTON DR 700 - 766 E5r 27203 CHEEK PURVIS TRL 6912 - 7000 A8 27208 CHEEK RD 500 - 568 E7l 27316 CHELSEA SQ 1502 - 1608 H2o 27263 CHEROKEE ST 300 - 405 D4k 27203 CHEROKEE TRL 5800 - 5959 G6a 27313 CHERRYWOOD RD 4900 - 5095 G5c 27317 CHERRYWOOD RD 4900 - 5095 G5n 27317 CHESAPEAKE LN 102 - 1407 H2p 27263 CHESAPEAKE LN 102 - 207 H2k 27263 CHESHIRE PL 400 - 572 D4a 27205 CHESNUTT OAK RD 500 - 618 F4d 27317 CHESNUTT OAK RD 500 - 618 F4p 27317 CHESTNUT ST 200 - 516 D4h 27203 CHESTNUT ST 200 - 369 D4l 27203 CHET DR 3900 - 4045 G3e 27370 CHET DR EXT 5348 - 5400 G3e 27370 CHEYENNE CIR 200 - 323 D4n 27205 CHEYENNE CIR 200 - 390 D4o 27205 CHEYENNE CIR 324 - 390 D4n 27205 CHEYENNE DR 3901 - 4207 H2t 27263 CHEYENNE TRL 2114 - 2400 G6a 27313 CHICKADEE CIR 1323 - 1388 E5r 27203 CHILTON RD 6300 - 6495 B8 27316 CHIPPER TRL 6300 - 6605 F1 27360 CHIPPER TRL 6300 - 6605 E1 27360 CHISHOLM RD 1000 - 1008 E7r 27316 CHISHOLM RD 1006 - 1020 D7a 27316 CHRISTOPHER WAY DR 441 - 500 E7k 27316 CHURCH ST 1300 - 1399 E7r 27316 CHURCH ST 200 - 254 F8t 27355 CHURCH ST 100 - 231 F5i 27317 CHURCH ST 100 - 322 E6p 27248 CHURCH ST 100 - 187 E6o 27248 CIRCLE B DR 964 - 1200 D5d 27205 CIRCLE CT 3400 - 3671 G1p 27370 CIRCLE CT 3400 - 3507 G1t 27370 CIRCLE DR 200 - 334 H2m 27263 CIRCLE DR EXT 6000 - 6057 H2m 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-21 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP CITATION DR 7300 - 7358 G1n 27370 CITY VIEW ST 400 - 723 D4h 27203 CLACIE LN 2300 - 2414 F7 27298 CLAPP DR 100 - 183 D6e 27205 CLARA THOMAS DR 5300 - 5390 E2a 27370 CLARENCE BOWERS RD 3046 - 3100 F5m 27317 CLARENCE BOWERS RD 3046 - 3100 F5q 27317 CLARENCE YORK RD 4700 - 5059 F7 27298 CLARENDON RD 900 - 1006 D4g 27205 CLARK AVE 100 - 3135 E6o 27248 CLARK ST 100 - 187 E6o 27248 CLARK ST 100 - 269 E6p 27248 CLASSIC DR 700 - 749 G4b 27317 CLAUDE HOLDEN DR 100 - 163 F4p 27317 CLAY ST 1104 - 1113 D4h 27203 CLAYBROOK RD 6116 - 6200 E8 27316 CLAYTON ST 5600 - 5812 H1o 27263 CLAYTON ST 5716 - 5812 H1n 27263 CLAYTON THOMAS DR 3000 - 3101 C6b 27316 CLEAR MORNING RD 3400 - 3533 F3a 27350 CLEAR RIDGE DR 2910 - 3207 F2b 27370 CLEARVIEW DR 300 - 546 C4h 27205 CLEARWATER CT 1100 - 1135 D6b 27205 CLEARWATER CT 1100 - 1135 D6d 27205 CLEGG AVE 500 - 520 E4p 27203 CLEON ST 1700 - 1865 D6c 27205 CLETUS LN 1777 - 1800 E4c 27350 CLEVELAND ST 1122 - 1317 D4g 27205 CLIFF RD 200 - 633 D5i 27203 CLIFF RD 600 - 1438 D5m 27205 CLIFFWOOD DR 1056 - 1600 D5k 27205 CLIFTON DR 5100 - 5227 G3j 27263 CLINT CAVINESS RD 5900 - 6268 B8 27316 CLIPWOOD RD 6500 - 6765 B8 27208 CLODFELTER TRL 100 - 318 H5c 27317 CLOVER DR 3500 - 3854 F3a 27350 CLOVER ST 908 - 1023 D4h 27203 CLOVERDALE CT 100 - 117 H2n 27263 CLOVERDALE DR 100 - 305 H2n 27263 CLOVERFIELD RD 1291 - 1500 B4 27205 CLUB VIEW DR 100 - 443 E3c 27205 CLUB VIEW DR 100 - 443 D3a 27205 CLYDE GRAVES CIR 5500 - 5672 D2 27239 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-22 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP CLYDE KING RD 5000 - 6768 B5 27341 CLYDE KING RD 5600 - 6768 B6 27341 CLYDE KING RD 5600 - 6768 A6 27341 CLYDE KING RD 4900 - 5311 B5c 27205 CLYDE TOOMES LN 6000 - 6104 G5a 27317 CLYDESDALE DR 101 - 112 H3q 27263 COLD BROOK CT 4400 - 4454 G2j 27370 COLD BROOK CT 4400 - 4454 G2i 27370 COLE MTN RD 2100 - 2500 C4s 27205 COLERIDGE RD 100 - 784 E7r 27316 COLERIDGE RD 700 - 784 D7a 27316 COLERIDGE RD 200 - 351 D5i 27203 COLLETT FARM RD 4500 - 4708 G1h 27370 COLLETT FARM RD 4500 - 4614 G1l 27370 COLLETTE ST 5300 - 5355 H2r 27370 COLLINS ST 4887 - 5020 G2f 27370 COLONIAL CIR 4545 - 4911 G1h 27370 COLONIAL CIR 4500 - 4959 G1l 27370 COLONIAL CLUB DR 6700 - 7514 G1g 27360 COLONIAL CLUB DR 6600 - 6879 G1h 27360 COLONIAL CLUB DR 6600 - 6625 G1l 27360 COLONIAL LN 7200 - 7243 H4p 27317 COLONIAL LOOP 300 - 530 H4p 27317 COLONIAL MANOR DR 4494 - 4600 G1g 27360 COLONIAL RD 350 - 400 D5n 27205 COLONIAL ST 200 - 210 H2o 27263 COLONIAL TRADING PATH 7986 - 8312 H7c 27283 COLONY CT 100 - 104 F4d 27317 COLONY LN 4700 - 4768 G3m 27370 COLONY RD 500 - 741 D5q 27205 COLORADO BLVD 7033 - 7099 G1j 27360 COLORADO BLVD 7069 - 7168 G1k 27360 COLTRANE CEDAR RD 4300 - 4513 F4a 27350 COLTRANE MEADOW RD 7400 - 7899 D8 27316 COLTRANE MILL RD 1300 - 2736 H4c 27317 COLTRANE MILL RD 2000 - 2612 H4q 27263 COLTRANE MILL RD 2613 - 2736 H3d 27263 COLTRANE ST 4500 - 4993 G2j 27370 COLTRANE ST 4600 - 4993 G2e 27370 COLTRANE ST 4600 - 4993 G2i 27370 COLUMBIA AVE 500 - 545 E7r 27316 COLUMBIA ST 200 - 510 F8t 27355 COLUMBUS AVE 106 - 135 H2o 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-23 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP COLUMBUS AVE 106 - 135 H2p 27263 COMANCHE RD 3700 - 3910 H2t 27263 COMMERCE PL 100 - 836 E4h 27203 COMMERCE SQ 100 - 128 F5i 27317 COMMONWEALTH RD 1200 - 1580 F4a 27317 COMMONWEALTH RD 800 - 1580 F4g 27317 COMMONWEALTH RD 800 - 1123 F4k 27317 COMMONWEALTH ST 100 - 219 F5e 27317 COMMONWEALTH ST 10 - 109 F5i 27317 CONCORD CHURCH RD 5900 - 6038 C7 27316 CONE ESTATES ST 548 - 600 F5m 27317 CONELSON RD 5500 - 6099 B1 27239 CONFERENCE CENTER DR 1900 - 2489 E3b 27350 COOK COLLIER RD 5200 - 5467 H8 27298 COOK COLLIER RD 5200 - 5467 G8a 27298 COOK COLLIER RD EXT 5969 - 6000 G8a 27298 COOL SHADE DR 2065 - 2100 E4e 27350 COOL SPRING ST 700 - 836 D5i 27203 COOL SPRINGS CHURCH RD 2700 - 2853 F6 27248 COOL SPRINGS CHURCH RD EXT 3812 - 3960 F6 27248 COOLERS KNOB TRL 1200 - 1292 E4a 27205 COOPER FARM RD 1100 - 1342 F4a 27350 COOPER FARM RD 1100 - 1342 F4c 27350 COOPER RD 622 - 795 C5c 27205 COOPER ST 200 - 554 D4p 27203 COOPER ST 500 - 601 F8t 27355 COPPERHEAD RD 1252 - 1400 C5f 27205 COPPLES RD 100 - 247 B5c 27205 COPPLES RD EXT 250 - 337 B5c 27205 CORDIE DR 2544 - 2600 C6a 27205 CORINA CIR 3100 - 3118 H2j 27263 CORINA CIR 3100 - 3210 H2n 27263 CORNELL ST 1000 - 1121 E5n 27203 CORPORATION DR 1204 - 1303 H2i 27263 CORPORATION DR 1100 - 1208 H2m 27263 CORTEZ RD 1250 - 1582 C4e 27205 CORVETTE AVE 1220 - 1437 C5 27205 CORWITH ST 600 - 853 D4g 27205 COTTAGE CT 101 - 103 H3q 27263 COTTAGE LN 4700 - 4787 G3m 27370 COTTON RD 5330 - 5400 H2s 27370 COTTON RD 5330 - 5400 G2g 27370 COTTONWOOD DR 400 - 448 E7d 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-24 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP COUNTRY ACRES DR 448 - 690 F4d 27317 COUNTRY CLUB DR 100 - 630 D4p 27205 COUNTRY CT 4901 - 4915 H3q 27263 COUNTRY DREAM LN 5500 - 5585 H2q 27263 COUNTRY ESTATES DR 3800 - 4001 D6b 27248 COUNTRY ESTATES DR EXT 300 - 321 D6b 27248 COUNTRY FARM RD 5300 - 5635 B8 27208 COUNTRY LN 5000 - 5199 H3q 27263 COUNTRY LN 5100 - 5199 G3e 27263 COUNTRY LN 2200 - 2400 E4o 27205 COUNTRY LOOP RD 6000 - 7138 B8 27208 COUNTRY MEADOWS LN 6797 - 6900 G1o 27370 COUNTRY PLACE RD 800 - 1046 E5r 27203 COUNTRY PLACE RD 1003 - 1109 E5n 27203 COUNTRY RIDGE RD 4400 - 4462 G7 27298 COUNTRY TRL 2000 - 2076 D3d 27205 COUNTRYSIDE ACRES DR 194 - 406 B4b 27205 COUNTRYSIDE CT 3035 - 3083 B4b 27205 COUNTY LAND RD 1100 - 1688 E5k 27317 COUNTY LAND RD 1100 - 1688 E5d 27317 COUNTY LINE RD 4100 - 4330 G1j 27360 COURTLAND CIR 3500 - 3914 F1g 27360 COURTLAND DR 6879 - 7100 F1g 27360 COURTLAND DR 6942 - 7100 F1f 27360 COURTLAND LN 100 - 1009 H3q 27263 COURTNEY LN 7100 - 7204 G1j 27360 COURTNEY LN 7100 - 7204 G1k 27360 COVENANT MOUNTAIN RD 1500 - 1600 D5j 27203 COVENTRY PL 600 - 666 D5f 27203 COVERED BRIDGE RD 4990 - 6101 E2a 27370 COVERED BRIDGE RD 4800 - 5227 E2b 27370 COWARD PICKARD LN 6800 - 7001 G8k 27298 COX AVE 500 - 570 D4p 27205 COX AVE 500 - 570 D5m 27205 COX BROTHERS RD 1400 - 1897 D6d 27205 COX LN 5200 - 5436 G8b 27298 COX MEADOW RD 1726 - 2019 F8c 27355 COX MEADOW RD 1700 - 2019 F8s 27355 COX MILL RD 2500 - 3801 A4 27205 COX MILL RD 3000 - 3801 A3 27205 COX ST 555 - 563 E7r 27316 COX VIEW DR 1800 - 1847 H4q 27317 COXEMOOR PL 1800 - 1841 D5q 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-25 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP COY STELLA TRL 100 - 286 C4o 27205 CRACKLIN DR 222 - 241 E5q 27203 CRACKLING WOODS LN 5022 - 5100 G6c 27317 CRAIG DR 100 - 115 H2o 27263 CRAIG DR 100 - 115 H2s 27263 CRAIG ST 700 - 791 D5b 27205 CRANBROOK CIR 1100 - 1170 D4n 27205 CRANBROOK CIR 1000 - 1170 D4r 27205 CRANBROOK WAY 1000 - 1116 D4n 27205 CRANFORD ST 100 - 111 F5i 27317 CRANFORD ST 100 - 177 D4l 27203 CRASTON DR 6055 - 6100 A5 27341 CRAVEN BRANCH RD 3109 - 3708 C7 27316 CRAVEN BRANCH RD 3260 - 3708 C8 27344 CRAVEN DR 400 - 476 D5e 27203 CRAVEN LN 1700 - 1854 C3b 27205 CRAVEN LN 1700 - 1747 C4i 27205 CRAVEN PINES RD 4000 - 4512 F2b 27350 CRAVEN PINES RD 4000 - 4308 F3a 27350 CRAVEN ST 2000 - 2021 E7q 27316 CRAVEN ST 2000 - 2007 E7r 27316 CRAVEN ST 100 - 137 E6p 27248 CRAVENS NEST DR 1800 - 1846 E6a 27248 CRAY DR 5200 - 5238 G3k 27263 CRAY DR EXT 2900 - 2938 G3k 27263 CREEK DR 4400 - 4446 G3r 27350 CREEK HILLS DR 6796 - 6900 D1 27370 CREEKRIDGE CTRY RD 3112 - 3948 F5b 27317 CREEKRIDGE CTRY RD 3410 - 3948 F5j 27317 CREEKRIDGE CTRY RD 3499 - 4059 F5f 27317 CREEKRIDGE CTRY RD 3112 - 3403 F5o 27317 CREEKRIDGE DR 2900 - 3172 C3a 27205 CREEKSIDE DR 265 - 284 E4l 27203 CREEKSIDE DR 149 - 292 E5i 27203 CREEKSIDE DR 1396 - 1535 G5b 27317 CREEKVIEW DR 4000 - 4349 G3m 27370 CREEKVIEW DR 3800 - 4061 G3n 27370 CREEKWAY RDG 2354 - 2600 D6a 27205 CREEKWOOD DR 5200 - 5226 G3e 27263 CREEKWOOD DR 1602 - 1914 E6a 27248 CREEKWOOD RD 3800 - 3925 C7 27344 CRESCENT DR 300 - 417 H2p 27263 CRESCENT DR 403 - 417 H3m 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-26 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP CRESENT AVE 4000 - 4087 G1l 27370 CRESENT AVE 3800 - 4087 G1p 27370 CRESENT DR 100 - 318 D5f 27203 CRESENT DR 100 - 318 D5g 27203 CRESENT DR 100 - 318 D5j 27203 CRESENT DR 100 - 318 D5k 27203 CRESTVIEW CHURCH RD 100 - 772 C4l 27205 CRESTVIEW CHURCH RD 600 - 1236 C5e 27205 CRESTVIEW CHURCH RD 600 - 772 C4h 27205 CRESTVIEW ST 200 - 229 D4k 27205 CRESTWICK RD 100 - 703 E7o 27316 CRESTWICK RD 600 - 906 E7n 27316 CRESTWOOD CTRY CT 3500 - 3568 G3j 27370 CRESTWOOD DR 5400 - 5571 G3f 27263 CRESTWOOD LN 1300 - 1427 D5k 27205 CRISTY CIR 2685 - 2900 D6f 27205 CROATAN TRAIL RD 2500 - 2603 G6a 27313 CROATAN TRL EXT 5755 - 5800 G6a 27313 CROOKED CREEK RD 4019 - 4500 G6d 27233 CROOKED STREAM LN 6806 - 6900 G1s 27360 CROOMCREST RD 200 - 378 C4h 27205 CROSS CREEK RD 4000 - 4539 C2 27205 CROSS LN 1800 - 2001 F5b 27248 CROSS LN 1800 - 2001 F6 27248 CROSS ST 500 - 864 D5e 27203 CROSS ST 300 - 822 D5i 27203 CROTTS DR 5029 - 5100 H1s 27263 CROTTS EDWARDS DR 3282 - 3400 F3c 27350 CROW CREEK RD 6600 - 6878 A1 27239 CROW CREEK RD EXT 6900 - 7036 A1 27239 CROWFLIGHT RD 7312 - 7312 H8 27298 CROWNE PARK AVE 200 - 300 D5e 27203 CRUTCHFIELD CTRY RD 6503 - 6800 F8a 27298 CRUTCHFIELD CTRY RD 6503 - 6800 F8b 27298 CRUTCHFIELD FARM RD 4500 - 4655 H7c 27298 CRYSTAL WOOD RD 497 - 700 D5d 27205 CUMBY RD 5141 - 5300 G2g 27370 CURRY DR 806 - 899 D4s 27205 CURTIS INDUSTRIAL DR 4897 - 5000 G8a 27298 CURTIS LN 3600 - 4032 G7 27355 CURTIS POWERS RD 7804 - 8629 A8 27208 CURTIS SMITH CIR 3600 - 3650 H6t 27233 CURTIS SMITH CIR 3600 - 3650 G6b 27233 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-27 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP CURTIS ST 370 - 393 E7r 27316 CYPRESS DR 600 - 647 D5m 27205 CYPRESS LN 5323 - 5500 G6b 27233 DAIRY BREEZE DR 3563 - 3689 F4d 27317 DAIRY ST 900 - 933 D4o 27203 DAISY RD 500 - 614 D5e 27203 DAISY RD 500 - 614 D5i 27203 DALE ST 500 - 520 H2o 27263 DANIEL PAUL DR 100 - 518 H2m 27263 DANIEL RD 600 - 706 D5d 27205 DANIELS CIR 5800 - 5848 H2q 27263 DANIELS ST 100 - 251 F5e 27317 DANNY BELL RD 1400 - 2869 C4i 27205 DANNY BELL RD 1400 - 1700 C4j 27205 DANNY BELL RD 2225 - 2869 C3b 27205 DANNY BELL RD 2225 - 2869 C3d 27205 DANNY BELL RD 1800 - 2224 C4e 27205 DANWOOD ST 700 - 930 D4k 27205 DARR RD 5258 - 5400 H2s 27370 DARR RD 4978 - 5300 G2g 27370 DARR RD EXT 4715 - 4900 G2g 27370 DASHWOOD DR 5616 - 5696 G5b 27313 DAVES MTN CT 1000 - 1082 D4g 27205 DAVID ALLRED DR 4072 - 4200 G6c 27233 DAVID ALLRED DR 4072 - 4200 F6 27233 DAVID LN 1900 - 1950 E5d 27317 DAVID LN 1900 - 1950 E6m 27317 DAVID ST 3800 - 3914 H2o 27263 DAVIDSON CTRY LN 2190 - 2303 E4o 27205 DAVIDSON RD 2194 - 2400 E4o 27205 DAVIDSON RD 2326 - 2400 E4k 27205 DAVIDSON RD EXT 2012 - 2100 E4o 27205 DAVIDSON ST 300 - 499 H2p 27263 DAVIDSON ST 400 - 510 H2o 27263 DAVIS ACRES TRL 1400 - 1510 G4a 27317 DAVIS CTRY RD 5924 - 7420 G4a 27317 DAVIS CTRY RD 5837 - 5921 G4b 27317 DAVIS CTRY RD 5518 - 5921 G4d 27317 DAVIS CTRY RD 5924 - 6375 G4b 27317 DAVIS ESTATES ST 4300 - 4346 G3s 27350 DAVIS FARM TRL 1476 - 1600 G4a 27317 DAVIS NELSON LN 3400 - 3539 F3a 27350 DAVIS ST 100 - 721 F4l 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-28 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP DAVIS ST 100 - 153 D4l 27203 DAWN ACRES DR 6800 - 6854 G1o 27370 DAWN DR 5300 - 5381 G3j 27263 DAWNWOOD DR 4400 - 4440 G1l 27370 DAWNWOOD DR 4100 - 4311 G1l 27370 DAWSON MILLER RD 100 - 887 C4s 27205 DAWSON MILLER RD 687 - 887 C4c 27205 DAWSON ST 3800 - 3855 E6t 27316 DEAD END LN 1000 - 1193 E8 27355 DEAN DR 400 - 522 H2j 27263 DEAN DR 400 - 410 H2n 27263 DEAN VIEW DR 1800 - 1925 H4q 27317 DEATON CIR 300 - 767 G8s 27298 DEATON LANGLEY DR 6800 - 6850 F8b 27298 DEATON RD 4647 - 6015 G2l 27370 DEATON RD 4600 - 4865 G2k 27370 DEATON RD 5020 - 5029 G2h 27370 DEBRA DR 1400 - 1459 F8c 27298 DEEP RIVER CHURCH RD 2895 - 4113 C7 27316 DEER FOREST LN 6708 - 6900 A2 27239 DEER RIDGE RD 2400 - 2518 C3c 27205 DEER RIDGE RD 2377 - 2423 C3a 27205 DEER RUN LN 2200 - 2231 C5c 27205 DEER TRACK RD 800 - 962 D3a 27205 DEER TRAIL DR 5686 - 6300 A2 27239 DEER TRAIL DR 5987 - 6300 A1 27239 DEERBERRY CT 317 - 400 D6e 27205 DEERFIELD CTRY RD 100 - 468 H5c 27317 DEERFIELD PL 101 - 110 H3q 27263 DEERHORN CT 2624 - 2700 C3a 27205 DEERHORN CT 2624 - 2700 C3b 27205 DEERRUN DR 1110 - 1498 F5d 27317 DEERWOOD LN 4569 - 4800 G2l 27370 DELBERT LN 3100 - 3143 C8 27344 DELLWOOD AVE 500 - 646 D5m 27203 DELLWOOD ST 200 - 309 H2p 27263 DELLWOOD ST 100 - 205 H2t 27263 DELTA CT 101 - 104 H2p 27263 DELTA DR 900 - 994 F5b 27317 DELTA DR 900 - 994 F5j 27317 DELWOOD DR 5300 - 5443 G3j 27263 DENISE DR 4800 - 4929 G3n 27370 DENNIS ST 1800 - 1940 D4s 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-29 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP DENNY DR 2000 - 2127 F5d 27248 DEPOT ST 100 - 498 E6o 27248 DEPOT ST 100 - 410 F5i 27317 DEPOT ST 800 - 810 E7r 27316 DEPOT ST EXT 600 - 657 E6o 27248 DERBY WAY 6341 - 6500 G1o 27370 DESTIN DR 2700 - 2759 F1b 27370 DEVIE CANOY DR 2547 - 2800 F3c 27350 DEVINEY KIRKMAN DR 4084 - 4200 G7 27298 DEVINEY RD 5800 - 5929 H7c 27283 DEWEY RD 100 - 269 E6q 27203 DEWEY RD 100 - 269 D6e 27203 DEWITT COLTRANE DR 5700 - 5793 G3b 27263 DEWITT CTRY LN 6770 - 6900 A8 27208 DINAH RD 100 - 191 C4o 27205 DINAH RD EXT 200 - 219 C4o 27205 DIXIE PL 1216 - 1300 H1k 27260 DIXON AVE 801 - 851 D4k 27203 DIXON AVE 600 - 803 D4l 27203 DIXON ST 2203 - 2226 E7q 27316 DIXON ST 2195 - 2220 D7e 27316 DIXON ST 100 - 147 D4l 27203 DIXON TILLEY RD 217 - 300 E7n 27316 DIXON TILLEY RD 217 - 300 E7o 27316 DOC HAYWORTH RD 5000 - 5655 C7 27316 DOE RUN TRL 7500 - 7867 F8p 27355 DOGWOOD BLOSSOM CT 6900 - 6951 H1o 27360 DOGWOOD CIR 7156 - 7200 F1f 27360 DOGWOOD CIR 7156 - 7200 F1g 27360 DOGWOOD DR 200 - 383 F5m 27317 DOGWOOD DR 400 - 531 G8o 27298 DOGWOOD HEIGHTS LN 4884 - 5000 G2f 27370 DOGWOOD LN 1001 - 1218 H3m 27263 DOGWOOD ST 1159 - 1300 D5n 27205 DOGWOOD TRL 5000 - 5182 E2b 27205 DOGWOOD WAY 3148 - 3200 F8a 27355 DON AVE 100 - 305 H2s 27370 DON AVE 100 - 110 H2t 27370 DONNA RD 200 - 310 C4o 27205 DONNA RD 200 - 310 C4p 27205 DONNA VIEW DR 3620 - 3667 G3e 27263 DONNA VIEW DR 3600 - 3667 G3f 27263 DONNYBROOK RD 1100 - 1206 H4c 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-30 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP DONNYBROOK RD 1100 - 1206 H4d 27317 DOOLEY DR 400 - 447 E5e 27203 DORIS ACRES ST 3207 - 3300 C6a 27205 DORSETT ST 200 - 211 H2k 27263 DOT DR 100 - 324 C4g 27205 DOT DR 100 - 324 C4h 27205 DOTTIE COX DR 2300 - 2452 H6c 27313 DOTTIE COX DR 2300 - 2452 G6a 27313 DOUGLAS DR 4100 - 4145 F7 27248 DOUL MTN RD 2139 - 2500 C3b 27205 DOUL MTN RD 2139 - 2500 C3d 27205 DOVE MEADOWS DR 100 - 213 H3m 27263 DOVE MEADOWS DR 100 - 152 H3q 27263 DOVE VIEW ST 3600 - 3811 E6t 27316 DOVER RD EXT 2256 - 2300 F5d 27317 DOVER ST 1932 - 1965 E5i 27203 DOVER ST 1932 - 1965 E5m 27203 DRAGONFLY LN 1600 - 1734 C4l 27205 DRAKE CT 4900 - 4920 G5n 27317 DRAPER ST 900 - 929 E5m 27203 DRAPER ST 900 - 1142 E5n 27203 DRIFTWOOD DR 5400 - 5779 G3f 27263 DRUM ST 100 - 213 B4b 27205 DUBLIN RD 222 - 629 D5i 27203 DUBLIN RD 600 - 950 D5m 27203 DUBLIN RD EXT 171 - 200 D5m 27203 DUBLIN SQUARE RD 100 - 199 D5i 27203 DUCKWORTH COX RD 187 - 303 E7m 27316 DUMONT ST 2200 - 2221 E5k 27203 DUNBAR BRIDGE RD 3900 - 4799 C2 27205 DUNBAR ST 500 - 716 D5e 27203 DUNCAN FARM RD 6662 - 6800 F8a 27298 DUNCAN FARM RD 6662 - 6800 F8b 27298 DUNDEE ST 100 - 280 D4o 27205 DUNLAP ST 200 - 433 D5i 27203 DUNWOODY CT 224 - 248 E4l 27203 DUSTY PATH DR 800 - 1001 C5i 27205 DUSTY ROCK DR 3100 - 3333 G1s 27360 DUSTY TRAIL RD 6515 - 6819 A8 27208 DWIGHT ST 5900 - 5958 G2e 27370 DYLAN LN 2800 - 2930 F3a 27350 DYLAN LN 2800 - 2930 F3c 27350 DYLAN SCOTT DR 101 - 118 H2m 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-31 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP DYNASTY DR 576 - 700 E3c 27205 E ACADEMY ST 100 - 415 F5i 27317 E ACADEMY ST 100 - 243 D4l 27203 E ALLRED ST 100 - 1256 E5q 27203 E ALLRED ST 1200 - 1660 E5r 27203 E BAILEY ST 100 - 325 E5m 27203 E BALFOUR AVE 100 - 513 E5m 27203 E BEASLEY ST 100 - 301 E5m 27203 E BROOKWOOD AVE 100 - 446 G8o 27298 E BROWER AVE 110 - 226 G8o 27298 E BROWER AVE 353 - 385 G8s 27298 E BROWN ST 100 - 620 F5i 27317 E BROWN ST 500 - 620 F5j 27317 E BUTLER AVE 100 - 1044 G8k 27298 E CENTRAL AVE 100 - 417 E5i 27203 E CENTRAL AVE 400 - 615 E5m 27203 E CHAMBERLIN DR 900 - 1100 D4a 27205 E DAMERON AVE 121 - 616 G8s 27298 E DIXIE DR 1135 - 1712 D5j 27203 E DIXIE DR 500 - 1339 D5m 27203 E DIXIE DR 1135 - 1339 D5n 27203 E DIXIE DR 100 - 569 D4p 27203 E DORSETT AVE 400 - 438 D4p 27203 E DORSETT AVE 100 - 319 D4p 27203 E DORSETT AVE 446 - 573 D4p 27203 E DORSETT AVE 446 - 573 D5m 27203 E FRANKLINVILLE ST 100 - 489 F8p 27355 E FRAZIER AVE 100 - 438 G8s 27298 E GRAHAM AVE 600 - 638 G8o 27298 E GRANDVIEW AVE 400 - 536 G8s 27298 E HIGH AVE 100 - 120 G8s 27298 E HIGHFILL AVE 100 - 575 G8o 27298 E JONES ST 2200 - 2203 E7q 27316 E JONES ST 2200 - 2203 D7e 27316 E KIME AVE 100 - 708 G8s 27298 E KING AVE 101 - 287 A5j 27341 E KIVETT ST 404 - 640 D5i 27203 E KIVETT ST 100 - 432 D4l 27203 E LOWE AVE 100 - 353 G8s 27298 E LUTHER AVE 100 - 418 G8o 27298 E MAIN ST 100 - 617 E6p 27248 E MAIN ST 100 - 435 A5j 27341 E MAIN ST 400 - 828 A5k 27341 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-32 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP E MAIN ST 100 - 249 E6o 27248 E MILLER ST 100 - 123 D4h 27203 E MINE ST 1100 - 1249 D4s 27205 E MOFFITT AVE 100 - 126 G8o 27298 E NAOMI ST 100 - 930 F5i 27317 E NAOMI ST 850 - 1016 F5f 27317 E NAOMI ST 850 - 930 F5j 27317 E NEWBERRY AVE 100 - 143 G8o 27298 E PATTERSON AVE 500 - 630 G8s 27298 E PRESNELL ST 200 - 1149 D5e 27203 E PRESNELL ST 100 - 239 D4h 27203 E PRESNELL ST 949 - 2062 D5f 27203 E PRESNELL ST 1400 - 2096 D5g 27203 E PRITCHARD ST 100 - 241 D4h 27203 E PRITCHARD ST 200 - 846 D5e 27203 E RALEIGH AVE 100 - 621 G8o 27298 E RALEIGH AVE 600 - 621 G8s 27298 E RIDGE AVE 400 - 574 G8s 27298 E RIDGE ST 338 - 351 E7r 27316 E RIVER DR 100 - 139 F5e 27317 E RIVER RUN 1130 - 1200 E4c 27205 E RIVER RUN EXT 1033 - 1120 E4c 27205 E SALISBURY ST 300 - 1365 D5i 27203 E SALISBURY ST 1300 - 1853 D5j 27203 E SALISBURY ST 100 - 349 D4l 27203 E STARMOUNT AVE 100 - 647 G8o 27298 E STRIDER ST 100 - 218 E5m 27203 E SUNRISE AVE 1410 - 1482 G1g 27360 E SUNRISE AVE 1379 - 1482 G1k 27360 E SUNRISE AVE 1300 - 1378 G1f 27360 E SUNRISE AVE 1351 - 1409 G1j 27360 E TAFT AVE 100 - 149 D4p 27203 E TEAGUE AVE 237 - 731 G8s 27298 E WAINMAN AVE 100 - 250 D4l 27203 E WALKER AVE 100 - 250 D4p 27203 E WARD ST 100 - 363 D4l 27203 E WARD ST 300 - 363 D5i 27203 E WHITE DR 108 - 139 H2o 27263 EAGLE CHASE RD 4200 - 4312 A2 27205 EAGLE CHASE RD 4200 - 5044 A3 27205 EAGLE LANDING DR 6325 - 6600 F1b 27370 EAGLE LANDING DR 6533 - 6600 F1g 27370 EAGLE NEST CT 2700 - 2790 F1b 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-33 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP EAGLE OAKS LN 1200 - 1270 C5f 27205 EAGLE PASS RD 2329 - 2400 C5c 27205 EAGLE POINT DR 2700 - 2938 F1b 27370 EAGLES FIELD RD 4400 - 5044 A2 27205 EARL BROWN RD 2764 - 3100 C6b 27205 EARL BROWN RD 2918 - 3100 C6d 27205 EARL JOHNSON RD 1400 - 1774 G4c 27350 EARL JOHNSON RD 1400 - 1774 G4d 27350 EARL TRL 5788 - 6000 H7c 27283 EARNHARDT RD 3100 - 4427 E3a 27205 EARNHARDT RD 4153 - 4599 E2b 27205 EARNHARDT RD 3100 - 3409 F3c 27350 EASEMENT DR 5632 - 5700 F2a 27370 EAST AVE 100 - 280 A5j 27341 EAST BEND ST 100 - 419 E6p 27248 EAST BEND ST 100 - 139 E6o 27248 EAST DR 100 - 334 B5a 27205 EAST FORK DR 2400 - 2839 A6 27341 EAST ST 100 - 166 D4k 27203 EAST ST 100 - 111 F5i 27317 EASTERN RANDOLPH RD 100 - 767 E7l 27316 EASTERN RANDOLPH RD 100 - 392 E7d 27316 EASTON EXT 300 - 322 D4r 27205 EASTVIEW DR 700 - 1119 D5e 27203 EASTVIEW LN 5200 - 5253 D7b 27316 EASTWARD AVE 3600 - 3669 H1k 27260 EASTWARD AVE EXT 3500 - 3532 H1k 27260 EASTWIND DR 101 - 199 H2p 27263 EASTWOOD DR 500 - 652 D5n 27205 EBB SHORE DR 2900 - 3147 H3o 27263 EBENEZER CHURCH RD 1981 - 2200 H3d 27263 EBENEZER CHURCH RD 1981 - 2200 H4q 27263 ECHO RDG 1300 - 1401 D2 27205 ECKERD ST 208 - 421 E5i 27203 ED DAVIS LN 1200 - 1276 G4b 27317 ED DAVIS LN 1200 - 1276 G4d 27317 EDEN FOREST DR 2660 - 2790 E4e 27350 EDEN TER 1000 - 1025 H2m 27263 EDEN TER 306 - 1025 H2n 27263 EDEN TER 306 - 414 H2o 27263 EDGAR RD 5400 - 5848 G3k 27263 EDGAR RD 4700 - 5289 G3o 27350 EDGAR RD 3402 - 4399 F3b 27350 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-34 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP EDGAR RD 4100 - 5143 G3s 27350 EDGAR VIEW DR 5218 - 5286 G3k 27263 EDGE CT 952 - 963 D5q 27205 EDGE FARM LN 4646 - 4700 G2d 27370 EDGEWOOD CT 101 - 106 H3q 27263 EDGEWOOD DR 408 - 543 G8k 27298 EDGEWOOD DR 6200 - 6244 G1l 27370 EDGEWOOD RD 500 - 875 D4g 27205 EDGEWOOD VIEW DR 100 - 160 A5f 27205 EDITH RUSSELL RD 100 - 153 F4h 27317 EDMONDS TRL 6400 - 6482 H4q 27263 EDNA ST 100 - 250 B5a 27205 EDNA ST 157 - 250 B4b 27205 EDWARD WALKER ST 5200 - 5281 G3k 27263 EDWARDS FARM RD 714 - 900 D7b 27316 EDWARDS ST 100 - 209 F8t 27355 EFFIE ST 357 - 400 G5n 27317 ELAINE ST 105 - 216 H2s 27370 ELAM AVE 300 - 322 E7r 27316 ELAM AVE 300 - 316 E7n 27316 ELBERT BRADY RD 4070 - 4100 C6b 27205 ELBERT DAVIS RD 7400 - 7517 A7 27341 ELDERBERRY CT 3000 - 3052 D6a 27205 ELDORADO RD 200 - 462 D4t 27205 ELEANOR ANNE LN 1200 - 1266 C4j 27205 ELEAZER CHURCH RD 7100 - 7635 A2 27371 ELIZABETH ST 142 - 200 E7q 27316 ELK HORN CT 101 - 107 H3q 27263 ELK RD 2951 - 3100 F5n 27317 ELKES PL 5400 - 5478 G3b 27263 ELLEN AVE 5000 - 5284 H1t 27263 ELLEN AVE 5000 - 5081 G1h 27263 ELLIOTT BROWN TRL 200 - 408 D6b 27248 ELLIOTT ST 500 - 521 H2n 27263 ELMER BEESON RD 5500 - 5753 G3b 27263 ELMONT ST 5100 - 5226 G3j 27263 ELMWOOD ST 4800 - 5198 G2f 27370 ELNORA DR 4494 - 4600 G7 27298 ELWOOD STOUT ST 200 - 283 D4o 27205 ELWORTH DR 570 - 600 E7k 27316 EMERALD CT 100 - 112 G3m 27370 EMERALD DR 4573 - 4800 F7 27298 EMERALD FARM RD 2707 - 3000 F6 27233 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-35 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP EMERALD ROCK RD 65 - 324 D3b 27205 EMERALD ROCK RD 65 - 324 D4a 27205 EMERALD ROCK RD 65 - 420 D4c 27205 EMERSON DR 600 - 713 D5m 27205 EMMANUEL CHURCH RD 100 - 333 B5c 27205 ENFIELD DR 3400 - 3531 G3j 27263 ENGLEWOOD DR 400 - 506 H2p 27263 ENGLEWOOD DR 100 - 417 H2o 27263 ENGLEWOOD DR 300 - 460 D4h 27203 ENGLISH CT 100 - 1124 G2h 27370 ENGLISH FARM RD 100 - 199 H2n 27370 ENGLISH PRIDE DR 7000 - 7234 G1n 27370 ENGLISH PRIDE DR 7000 - 7174 G1o 27370 ENGLISH ST 104 - 309 E5q 27203 ENTERPRISE ST 200 - 326 F8t 27355 ENTERPRISE ST 2216 - 2337 D4t 27205 ENZO LN 1825 - 1833 C5 27205 ERECT RD 6100 - 6386 B7 27341 ERECT RD 4812 - 5650 C7 27316 ERECT RD 7000 - 9885 A7 27341 ERICA DR 100 - 124 H3c 27263 ERIK DR 6600 - 6947 G1p 27370 ERMINE ST 2200 - 2384 F5d 27317 ERNEST RD 2786 - 2900 E6r 27203 ERVIN LN 1400 - 1461 D4c 27205 ESSEX SQ 1100 - 1312 H2o 27263 ESSEX TRL 5900 - 6059 G6a 27313 ETHAN CT 700 - 751 D4r 27205 ETHAN CT 700 - 751 D4s 27205 ETHAN SPRINGS RD 2211 - 2300 A4 27205 ETON AVE 1154 - 1279 E5q 27203 ETTA CT 4700 - 4743 G4c 27350 EUGENE ESTATE DR 2979 - 3179 G3s 27350 EUGENE ST 4276 - 4400 G3s 27350 EVANS CEDAR LN 5900 - 6280 G5a 27317 EVANS DR 5400 - 5530 E2a 27370 EVANS TRL 100 - 115 F4l 27317 EVANS TRL 100 - 115 F4p 27317 EVELYN DR 3709 - 4000 G2c 27370 EVELYN LN 6045 - 6200 H6c 27313 EVELYN LN 5902 - 6200 G6a 27313 EVELYN ST 3179 - 3300 F3b 27350 EVELYN VIEW DR 5600 - 5671 H2m 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-36 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP EVELYN VIEW DR 5600 - 5671 H2q 27263 EVENING SHADE RD 6100 - 6440 A3 27371 EVERGREEN CT 5400 - 5446 G6b 27233 EVERGREEN DR 3725 - 4127 G1p 27370 EVERGREEN DR 3500 - 4127 G1t 27370 EWINGS ST 5383 - 5500 H2r 27370 EXECUTIVE WAY 900 - 940 D5m 27203 EZRA DR 6000 - 6165 H5d 27313 EZRA DR 6000 - 6165 G5b 27313 FAIRFAX CT 481 - 497 D4h 27203 FAIRFIELD ST 100 - 109 D4h 27203 FAIRVIEW CHURCH RD 5752 - 6722 G2k 27370 FAIRVIEW CHURCH RD 6500 - 6934 G2g 27370 FAIRVIEW CHURCH RD 4600 - 5910 G2d 27370 FAIRVIEW CHURCH RD 4500 - 5182 G3m 27370 FAIRVIEW CT 4900 - 5016 G2k 27370 FAIRVIEW DR 4600 - 4773 G2k 27370 FAIRVIEW DR EXT 4900 - 5015 G2k 27370 FAIRVIEW FARM RD 2100 - 4499 C5 27205 FAIRVIEW FARM RD 2100 - 3131 C6a 27205 FAIRVIEW FARM RD 2800 - 3631 C6c 27205 FAIRVIEW FARM RD 4100 - 5137 B5 27205 FAIRVIEW LN 4500 - 4724 G2k 27370 FAIRWAY RD 1500 - 1815 D4p 27205 FAIRWAY RD 1700 - 1815 D4t 27205 FAIRWAY VIEW DR 4000 - 4193 F4l 27317 FAIRWOOD DR 4100 - 4302 G1l 27370 FAIRWOOD TRL 693 - 800 C4f 27205 FAIRWOOD TRL 693 - 800 C4g 27205 FAITH MEADOWS LN 1300 - 1437 C5j 27205 FAITH ROCK RD 100 - 1154 E6s 27248 FAITH ROCK RD 100 - 611 E6t 27248 FAITH ROCK RD 575 - 1154 E6o 27248 FAITH WAY TRL 1700 - 1795 E5b 27317 FALCON DR 6053 - 6200 H5d 27313 FALCON DR 6053 - 6200 G5b 27313 FALCON HILLS DR 300 - 352 D5k 27205 FALCON WAY 7077 - 7200 G1o 27370 FALLING OAK RD 2407 - 2641 C2 27205 FARLEY DR 6300 - 6436 H5c 27317 FARLEY DR 6200 - 6436 G5a 27317 FARLOW CORNER RD 100 - 252 A5 27341 FARLOW FARM RD 1800 - 1958 G4a 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-37 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP FARLOW LAKE CT 2000 - 2107 C5c 27205 FARLOW MEADOW RD 3400 - 3745 F3c 27350 FARLOW PINES DR 3202 - 3300 F3a 27350 FARLOW PINES DR 3202 - 3300 F3b 27350 FARLOW ST 5100 - 5241 H1t 27263 FARLOWE DAVIS DR 5100 - 5315 G3d 27350 FARMBROOK PL 7300 - 7515 G1r 27360 FARMCREEK DR 1006 - 1200 E6n 27248 FARMER CT 2900 - 3130 C2 27239 FARMER DENTON RD 4600 - 6006 C2 27239 FARMER DENTON RD 6500 - 7109 D1 27239 FARMER DENTON RD 5300 - 8191 C1 27239 FARMER RD 100 - 520 D4k 27203 FARMHOUSE RD 6900 - 7156 G8b 27298 FARMSTEAD RD 5528 - 5682 B6 27341 FARMSTEAD RD 5528 - 5682 B7 27341 FARMSTEAD RD 5000 - 5527 B6 27341 FARMSTEAD RD 5000 - 5527 B6b 27341 FARMWOOD LN 2200 - 2366 C3b 27205 FARR ST 600 - 735 D5e 27203 FAW DR 3255 - 3400 F3c 27350 FAWN DR 1473 - 1615 E4c 27205 FEATHERSTONE CT 2395 - 2500 F2d 27370 FELLOWSHIP RD 5878 - 6000 C7 27316 FERGUSON FARM LN 4967 - 5100 G6b 27298 FERGUSON RD 7600 - 8020 F8c 27298 FERGUSON RD 6500 - 8020 E7b 27298 FERGUSON RD 7600 - 8020 E8 27298 FERGUSON RD 5700 - 7003 E7a 27316 FERGUSON ST 300 - 320 F5i 27317 FERMER RD 800 - 935 D4o 27203 FERN DR 400 - 505 E5q 27203 FERNANDEZ LOOP 300 - 379 A5k 27341 FERNWOOD DR 3600 - 3646 G3f 27263 FERNWOOD FOREST RD 1700 - 1829 E4e 27350 FERRARI DR 1500 - 1701 C5 27205 FERREE ST 100 - 130 F5i 27317 FESMIRE ST 700 - 815 D5q 27205 FIDDLERS CREEK RD 1900 - 2348 B3 27205 FIELDCREST CT 3200 - 3327 D6b 27205 FIELDS COX RD 5400 - 5540 C7 27316 FIFTH PARK AVE 510 - 690 E5e 27317 FIFTH PARK AVE 600 - 736 E5f 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-38 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP FILLER RD 1423 - 1700 D6c 27205 FILLER RD EXT 1344 - 1422 D6c 27205 FINCH FARM RD 3517 - 5019 G1t 27370 FINCH FARM RD 3000 - 4238 F1b 27370 FINCH FARM RD 3000 - 4238 F2a 27370 FINCH FARM RD 5400 - 5940 G1k 27370 FINCH FARM RD 4580 - 5546 G1o 27370 FINCH FARM RD 1700 - 2910 F1 27370 FINCH FARM RD 2200 - 2910 F2c 27370 FINCH FARM RD 4580 - 5016 G1p 27370 FINCHLEY CT 1585 - 1670 E5n 27203 FIRE FIGHTER RD 5000 - 5218 C2 27239 FIRESIDE CT 473 - 500 D3b 27205 FIRST HEIGHTS DR 6600 - 6641 H1s 27263 FIRST PARK AVE 510 - 700 E5f 27317 FIRST ST 1400 - 1505 D4p 27205 FIRST ST 1700 - 1769 D4t 27205 FISHER CIR 800 - 951 D4o 27205 FLAKE BRILES RD 700 - 866 E1 27370 FLAT CREEK RD 6400 - 7538 B8 27208 FLAT CREEK RD 6500 - 7711 A8 27208 FLETA BROWN RD 1336 - 1678 D5d 27205 FLETA BROWN RD 1336 - 1678 D5r 27205 FLINCHUM FARM RD 4057 - 4200 F7 27298 FLINT HILL RD 5500 - 6927 F3c 27350 FLINT HILL RD 6835 - 7726 F3a 27350 FLINT ST 1718 - 1837 E5m 27203 FLIPPIN RD 6798 - 7000 B8 27208 FLORA MAE LN 4200 - 4302 G2d 27370 FLORIDA DR 100 - 220 G1f 27360 FLORIDA DR 200 - 220 G1g 27360 FLOYD DR 1208 - 1300 D4a 27205 FLOYD DR 1208 - 1300 D4n 27205 FLYNT RD 3000 - 3883 G8d 27298 FLYNT RD 3000 - 3883 F8b 27298 FOGGY MTN RD 902 - 1172 B4 27205 FOGGY MTN RD 800 - 1159 B4b 27205 FOGGY TOP RD 1200 - 1274 E5d 27317 FOGLEMAN LN 100 - 115 F5j 27317 FOLGER RD 4284 - 4514 H7c 27283 FOLWELL DR 5587 - 5700 G3b 27263 FOOTHILLS DR 1556 - 1612 C4p 27205 FOREST BROOK CIR 0 - 150 E5i 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-39 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP FOREST BROOK CIR 1 - 150 E4l 27203 FOREST DR 2679 - 3400 F5m 27317 FOREST DR 501 - 614 G8o 27298 FOREST EAST LN 500 - 672 E5e 27317 FOREST EAST LN 600 - 672 E5f 27317 FOREST ESTATES DR 3100 - 3177 F5n 27317 FOREST GROVE DR 5100 - 5202 F2a 27370 FOREST GROVE DR 5100 - 5202 F2b 27370 FOREST HAVEN DR 2096 - 2300 G6c 27233 FOREST HILLS DR 2100 - 2510 B3 27205 FOREST HILLS DR 2100 - 2309 B4 27205 FOREST LAKE DR 876 - 1132 E2b 27205 FOREST LAKE DR 876 - 1000 E2a 27205 FOREST LN 300 - 366 D3b 27205 FOREST MANOR DR 4100 - 4367 G1l 27370 FOREST OAKS DR 1100 - 1165 C4c 27205 FOREST PARK DR 2219 - 2947 E5e 27317 FOREST PARK DR 2979 - 3177 F4d 27317 FOREST PARK DR 2900 - 3177 F5q 27317 FOREST TRL 2400 - 2587 F3d 27350 FOREST VALLEY DR 600 - 681 D5d 27205 FORESTVIEW ST 300 - 349 E7m 27316 FORESTVIEW ST 300 - 349 E7q 27316 FORESTWOOD DR 401 - 511 H2p 27263 FORK CREEK MILL RD 4747 - 5121 A7 27341 FORK CREEK MILL RD 3200 - 4746 B6 27341 FORK CREEK MILL RD 1629 - 3402 A6 27341 FORK CREEK MILL RD 4400 - 5060 B7 27341 FORK CREEK MILL RD 600 - 1824 A5 27341 FOSTER ST 100 - 488 D4t 27205 FOSTER VIEW DR 1800 - 1937 H4q 27317 FOUNTAIN ST 3400 - 3412 H2o 27263 FOURTH PARK AVE 600 - 689 E5e 27317 FOURTH PARK AVE 600 - 689 E5f 27317 FOUSHEE RD 6100 - 6808 E8 27316 FOUSHEE RD 4955 - 6808 E7d 27316 FOUSHEE RD 1250 - 5135 E7r 27316 FOUSHEE ST 300 - 681 F8t 27355 FOUSHEE ST 100 - 334 F8p 27355 FOUST ACRES DR 4000 - 4027 G8o 27298 FOUST DR 400 - 471 B5a 27205 FOUST RD 2500 - 3585 F7 27355 FOUST ST 200 - 345 D4h 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-40 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP FOX CHASE DR 7300 - 7516 G1n 27370 FOX CHASE DR 7300 - 7454 G1o 27370 FOX CTRY RD 1000 - 1399 E5f 27317 FOX CTRY RD 1000 - 1399 E5b 27317 FOX DR 3547 - 3700 B4b 27205 FOX GROVE RD 5200 - 5272 E7o 27316 FOX HOLLOW LN 500 - 779 F5f 27317 FOX HUNT CT 2700 - 2731 F1g 27360 FOX MEADOW RD 3800 - 3886 G1p 27370 FOX RIDGE RD 2400 - 2656 C3d 27205 FOX RUN DR 3148 - 3500 D6c 27205 FOX RUN DR 3148 - 3500 D6d 27205 FOX RUN VIEW LN 100 - 387 E1 27370 FOX ST 100 - 325 F5e 27317 FOX ST 300 - 4454 F5f 27317 FOX ST 100 - 135 F5i 27317 FOXBORO CT 4100 - 4199 G2h 27370 FOXBURROW RD 1300 - 1388 B4 27205 FOXFIELD RD 1767 - 1900 E4a 27350 FOXFIELD RD 1767 - 1900 E4c 27350 FOXFIRE RD 900 - 1672 D6b 27205 FOXFIRE RD 1200 - 1984 D6d 27205 FOXFIRE RD 100 - 825 D6f 27205 FOXFIRE RD 700 - 1054 D6a 27205 FOXWOOD CT 200 - 209 F5f 27317 FOXWORTH RD 400 - 758 E5d 27203 FRANCES DR 400 - 600 G8j 27298 FRANCES DR 400 - 600 G8n 27298 FRANCIS ST 100 - 122 E5m 27203 FRANK LAMB DR 821 - 1000 B4 27205 FRANK LN 6000 - 6068 H6t 27233 FRANK RD 1900 - 2123 A4 27205 FRANK WHITE DR 5621 - 5700 G3f 27263 FRANKIE TRL 6100 - 6192 A4 27205 FRANKLIN DR 1213 - 1600 E5b 27317 FRANKLIN HILLS CT 1400 - 1593 F5d 27317 FRANKS ST 600 - 829 D5i 27203 FRANKTON CT 1500 - 1530 D4a 27205 FRAZIER CTRY DR 1200 - 1283 F4k 27350 FRAZIER MARSH RD 6500 - 6841 H3d 27263 FRAZIER RD 300 - 1035 E8 27316 FRAZIER RD 424 - 1035 D8 27316 FRAZIER ST 300 - 345 D4l 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-41 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP FRAZIER ST 114 - 220 H2o 27263 FRAZIER VIEW RD 600 - 773 G4b 27317 FRED EAST LN 5950 - 6100 H6c 27313 FRED EAST LN 5950 - 6100 G6a 27313 FRED FRANK TRL 4600 - 4712 G4c 27350 FRED LINEBERRY RD 4800 - 5812 G5d 27317 FRED LINEBERRY RD 5510 - 6233 G5b 27317 FRED LINEBERRY RD 4800 - 5334 G5n 27317 FRED LINEBERRY RD EXT 5001 - 5100 G5d 27317 FREEDOM DR 300 - 352 D4l 27203 FREEDOM STATE ST 1070 - 1200 C5j 27205 FREEDOM TRL 884 - 1056 C5i 27205 FREEMAN PL 100 - 299 H2o 27263 FREEMAN ST 100 - 120 F5i 27317 FREEMONT CT 1 - 16 G1g 27360 FREEMONT DR 200 - 425 G1g 27360 FREEMONT DR 192 - 209 G1f 27360 FRIENDLY ACRES RD 310 - 700 D4r 27205 FRIENDLY CIR 900 - 942 D4r 27205 FRIENDLY LN 4418 - 4500 E7m 27316 FRIENDLY LN 4435 - 4500 E7n 27316 FRIENDLY RD 200 - 215 D5i 27203 FRIENDS LN 101 - 107 H3q 27263 FRIENDSHIP LN 4444 - 4500 G2d 27370 FRIENDSHIP RD 4054 - 4200 B4 27205 FRITZ FARM RD 478 - 900 D2 27370 FRONTIER ST 600 - 699 H2s 27263 FRYE FARMS RD 2400 - 2554 E4k 27205 FRYE ST 5150 - 5300 G2h 27370 FULLER MILL RD N 2700 - 3614 F1b 27360 FULLER MILL RD N 3200 - 3936 F1j 27360 FULLER MILL RD N 1481 - 2851 F1 27360 FULLER MILL RD N 4421 - 4803 G1r 27360 FULLER MILL RD N 100 - 2276 E1 27370 FULLER MILL RD N 3615 - 4508 F1f 27360 FULLER MILL RD S 100 - 179 E1 27370 FULTON RD 3200 - 3411 B4 27205 FULTON RD 3200 - 3411 B4b 27205 GABLE ST 1569 - 1599 H1l 27260 GADDY CIR 335 - 400 E1 27360 GADDY DR 3400 - 3543 G1t 27370 GAITHER CT 2202 - 2205 H2i 27263 GALLIMORE DAIRY RD 1600 - 3380 D2 27239 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-42 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP GALLIMORE DAIRY RD 2403 - 3380 C2 27239 GALLIMORE DR 862 - 900 F5n 27317 GALLIMORE TOWN RD 5400 - 6308 E2c 27370 GALLOP WAY 101 - 108 H3q 27263 GALWAY PL 700 - 743 D5m 27203 GANT ST 2200 - 2227 E5j 27203 GANT ST 2200 - 2209 E5k 27203 GARDENGATE RD 4900 - 5097 E2d 27205 GARDINER RD 200 - 330 D5i 27203 GARNER FARM RD 800 - 1028 D3a 27205 GARNER LN 4300 - 4537 C1 27239 GARNER MASHBURN DR 253 - 308 A5 27341 GARNER ST 100 - 222 A5f 27341 GARRELL ST 3100 - 3512 H2n 27263 GARRELL ST 3100 - 3114 H2j 27263 GARREN TOWN RD 398 - 2526 D2 27205 GARREN TOWN RD 100 - 1730 E2d 27205 GARY MCMASTERS RD 5060 - 5192 F7 27298 GARYDALE DR 4104 - 4200 F4k 27350 GATE DR 6952 - 7200 F1f 27360 GATE DR 6952 - 7000 F1g 27360 GATEWOOD AVE 4000 - 4063 G3s 27350 GATEWOOD AVE 4000 - 4063 F3b 27350 GATLIN CTRY DR 7000 - 7062 A7 27341 GEARREN ST 115 - 178 D4a 27205 GEFFEN LN 586 - 700 C5c 27205 GEFFEN LN 586 - 700 B5a 27205 GEMSTONE CT 100 - 142 E6t 27248 GEMSTONE CT 100 - 142 D6b 27248 GENE ALLRED DR 1328 - 1400 F5d 27317 GENTRY ACRES RD 3700 - 3782 B5a 27205 GENTRY ACRES RD 3700 - 3782 B5c 27205 GEORGE CONNOR RD 849 - 900 E5j 27317 GEORGE YORK RD 1900 - 3177 F5d 27317 GEORGE YORK RD 2740 - 3212 F5o 27317 GEORGE YORK RD 1900 - 2408 E5b 27317 GEORGIA DR 6400 - 6528 H5c 27317 GEORGIA DR 6200 - 6528 G5a 27317 GERTRUDE DR 7600 - 7703 E8 27355 GERTRUDE LOOP RD 2900 - 3285 B6b 27341 GERTRUDE LOOP RD EXT 4672 - 4701 B6b 27341 GIANT OAKS CT 3200 - 3474 F3a 27350 GIBNEY MCCRACKEN TRL 1900 - 1957 E4e 27350 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-43 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP GILBERT DAVIS DR 5952 - 6100 G4a 27317 GILEAD DR 2687 - 2800 F2b 27350 GILEAD DR 2687 - 2800 F2d 27350 GILES CHAPEL RD 1120 - 1717 E5n 27203 GILES CHAPEL RD 1422 - 1782 E5d 27203 GILMORE DR 4500 - 4644 G7a 27298 GINGER CT 240 - 252 F5q 27317 GLADE RD 2300 - 2535 D3d 27205 GLEN CIR 512 - 520 E5i 27203 GLENDALE DR 3500 - 3516 H2p 27263 GLENDALE DR 600 - 676 D4s 27205 GLENN CTRY RD 1061 - 1400 D5d 27205 GLENN DR 200 - 280 D6e 27205 GLENN RICH LN 1000 - 1113 E6m 27317 GLENN SMITH DR 7000 - 7100 F8b 27298 GLENN ST 100 - 127 A5k 27341 GLENN WILLIAMS DR 100 - 179 G5c 27317 GLENNS WAY 100 - 156 F5f 27317 GLENNS WAY 100 - 156 F5j 27317 GLENNVILLE DR 5492 - 5600 G2j 27370 GLENOLA INDUSTRIAL DR 5250 - 5300 G3k 27263 GLENVIEW DR 4562 - 5400 G3j 27263 GLENWOOD RD 300 - 631 D5i 27203 GLENWOOD RD 600 - 1022 D5m 27203 GLENWOOD RD 1000 - 1022 D4p 27203 GLOVINIA ST 440 - 621 D5e 27203 GLOVINIA ST 300 - 559 D5i 27203 GLOWING WOOD TRL 2861 - 3000 D6f 27205 GLOWING WOOD TRL 2861 - 3000 D6b 27205 GODNICK LN 5563 - 5597 G3b 27263 GOLD HILL RD 319 - 1428 E5r 27203 GOLD HILL RD 1900 - 2049 E5j 27203 GOLD HILL RD 1300 - 2026 E5n 27203 GOLD HILL RD 200 - 1057 D5f 27203 GOLDA AVE 100 - 2155 E5i 27203 GOLDEN EAGLE DR 4100 - 4176 G3r 27350 GOLDEN LEAF LN 5842 - 5900 G4b 27317 GOLDEN LEAF LN 5842 - 5900 G4d 27317 GOLDEN MEADOW RD 3400 - 4423 D2 27205 GOLDEN MEADOW RD 3400 - 4149 D3c 27205 GOLDFIELD RD 6300 - 6434 F8c 27298 GOLDSTON RD 5190 - 5400 E7k 27316 GOOD LUCK RD 1615 - 1880 C4k 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-44 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP GOOD LUCK RD 1615 - 1880 C4o 27205 GOODMAN ST 300 - 720 H2o 27263 GOPHER WOODS RD 1400 - 1783 D3c 27205 GOSPEL CHAPEL DR 100 - 160 D6f 27205 GRA LAN DR 6900 - 7046 G1k 27360 GRACELAND DR 533 - 795 D5d 27205 GRACEWOOD RD 5116 - 5200 D7a 27316 GRADY WILLIAMS DR 2530 - 2620 C3a 27205 GRADY WILLIAMS DR 2530 - 2620 C3c 27205 GRAHAM DAVIS RD 8100 - 8332 A1 27239 GRAHAM DAVIS RD EXT 7940 - 8200 A1 27239 GRAHAM ST 100 - 183 F8p 27355 GRAHAM ST EXT 7100 - 7257 G8o 27298 GRAHAM ST EXT 7126 - 7257 G8d 27298 GRANGE HALL RD 3100 - 3612 C2 27205 GRANITE RDG 3200 - 3315 C3a 27205 GRANITE ROCK DR 4100 - 4366 D2 27239 GRANT TRL 2756 - 2800 E4g 27317 GRANTVILLE LN 700 - 1427 D6b 27248 GRANTVILLE LN 843 - 2902 D6d 27205 GRANTVILLE LN 2400 - 3778 C6a 27205 GRANTVILLE LN 2400 - 2902 C6b 27205 GRAPEVINE DR 6100 - 6163 H6t 27233 GRAVEL HILL RD 6000 - 7666 B1 27239 GRAVES CTRY RD 5001 - 5400 A5 27341 GRAVES THOMAS RD 5100 - 5196 E7o 27316 GRAY FARM RD 4600 - 5077 G4c 27350 GRAY FOX LN 2400 - 2537 F8p 27355 GRAY OWL RD 1600 - 2066 C3d 27205 GRAY ROCK RD N 100 - 507 E1 27370 GRAY ROCK RD S 100 - 432 E1 27370 GRAYS CHAPEL SCHOOL RD 0 - 0 F6 27248 GREEN ACRES DR 5721 - 5800 H2m 27263 GREEN FARM RD 800 - 1331 E3d 27205 GREEN GLADE RD 3200 - 3338 F3d 27350 GREEN LEAF LN 1900 - 2016 E6a 27248 GREEN MTN DR 1500 - 1543 C4l 27205 GREEN ST 100 - 235 A5j 27341 GREEN TREE RD 3000 - 3312 G1r 27360 GREEN VALLEY DR 4400 - 4484 G1H 27370 GREEN VALLEY RD 300 - 699 D5k 27205 GREENBROOK RD 2200 - 2388 F2a 27370 GREENBRUSH RD 300 - 455 D6f 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-45 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP GREENCASTLE RD 893 - 1000 D3d 27205 GREENCASTLE RD 893 - 1000 D4c 27205 GREENDALE RD 1722 - 2000 G4a 27263 GREENDALE RD EXT 1558 - 1710 G4a 27263 GREENE OAK RD 1280 - 1700 D3c 27205 GREENFIELD ST 600 - 667 D5e 27203 GREENFIELD ST 1354 - 1400 D7b 27316 GREENFOREST RD 100 - 203 G5c 27317 GREENHAVEN DR 138 - 155 H2p 27263 GREENHILL RD 100 - 231 E7q 27316 GREENHILL TRL 6200 - 6317 G4a 27317 GREENLAWN DR 310 - 517 E5i 27203 GREENLEAF ACRES DR 900 - 1083 D4r 27205 GREENLEAF ACRES DR 900 - 1083 C4f 27205 GREENMONT DR 800 - 1128 E4s 27205 GREENOAK DR 316 - 324 H2k 27263 GREENOAK DR 316 - 324 H2o 27263 GREENSBORO ST 320 - 446 D4l 27203 GREENSBORO ST 405 - 665 D4h 27203 GREENTREE CT 191 - 223 E4l 27203 GREENTREE CT 191 - 223 E5i 27203 GREENVALE RD 100 - 339 E4l 27203 GREENVALE RD 100 - 339 E5i 27203 GREENVIEW DR 700 - 961 B4b 27205 GREENVIEW DR 400 - 748 C4t 27205 GREENWAY DR 3800 - 3888 G1p 27370 GREENWOOD RD 1900 - 1945 E5m 27203 GREESON CTRY RD 3100 - 3442 H6d 27233 GREESON CTRY RD 3100 - 3753 H6t 27233 GREESON CTRY RD 3700 - 3753 G6b 27233 GREGG ST 300 - 401 G3e 27263 GREGG ST 200 - 311 H3q 27263 GREGORY CT 251 - 500 D3a 27205 GREGSON RD 1328 - 1800 H5d 27313 GREY DR 3600 - 3897 F3a 27350 GREY OAKS RD 5300 - 5399 H2s 27370 GREY RABBIT RUN 2576 - 2600 C3c 27205 GREYSTONE RD 800 - 1047 D5m 27203 GREYSTONE RD 800 - 881 D5i 27203 GRIFFIN DR 5997 - 6100 E8 27316 GROOM RD 1725 - 2000 F4c 27350 GROVE ST 5080 - 5276 G2g 27370 GUESS RD 100 - 233 E8 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-46 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP GUILFORD WAY 2672 - 2800 F6c 27248 GUM ST 100 - 270 F4d 27317 GUM ST 100 - 270 F5q 27317 GUM TREE RD 1800 - 1903 E4s 27205 GUMWOOD RD 2729 - 2900 G1r 27360 GUMWOOD RD 2729 - 2900 F1f 27360 GYPSY ROSE DR 5400 - 5580 H8 27298 HABITAT DR 3500 - 3753 G2c 27370 HABITAT DR EXT 3600 - 3750 G2c 27370 HACKETT LN 4015 - 4200 G6d 27233 HAITHCOCK RD 1209 - 1306 E6a 27248 HAITHCOCK RD 1209 - 1306 E6n 27248 HALIFAX ST 559 - 685 D5q 27205 HALL DR 300 - 375 D4t 27205 HALL RD 2707 - 3510 F6c 27248 HALTOM RD 100 - 356 E1 27292 HAMILTON DR 600 - 800 G8k 27298 HAMILTON DR 600 - 800 G8o 27298 HAMILTON ST 683 - 700 D4k 27205 HAMLIN ST 335 - 567 D4h 27203 HAMLIN ST 332 - 399 D4l 27203 HAMMER AVE 700 - 1039 D4p 27203 HAMMER AVE 400 - 818 D4l 27203 HAMMOND RD 3300 - 3543 F3c 27350 HAMMOND ST 101 - 211 F5e 27317 HAMMOND ST 200 - 211 F5f 27317 HAMPTON CT 1500 - 1540 D5k 27205 HAMPTON RD 100 - 250 D4h 27203 HANCOCK LN 520 - 524 F1 27360 HANCOCK ST 100 - 119 F5e 27317 HANCOCK ST 100 - 119 F5i 27317 HANDY RD 4745 - 4789 B1 27239 HANGAR RUN 3800 - 3887 G3q 27350 HANNAH DR 2000 - 2097 C3b 27205 HANNAH MAC RD 227 - 231 F8b 27355 HANNER CT 100 - 106 H3m 27263 HANNER HILL RD 900 - 1030 E3d 27205 HANNER RD 600 - 761 G4b 27317 HANNER RD EXT 780 - 813 G4b 27317 HAPPY HILLS DR 3100 - 3283 G8c 27355 HAPPY HILLS DR 3100 - 3283 F8a 27355 HAPPY HOLLOW RD 3000 - 4837 B5a 27205 HAPPY HOLLOW RD 4088 - 4837 B5c 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-47 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP HAPPY HOLLOW RD 3000 - 3193 B4b 27205 HAPPY LN 3374 - 3700 B5a 27205 HARDIN CT 500 - 514 G8o 27298 HARDIN ELLISON RD 3532 - 4260 F6 27248 HARDIN ELLISON RD 3532 - 4260 E6b 27248 HARDIN ELLISON RD 3532 - 4617 E7a 27248 HARDIN ST 5000 - 5004 G3e 27263 HARDINS FARM RD 3800 - 4282 F3a 27350 HARDINS FARM RD 4041 - 4282 G3r 27350 HARDWOOD TRL 2357 - 2400 D3b 27205 HARLOW DR 7146 - 9339 H3o 27263 HARLOW RD 7500 - 8079 H4q 27263 HARLOW RD 7825 - 8980 H3d 27263 HARLOW RD 7500 - 7728 G4a 27263 HARMONY TRL 3009 - 3100 D3b 27205 HAROLD MEADOW RD 5700 - 6069 H7c 27283 HAROLD MEADOW RD EXT 6070 - 6188 H7c 27283 HAROLD MEADOW RD EXT 6070 - 6188 H6t 27283 HARPER RD 1600 - 1745 E4s 27205 HARRIET ST 3700 - 3800 H2o 27263 HARRIS CT 2200 - 2229 F2d 27370 HARRIS FAMILY LN 4297 - 4500 C2 27205 HARRIS RD 943 - 1100 E2a 27370 HARRISON ST 301 - 321 D5i 27203 HARRISON TRL 1200 - 1347 F4k 27317 HARRISON TRL 1233 - 1347 F4g 27350 HARSHAW DR 700 - 810 F4d 27317 HARTSELL DR 3400 - 3513 G2c 27370 HARVELL RD 3400 - 3783 A3 27205 HARVELL ST 1700 - 2105 D4s 27205 HARVELL ST EXT 246 - 300 D4s 27205 HARVEST CIR 1100 - 1407 E5q 27203 HARVEST DR 3000 - 3131 G1r 27360 HARVEST VIEW DR 1600 - 1691 G5d 27317 HASTY ST 1440 - 1460 E5q 27203 HATTIE ST 300 - 309 H2o 27263 HAVENWOOD DR 100 - 405 H2n 27263 HAVENWOOD DR 100 - 106 H2o 27263 HAWK FARM RD 5537 - 5753 D7b 27316 HAWK NEST DR 1053 - 1220 E1 27292 HAWK WATCH RD 486 - 592 D5b 27205 HAWKSVIEW RD 1102 - 1926 G5d 27248 HAWKSVIEW RD 1605 - 1926 G6c 27248 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-48 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP HAWTHORNE CT 300 - 330 G5n 27317 HAWTHORNE DR 100 - 666 C4h 27205 HAYES DR 1000 - 1146 C4h 27205 HAYES FARM RD 5500 - 5738 B7 27341 HAYFIELD DR 2600 - 2773 C6a 27205 HAYSTACK LN 2957 - 3000 F7 27248 HAYWOOD RD 5409 - 5500 H2r 27370 HAYWORTH ST 300 - 315 H2k 27263 HAYWORTH ST 300 - 315 H2o 27263 HAZEL AVE 300 - 323 H2o 27263 HAZEL AVE 300 - 323 H2p 27263 HAZEL HULL LN 100 - 108 F4d 27317 HAZELWOOD LN 6090 - 6200 H3c 27263 HAZELWOOD ST 600 - 649 D5m 27205 HEADEN CTRY TRL 2800 - 3004 F7 27355 HEADEN CTRY TRL 2800 - 3004 F8a 27355 HEARTHSIDE DR 4600 - 4861 F2d 27370 HEARTHWOOD RD 2707 - 2900 F3c 27350 HEARTHWOOD RD 2657 - 2772 F3d 27350 HEARTLAND DR 6300 - 6388 H4q 27263 HEARTLEAF TRL 6884 - 7000 A1 27239 HEATH DAIRY RD 2900 - 4338 F4d 27317 HEATH DAIRY RD 2900 - 3616 E4a 27317 HEATH DAIRY RD 2900 - 3616 E4g 27317 HEATHER CT 500 - 515 D4h 27203 HEATHER DR 5650 - 5700 G4a 27317 HEATHER GLENN PL 640 - 700 E4s 27205 HEATHWOOD DR 6300 - 6549 G1l 27370 HEATHWOOD DR 6200 - 6337 G2i 27370 HEATHWOOD RD 1100 - 1153 E5j 27317 HEBLER LN 800 - 871 G5b 27317 HEDGEBERRY LN 4100 - 4270 G7a 27298 HEDGECOCK RD 1200 - 1352 H4c 27317 HEMLOCK DR 600 - 641 D5m 27205 HENLEY CTRY RD 132 - 1864 E5d 27203 HENLEY CTRY RD 132 - 1179 E5s 27203 HENLEY CTRY RD 132 - 873 D5g 27203 HENLEY CTRY RD 1562 - 2178 E5k 27317 HENLEY DR 1300 - 1596 D5d 27205 HENLEY DR 1300 - 1407 D5n 27205 HENRY DELK RD 5100 - 5401 D2 27239 HENRY PARRISH RD 300 - 549 D4a 27205 HENRY RD 200 - 327 D4n 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-49 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP HENSON RD 1804 - 1828 E4p 27203 HERITAGE CT 2030 - 2059 E5j 27203 HERITAGE DR 100 - 316 F4d 27317 HERITAGE DR 300 - 411 F5q 27317 HERITAGE LN 7300 - 7373 H4p 27317 HERITAGE MTN TRL 900 - 1129 F5r 27317 HERITAGE VIEW LN 2200 - 2473 F1b 27360 HERMAN HUSBAND RD 4000 - 4219 G7 27298 HERRINGTON CTRY RD 5000 - 5689 C7 27316 HICKORY CREEK TRL 500 - 546 D4s 27205 HICKORY DR 2535 - 3000 B5a 27205 HICKORY DR 2535 - 2800 C4t 27205 HICKORY DR 2535 - 2800 B4b 27205 HICKORY FOREST DR 2302 - 2437 E5e 27203 HICKORY FOREST DR 2302 - 2437 E5i 27203 HICKORY HILL DR 6700 - 6789 F1g 27370 HICKORY WAY 3146 - 3200 F8a 27355 HICKORY WOOD LN 1800 - 1846 G4a 27317 HICKS CTRY LN 2500 - 2641 F8a 27355 HICKS FARM RD 100 - 1222 E8 27355 HIDDEN CT 800 - 852 E2b 27205 HIDDEN LN 6800 - 6959 H5c 27313 HIDDEN LN EXT 7000 - 7066 H5c 27313 HIDDEN LN EXT 7000 - 7066 H5d 27313 HIDDEN SPRINGS RD 6420 - 6600 C1 27239 HIDEAWAY LN 6100 - 6300 F1b 27370 HIGH KNOB TRL 663 - 1000 A5 27341 HIGH KNOB TRL 663 - 1000 A5k 27341 HIGH MEADOW DR 2527 - 2700 C3d 27205 HIGH PINE CHURCH RD 6500 - 9923 B2 27205 HIGH PINE CHURCH RD 2500 - 6012 B3 27205 HIGH PINE CHURCH RD 5413 - 7628 A3 27205 HIGH PINE CHURCH RD 2500 - 3273 C4c 27205 HIGH PINE CHURCH RD 2500 - 3273 B4 27205 HIGH PINE CHURCH RD 9400 - 9923 B1 27239 HIGH PINE CHURCH RD 6500 - 7628 A2 27205 HIGH POINT ST 100 - 435 F5e 27317 HIGH POINT ST 404 - 1099 F4h 27317 HIGH POINT ST 950 - 1199 F4l 27317 HIGH POINT ST 1100 - 1199 F4k 27317 HIGHFILL ST 7080 - 7206 G8o 27298 HIGHFILL ST 7080 - 7206 G8d 27298 HIGHLAND CT 422 - 535 D4l 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-50 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP HIGHLAND ST 700 - 907 D4p 27203 HIGHLAND ST 600 - 717 D4l 27203 HIGHLANDS LN 3800 - 3924 C2 27205 HIGHRIDGE ST 700 - 832 D4k 27205 HIGHT ST 1400 - 1471 D5d 27205 HIGHTOWER DR 5200 - 5272 G5c 27317 HIGHWOOD DR 900 - 971 D4g 27205 HILL FARM RD 5500 - 5605 G3b 27263 HILL FARM RD 5500 - 5605 G3k 27263 HILL HARDISTER RD 5597 - 5700 A2 27371 HILL ST 100 - 197 A5j 27341 HILL ST 100 - 197 A5k 27341 HILL ST 312 - 451 D4l 27203 HILL TOP HOME RD 500 - 605 E6r 27248 HILLARY CT 400 - 637 C4l 27205 HILLBROOK DR 600 - 693 D4s 27205 HILLCREST CIR 800 - 843 D5m 27203 HILLCREST CT 3900 - 4076 G3q 27350 HILLCREST DR 400 - 516 F5i 27317 HILLCREST LN 4243 - 4300 G2d 27370 HILLCREST LN 133 - 200 H2o 27263 HILLIARD LN 4507 - 4540 G5c 27317 HILLIARY ST 100 - 111 F5i 27317 HILLSBORO ST 200 - 245 F8p 27355 HILLSDALE CT 3400 - 3614 E3c 27205 HILLSDALE DR 1071 - 1200 D5e 27203 HILLSDALE PARK DR 3834 - 4037 F3a 27350 HILLSIDE CT 101 - 107 H3q 27263 HILLSVILLE RD 8500 - 9196 G3q 27370 HILLSVILLE RD 7800 - 8552 F3a 27370 HILLTOP AVE 5100 - 5200 G2f 27370 HILLTOP CHURCH RD 636 - 714 C5e 27205 HILLTOP DR 3300 - 3509 H3c 27263 HILLVIEW CT 4100 - 4139 G3q 27370 HILLVIEW ST 400 - 440 D4g 27205 HILTON TRL 3460 - 3500 C6d 27205 HINESLEY RD 500 - 543 A5k 27341 HINSHAW CTRY RD 3300 - 3915 G8s 27298 HINSHAW CTRY RD 3300 - 3509 F8b 27298 HINSHAW FARM RD 3000 - 3464 G6b 27233 HINSHAW ST 400 - 521 F5i 27317 HINSHAW ST 1600 - 1623 E5m 27203 HINSHAW TOWN RD 6800 - 7122 D7 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-51 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP HINSHAW TOWN RD 4800 - 6976 C7 27316 HINSHAW TOWN RD 4300 - 4733 C6b 27316 HINSHAW TOWN RD 4200 - 4522 C6d 27205 HOCKETT CTRY LN 6600 - 6865 H5d 27313 HOCKETT DAIRY RD 100 - 1403 H4d 27317 HOCKETT DAIRY RD 1200 - 1403 H4c 27317 HOCKETT TRL 6400 - 6778 H4d 27317 HOCKETT TRL 6400 - 6778 G4b 27317 HODGE RD 1000 - 1355 F5o 27317 HOFFMAN ST 3600 - 3646 F3a 27350 HOG SLIDE RD 2800 - 3199 G3o 27350 HOG SLIDE RD 2800 - 3199 G3d 27350 HOGAN FARM TRL 6705 - 7118 A1 27239 HOHN DAVIS RD 1700 - 2085 G4a 27263 HOHN RD 2300 - 2448 H3d 27263 HOLDER FARM RD 3979 - 4400 G7 27298 HOLDER INMAN RD 300 - 661 G4b 27317 HOLDER INMAN RD 100 - 513 G5a 27317 HOLDER INMAN RD EXT 6400 - 6604 G4b 27317 HOLDER ST 200 - 250 F4h 27317 HOLDER ST 100 - 220 F4l 27317 HOLLAND ST 2001 - 2037 E5i 27203 HOLLINGS RD 800 - 856 D4s 27205 HOLLINGSWORTH FARM DR 1900 - 1972 F4a 27350 HOLLINGSWORTH RD 700 - 821 F4d 27317 HOLLINGSWORTH RD EXT 830 - 953 F4d 27317 HOLLOW HILL RD 4903 - 5727 G7a 27298 HOLLOW HILL RD 5223 - 5767 H7c 27298 HOLLOW TREE DR 3677 - 3900 G7 27298 HOLLY DR 700 - 859 D5q 27205 HOLLY GROVE CT 4200 - 4249 F4k 27317 HOLLY GROVE DR 562 - 900 F4k 27317 HOLLY HILL ST 200 - 233 E7o 27316 HOLLY HILL ST 200 - 233 E7d 27316 HOLLY HILL ST 200 - 233 E7r 27316 HOLLY LEAF RD 4400 - 4574 D7a 27316 HOLLY LEAF RD EXT 1300 - 1327 D7a 27316 HOLLY OAK DR 1200 - 1318 G5b 27317 HOLLY SPRING RD 2500 - 4799 C7 27316 HOLLY SPRING RD 2500 - 2969 D7 27316 HOLLY SPRINGS CHURCH RD 2300 - 2752 C7 27316 HOLLY ST 600 - 741 D4k 27203 HOLLY ST 200 - 741 D4l 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-52 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP HOLLY ST 100 - 273 E6p 27248 HOLLYRIDGE DR 3500 - 3560 G3j 27370 HOLT ST 4152 - 4200 G8o 27298 HOME AVE 500 - 693 D4l 27203 HOMEPLACE DR 100 - 258 F5q 27317 HOMEPLACE DR 100 - 199 F4d 27317 HOMEPLACE TRL 2500 - 2521 C3d 27205 HOMER LN 100 - 182 F5m 27317 HOMESTEAD RD 329 - 600 E1 27370 HOMEWARD TRL 3500 - 3701 F6 27248 HONEY LOCUST RD 1900 - 2357 B3 27205 HONEY LOCUST RD 1900 - 2357 B4 27205 HONEYCUTT ST 100 - 121 F5i 27317 HONEYSUCKLE RD 600 - 874 E5q 27203 HONEYSUCKLE RDG 500 - 629 D6a 27205 HOOTS HOLLOW RD 4600 - 4933 G7 27298 HOOVER GROVE RD 4900 - 5226 D2 27239 HOOVER HILL CT 4128 - 4200 F3a 27370 HOOVER HILL RD 3600 - 4968 F2b 27370 HOOVER HILL RD 100 - 1411 E2d 27205 HOOVER HILL RD 800 - 2789 E2b 27205 HOOVER HILL RD 2500 - 3913 F2d 27370 HOOVER HILL RD 4969 - 5188 G3q 27370 HOOVER HILL RD 4664 - 5188 F3a 27370 HOOVER ST 300 - 843 D4l 27203 HOOVER ST 800 - 843 D4k 27203 HOPE CT 101 - 107 H3m 27263 HOPE VALLEY DR 100 - 128 H3m 27263 HOPEWELL CHURCH RD 4000 - 4859 G2c 27370 HOPEWELL CHURCH RD 5400 - 5774 G2e 27370 HOPEWELL CHURCH RD 4500 - 5522 G2i 27370 HOPEWELL FRIENDS RD 2300 - 2776 C3b 27205 HOPEWELL FRIENDS RD 800 - 1969 C4c 27205 HOPEWELL FRIENDS RD 1900 - 2639 C3d 27205 HOPEWELL ST 2204 - 2231 E5j 27203 HOPEWOOD RD 2757 - 2900 E4g 27317 HOPEWOOD RD 2757 - 2900 E4h 27317 HOPKINS DR 6505 - 6600 A2 27239 HORSE CANYON RD 1700 - 1746 C4i 27205 HORSE CARRIAGE LN 1868 - 1969 D5q 27205 HORSE MOUNTAIN DR 569 - 700 D5n 27205 HORSE MOUNTAIN DR 569 - 700 D5r 27205 HORSESHOE BEND RD 2800 - 2897 F5q 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-53 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP HOWARD AUMAN RD 1300 - 1574 B4 27205 HOWARD AUMAN RD EXT 1575 - 1649 B4 27205 HOWARD AVE 800 - 1004 C4h 27205 HOWARD CIR 5800 - 6004 H2q 27263 HOWARD MILL RD 6900 - 8934 A8 27208 HOWARD RUSSELL RD 2600 - 2750 H3d 27263 HOWARD RUSSELL RD 2646 - 2750 G3b 27263 HOYLE DR 200 - 275 A5f 27205 HOYT DR 300 - 518 A5j 27341 HOYT DR 300 - 518 A5k 27341 HUB MORRIS RD 616 - 1104 E5i 27317 HUB MORRIS RD 100 - 799 E5e 27203 HUB MORRIS RD 919 - 1130 E5j 27203 HUBBARD LN 7189 - 7299 H4d 27317 HUBBARD LN 7189 - 7299 H4p 27317 HUCK ST 3900 - 3960 E6t 27316 HUCKLEBERRY LN 5700 - 5849 F2a 27370 HUDSON LN 1018 - 1100 E5d 27203 HUDSON ST 3700 - 3716 H2o 27263 HUFF CT 5177 - 5200 G5n 27317 HUFF CTRY TRL 5303 - 5500 E7d 27316 HUFF CTRY TRL 5303 - 5500 D7b 27316 HUFF RD 4100 - 4741 H3m 27263 HUFF RD 4100 - 4199 H2p 27263 HUGHES DR 2700 - 3052 E3d 27350 HUGHES FARM RD 4815 - 5300 G3b 27263 HUGHES FARM RD 4815 - 5300 G3k 27263 HUGHES FARM RD 4815 - 5300 G3d 27263 HUGHES GROVE RD 7000 - 7579 E1 27360 HUGHES ST 200 - 274 E5m 27203 HUGHES ST 200 - 274 E5q 27203 HULIN MCDOWELL RD 2100 - 3084 D1 27239 HUMBLE HOLLOW DR 300 - 386 E5m 27203 HUMBLE HOLLOW DR 300 - 386 E5q 27203 HUMBLE ST 1507 - 1619 E5q 27203 HUMBLE ST 1557 - 1619 E5m 27203 HUMMINGBIRD LN 7453 - 7530 G8b 27298 HUNT DELK RD 1796 - 2100 D1 27239 HUNT MASTER TRL 103 - 380 D3a 27205 HUNT RD 5400 - 6059 B1 27239 HUNT RD 5400 - 6059 B2 27239 HUNT RIDGE CT 2875 - 3000 F2b 27370 HUNTER CT 3158 - 3200 D3a 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-54 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP HUNTERS CLUB DR 7014 - 7200 G1o 27370 HUNTERS RIDGE RD 600 - 972 F4g 27317 HUNTERS RUN 4240 - 4500 F2b 27370 HUNTERS WOODS DR 1501 - 1700 F2d 27370 HUNTERS WOODS DR 1501 - 1700 E2b 27370 HUNTING LODGE RD 5900 - 6706 H6c 27313 HUNTING LODGE RD 5704 - 6062 G6a 27313 HUNTINGTON DR 4260 - 4400 F2b 27370 HUNTINGWOOD RD 4581 - 4800 E7n 27316 HUNTS KNOLL LN 5327 - 5400 H1t 27263 HUSSEY CTRY TRL 7700 - 8140 A7 27341 HUSSEY CTRY TRL 7700 - 8140 A8 27341 HUSSEY WILLIAMS RD 7140 - 7300 A6 27341 HWY 311 EXT 100 - 563 F4p 27317 HYATT DR 6500 - 6550 H5c 27317 HYDE AWAY LN 6400 - 6583 H4q 27263 HYDE AWAY LN 6400 - 6583 G3b 27263 HYDE AWAY LN 6400 - 6583 G4a 27263 IDEAL DR 310 - 515 E5q 27203 IDLEBROOK TRL 1500 - 1624 C3b 27205 IDLEWILD DR 100 - 357 E5e 27317 IDLEWILD DR EXT 2536 - 2665 E5e 27317 IDLEWOOD DR 1200 - 1299 E4s 27205 IDLEWOOD DR 1200 - 1299 D4g 27205 INDEPENDENCE AVE 1377 - 1700 C5j 27205 INDEPENDENCE DR 300 - 380 D4l 27203 INDIAN CREEK DR 1147 - 1300 E2a 27370 INDIAN SPRINGS RD 2900 - 3155 D6f 27205 INDIAN SPRINGS RD 2900 - 3155 D6b 27205 INDIAN TRL 3030 - 3100 F3c 27350 INDIAN TRL 3030 - 3100 F3d 27350 INDIAN WELLS LOOP 1525 - 1600 C5i 27205 INDIGO TRL 3320 - 3452 D6b 27205 INDUSTRIAL PARK AVE 100 - 734 D4t 27205 INDUSTRIAL PARK AVE 500 - 799 D4s 27205 INDUSTRIAL PARK AVE 735 - 799 C4g 27205 INFINITE WAY 3800 - 3852 E6t 27248 INFINITE WAY EXT 300 - 317 E6t 27248 INGOLD DR 4856 - 4900 G5c 27317 INGRAM DR 1000 - 1272 E5q 27203 INTERSTATE DR 102 - 406 H2t 27263 INTERSTATE HWY 73 1200 - 1599 F4h 27317 INTERSTATE HWY 73 1500 - 1799 F4l 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-55 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP INTERSTATE HWY 73 1800 - 1899 F4d 27317 INTERSTATE HWY 73 1700 - 1899 F4p 27317 INTERSTATE HWY 73 1100 - 1499 G4b 27317 INTERSTATE HWY 73 1200 - 1499 G4d 27317 INTERSTATE HWY 73 1200 - 1499 F4g 27317 INTERSTATE HWY 73 1000 - 1199 H4d 27317 INTERSTATE HWY 73 1000 - 1099 H4p 27317 INTERSTATE HWY 73/74 3000 - 3499 D4s 27205 INTERSTATE HWY 73/74 3700 - 4199 B4b 27205 INTERSTATE HWY 73/74 2100 - 2249 E4t 27203 INTERSTATE HWY 73/74 2200 - 2299 D4h 27203 INTERSTATE HWY 73/74 4000 - 4199 B4 27205 INTERSTATE HWY 73/74 4000 - 4199 B5c 27205 INTERSTATE HWY 73/74 4000 - 4400 A5a 27205 INTERSTATE HWY 73/74 2800 - 3099 D4o 27205 INTERSTATE HWY 73/74 2000 - 2199 E4o 27203 INTERSTATE HWY 73/74 2100 - 2199 E4p 27203 INTERSTATE HWY 73/74 2400 - 2899 D4k 27203 INTERSTATE HWY 73/74 3500 - 3699 C4o 27205 INTERSTATE HWY 73/74 3600 - 3799 C4s 27205 INTERSTATE HWY 73/74 1900 - 1999 F4d 27317 INTERSTATE HWY 73/74 1900 - 2099 E4g 27317 INTERSTATE HWY 73/74 2250 - 2499 D4g 27203 INTERSTATE HWY 73/74 4300 - 4400 A5 27341 INTERSTATE HWY 73/74 4300 - 4400 A5j 27341 INTERSTATE HWY 73/74 3700 - 3799 C4t 27205 INTERSTATE HWY 73/74 3400 - 3599 C4k 27205 INTERSTATE HWY 73/74 2000 - 2099 E4k 27317 INTERSTATE HWY 73/74 3400 - 3499 C4g 27205 INTERSTATE HWY 74 2000 - 3708 G3b 27263 INTERSTATE HWY 74 2000 - 3708 G3k 27263 INTERSTATE HWY 74 2800 - 4779 G3d 27263 INTERSTATE HWY 74 3800 - 4920 G4c 27350 INTERSTATE HWY 74 1000 - 2727 H3c 27263 INTERSTATE HWY 74 6000 - 7085 F4d 27317 INTERSTATE HWY 74 4800 - 6618 F4a 27350 INTERSTATE HWY 74 2000 - 2727 G3f 27263 INTERSTATE HWY 74 1500 - 1984 H3d 27263 INTERSTATE HWY 74 6000 - 6618 F4c 27350 INTERSTATE HWY 85 1800 - 1899 G1j 27360 INTERSTATE HWY 85 1800 - 1899 G1k 27360 INTERSTATE HWY 85 1800 - 1899 G1n 27360 INTERSTATE HWY 85 1200 - 1499 H2s 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-56 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP INTERSTATE HWY 85 1500 - 1799 G2e 27370 INTERSTATE HWY 85 1400 - 1599 G2f 27370 INTERSTATE HWY 85 1000 - 1299 H2p 27263 INTERSTATE HWY 85 1200 - 1299 H2t 27263 INTERSTATE HWY 85 1600 - 1799 G1k 27370 INTERSTATE HWY 85 1600 - 1799 G1l 27370 INTERSTATE HWY 85 1600 - 1799 G2i 27370 INTERSTATE HWY 85 1400 - 1499 H2r 27370 INTERSTATE HWY 85 1000 - 1099 H3m 27263 INWOOD RD 200 - 812 D5n 27205 INWOOD RD 200 - 812 D5q 27205 INWOOD RD 200 - 812 D5r 27205 INWOOD VIEW DR 1200 - 1262 F4a 27350 IRA MCGEE RD 4606 - 4696 D7 27316 IRISH MEADOW TRL 6100 - 6164 C1 27239 IRISH MEADOW TRL 6100 - 6164 B1 27239 IRON LOOP DR 2569 - 2680 D6a 27205 IRON MOUNTAIN RD 1900 - 2415 D5d 27205 IRON MOUNTAIN RD 1101 - 2178 D6c 27205 IRON MOUNTAIN RD 500 - 1553 D6a 27205 IRON MOUNTAIN RD 100 - 672 D6e 27205 IRON MOUNTAIN VIEW RD 600 - 1178 D6a 27205 IRON MOUNTAIN VIEW RD 600 - 1178 D6c 27205 IRVIN CTRY RD 4700 - 4993 G5d 27317 IRWIN ST 4511 - 4600 G1h 27370 IRWIN ST 4511 - 4600 G1l 27370 ISAAC DR 7200 - 7452 G8d 27298 ISAAC DR 7200 - 7452 G8s 27298 ISAAC DR 7200 - 7452 F8b 27298 ISABEL DR 2600 - 2708 F5d 27248 ISLAND FORD RD 4557 - 5191 F4g 27317 ISLAND FORD RD 4300 - 4793 F4k 27317 ISLAND OAK DR 6653 - 6900 H8 27298 ISLAND OAK DR 6653 - 6900 G8a 27298 ISLAND OAK DR 6653 - 6900 G8b 27298 ISLEY LN 479 - 500 E7l 27316 ISOM RD 4400 - 4493 D7e 27316 ITASCA CT 600 - 620 E5q 27203 IVEY LN 3500 - 3560 G3j 27370 IVEYDALE DR 1600 - 1724 C4l 27205 IVORY LN 3000 - 3102 F3d 27350 IVY CREEK DR 708 - 757 E5e 27317 IVY CREEK DR 708 - 757 E5f 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-57 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP IVY ROCK CT 400 - 427 F5m 27317 J C TEAGUE RD 100 - 499 E8 27355 J C TEAGUE RD EXT 500 - 842 E8 27355 JABO HUSSEY RD 5845 - 6000 A8 27325 JABO HUSSEY RD EXT 5375 - 5800 A8 27325 JACK WALL LN 6300 - 6391 H3d 27263 JACKIE AVE 100 - 108 H2t 27263 JACKIE AVE 100 - 108 G2h 27263 JACKSON CREEK RD 6500 - 8046 D1 27239 JACKSON CREEK RD 4000 - 6751 D2 27239 JACKSON CREEK RD 4000 - 4401 C2 27239 JACKSON RD 3465 - 3500 D3a 27205 JACKSON WAY 2053 - 2100 F4a 27350 JACOB CT 100 - 105 H3m 27263 JADES WAY 1600 - 1741 F1 27360 JAECO CAUDILL DR 700 - 937 D4c 27205 JAECO CAUDILL DR 700 - 937 D4r 27205 JAECO CAUDILL DR 700 - 937 C4f 27205 JAKE PUGH DR 1200 - 1293 F5b 27248 JAMES AVE 5228 - 5345 G2f 27370 JAMES BEESON RD 1700 - 2264 G5d 27233 JAMES BEESON RD 1700 - 2264 G6c 27233 JAMES RAY DR 1145 - 1200 E6m 27317 JAMES ST 323 - 325 E4t 27203 JAMIE DAVIS RD 3049 - 3200 F3d 27350 JAN DAN DR 800 - 1079 E1 27370 JANICE ACRES ST 3182 - 3300 C6a 27205 JARRELL DR 1000 - 1053 D4n 27205 JARVIS MILLER RD 974 - 1324 E3c 27205 JASMINE LN 5996 - 6120 C7 27316 JASON HOOVER RD 700 - 1096 D4c 27205 JASPER DR 5254 - 5400 G3b 27263 JAY MAC CT 4861 - 4900 G1g 27360 JEFFERSON CT 2001 - 2107 H2p 27263 JEFFERSON ST 615 - 660 D4g 27205 JENNIFER CT 5100 - 5516 H1s 27263 JENNIFER CT 5200 - 5516 H1t 27263 JENNIFER DR 6800 - 6847 H5d 27313 JENNIFER LYNN DR 6600 - 6751 G1t 27370 JENNIFER VIEW DR 3584 - 3800 D6d 27205 JENNINGS CTRY DR 711 - 886 E3d 27205 JENNINGS RD 1100 - 1395 E6a 27317 JENNINGS RD 1100 - 1132 E6m 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-58 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP JERICHO BUTLER DR 1800 - 1942 E3a 27205 JERICO RD 716 - 2408 E3c 27205 JERICO RD 1105 - 2408 E3a 27205 JERNIGAN PL 100 - 120 H2n 27370 JERRY HUGHES ST 800 - 871 D4o 27205 JERRY ST 4480 - 4600 G1h 27370 JERRY ST 4310 - 4600 G1l 27370 JESS FERREE CT 100 - 108 F4l 27317 JESS HACKETT RD 3500 - 4312 F6 27233 JESS HACKETT RD 3680 - 4312 G6d 27233 JESS SMITH RD 3400 - 3799 F3a 27350 JESS SMITH RD 2600 - 3479 F3c 27350 JESSE SMALL RD 5200 - 5691 G4d 27317 JESSICA DR 5100 - 5324 H1s 27263 JILL DR 3700 - 3856 G3n 27370 JIM LEWALLEN RD 200 - 216 C4g 27205 JIM LEWALLEN RD 200 - 216 C4h 27205 JIM PIERCE RD 5904 - 6414 D1 27370 JIM PIERCE RD 5904 - 6414 D2 27370 JIM WALKER RD 3252 - 3400 F6 27248 JIMMY COX RD 6100 - 6847 B8 27208 JIMMY SCOTT RD 2400 - 2562 F6 27233 JOAN DR 5700 - 5861 H2m 27263 JOE BRANSON RD 6400 - 7217 B8 27208 JOE DEAN TRL 5500 - 5578 D7b 27316 JOE DEAN TRL 5500 - 5578 D7 27316 JOE FARLOW RD 100 - 346 B5c 27205 JOE HOFFMAN DR 6105 - 6200 G1h 27263 JOE LOFLIN TRL 5300 - 5384 B1 27239 JOEL JESSUP RD 4500 - 5557 B7 27341 JOHN DR 5238 - 5300 G2f 27370 JOHN GLENN DR 1100 - 1183 F4a 27350 JOHN GLENN DR 1100 - 1183 F4k 27350 JOHN MARSH RD 7200 - 7490 F8b 27298 JOHNNYS WAY 1641 - 1699 E5n 27203 JOHNNYS WAY 1600 - 1699 E5r 27203 JOHNS RIDGE DR 2458 - 2700 C3c 27205 JOHNSON FARM RD 6000 - 6835 B1 27239 JOHNSON OAK DR 1800 - 1840 G4a 27317 JOHNSON ST 5319 - 5400 G3k 27263 JOHNSON ST EXT 3200 - 3243 G3k 27263 JOHNSTON CT 5719 - 5900 G6a 27233 JONES CTRY TRL 2400 - 2546 C5 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-59 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP JONES CTRY TRL 2400 - 2546 C6c 27205 JONES RD 300 - 554 E2d 27205 JONES ST 1946 - 1965 E5i 27203 JONES ST 1946 - 1965 E5m 27203 JONES ST EXT 4100 - 4458 E7q 27316 JONES ST EXT 4411 - 4458 D7e 27316 JONES ST EXT 3700 - 4211 E6t 27248 JORDAN AVE 500 - 521 E4p 27203 JORDAN RD 7000 - 7281 E7n 27316 JORDAN RD 6271 - 6526 E7q 27316 JORDAN RD 6513 - 7051 E7r 27316 JORDAN RD 7300 - 7368 E7o 27316 JORDAN RD 7229 - 7281 E7o 27316 JORDAN ST 400 - 415 E5m 27203 JORDAN ST 4400 - 4573 G1l 27370 JORDAN VALLEY RD 4600 - 5188 F2d 27370 JORDAN VALLEY RD 4600 - 5188 E2b 27370 JOSE RD 5500 - 5609 B8 27208 JOSH CT 2800 - 2843 F1g 27360 JOYCE ST 827 - 857 D4p 27203 JUGTOWN RD 7500 - 8103 A7 27341 JULIAN AIRPORT RD 5488 - 6157 H7c 27298 JULIAN AIRPORT RD 5503 - 5680 G7a 27298 JULIAN AVE 100 - 405 H2o 27263 JULIAN AVE 400 - 525 H2p 27263 JULIAN RD 600 - 733 E6o 27248 JULIAN ST 3600 - 3737 H6t 27233 JULIAN ST 3500 - 3648 G6b 27233 JUNE TRL 6319 - 6600 F8c 27298 JUNIPER CT 2288 - 2297 E5i 27203 KAMERIN ST 2800 - 3099 F5q 27317 KARLA DR 623 - 700 D5q 27205 KATRINA DR 3200 - 3459 G1r 27360 KAY DR 3500 - 3545 G3n 27370 KAY LYNN DR 4500 - 4596 G3m 27370 KAYE ST 400 - 514 H2n 27263 KAYE ST 400 - 411 H2j 27263 KEELY LN 4992 - 5200 G6b 27233 KEETER CT 100 - 150 G8n 27298 KEITH DR 5300 - 5449 C7 27316 KELLO RD 6005 - 6100 H2q 27263 KELLY CIR 503 - 522 E5i 27203 KELLY COLTRANE DR 6776 - 7100 H5c 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-60 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP KEMP BLVD 1100 - 1141 D5i 27203 KEMP MILL RD 3300 - 4461 C6d 27205 KEN LEE CT 1691 - 1800 D5d 27205 KENMORE ST 900 - 1043 D5m 27203 KENNEDY CT 4000 - 4113 G2c 27370 KENNEDY CTRY DR 484 - 700 D5d 27205 KENNEDY FARM RD N 100 - 1304 E1 27370 KENNEDY FARM RD N 900 - 2560 F1 27360 KENNEDY FARM RD S 100 - 578 E1 27370 KENNEDY RD 5700 - 6991 G2c 27370 KENNEDY RD 6600 - 7149 G1t 27370 KENNEDY RD 4500 - 5872 F2b 27370 KENNEDY RD 5700 - 5872 G2d 27370 KENNELWOOD DR 302 - 333 E4t 27203 KENTLAND DR 5100 - 5210 G3i 27370 KENTUCKY LN 1 - 4 G1f 27360 KERMIT HUNT RD 1300 - 1356 E3a 27205 KERR DR 6500 - 6863 H5c 27317 KERRY ST 1000 - 1055 D5i 27203 KERSEY DR 100 - 315 H2o 27263 KEYAUEE DR 1511 - 1700 D3c 27205 KEYAUWEE RIDGE RD 3200 - 3376 E3c 27205 KEYSTONE DR 1200 - 1357 E5q 27203 KEYSTONE DR 1000 - 1260 D5e 27203 KIDD DR 500 - 615 D5e 27203 KIDD DR 500 - 615 D5i 27203 KIDD FARM TRL 3100 - 3189 C8 27344 KIDDS LN 2300 - 2371 F7 27248 KIDDS MILL RD 3200 - 4143 F6 27248 KIDDS MILL RD 3718 - 5116 F7 27248 KIDDS MTN RD 7700 - 8072 A2 27239 KILDARE RD 729 - 1019 D5m 27203 KILDEE CHURCH RD 400 - 2303 D8 27316 KILDEE CHURCH RD 400 - 1025 E8 27316 KILOWATT DR 2091 - 2200 C4p 27205 KIMBERLY DR 300 - 430 C4h 27205 KIMBERLY LN 5100 - 5589 G2f 27370 KIMBERLY LN 5242 - 5589 H2r 27370 KIME FARM RD 4400 - 4558 G6d 27233 KIME FARM RD EXT 4400 - 4509 G6d 27233 KIMREY LN 5584 - 5700 H7d 27298 KIMREY ST 400 - 407 E7n 27316 KIMREY ST 0 - 435 E7r 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-61 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP KINDLEY FARM RD 3200 - 3575 D6b 27205 KINDLEY FARM RD 3200 - 3448 D6a 27205 KINDLEY FARM RD EXT 3575 - 3673 D6b 27205 KINDLEY RD 526 - 940 E1 27360 KINDLEY RD 100 - 233 E2c 27205 KINDLEY RD 100 - 233 E2d 27205 KINDLEY TRL 3400 - 3545 D6b 27205 KING CT 2047 - 2114 E5i 27203 KING MTN RD 6295 - 7611 A2 27205 KING MTN RD 6295 - 7611 A3 27205 KING RD 127 - 452 E7n 27316 KING RD 127 - 178 E7r 27316 KING RD 488 - 504 A5 27341 KING VIEW RD 4898 - 5072 A4 27205 KING VIEW RD 4898 - 5352 A5a 27205 KINGS RIDGE RD 300 - 432 G5n 27317 KINGSFIELD CT 101 - 107 H2m 27263 KINGSFIELD FOREST DR 101 - 334 H2m 27263 KINGSTON CT 4300 - 4444 G1k 27360 KINGSTON RD 6900 - 7281 G1k 27360 KINGSTON RD 7200 - 7346 G1j 27360 KINGSWAY RD 10 - 28 D4o 27203 KINLEY TRL 2781 - 2900 H3d 27263 KINNEY WOODS WAY 384 - 500 E1 27370 KINRO RD 6800 - 7062 F8b 27298 KINVIEW DR 118 - 4304 H2t 27263 KIRKMAN CT 101 - 110 H2m 27263 KIRKMAN PL 100 - 155 F5m 27317 KIRKMAN ST EXT 6000 - 6214 G8c 27298 KIRKMAN ST EXT 6000 - 6214 G8r 27298 KISER RD 7000 - 7274 A7 27341 KIVETT COUNCIL RD 1700 - 2193 F8c 27298 KIVETT FARM RD 7600 - 7817 E8 27355 KIVETT ST 300 - 434 F8t 27355 KNOLL DR 1890 - 1955 G4a 27317 KNOLL DR 1800 - 1886 G4a 27317 KNOLLVIEW DR 3700 - 3898 F3a 27350 KNOLLWOOD DR 4000 - 4509 H2p 27263 KNOLLWOOD DR 4500 - 4605 H2t 27263 KNOLLWOOD DR 4000 - 4034 H3m 27263 KOLBY CT 2859 - 2900 F3c 27350 KOONCE CT 5100 - 5206 E2a 27370 KOONCE DR 1194 - 1500 E2a 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-62 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP KREAMER DR 3600 - 3745 G3f 27263 KREAMER DR 3700 - 3745 G3e 27263 KYLES LN 5100 - 5184 G5d 27317 KYNWOOD DR 4000 - 4346 G3m 27370 LABRADOR DR 100 - 271 H4d 27317 LABRADOR DR 100 - 271 H5c 27317 LACEWOOD CT 300 - 341 G5n 27317 LACEY CT 5805 - 6100 F1b 27370 LACEY CT 5805 - 6100 F2a 27370 LACKEY RD 6600 - 6884 F8c 27355 LACY DR 3900 - 3979 F5f 27317 LACY HODGE DR 3417 - 3600 F4c 27350 LAKE CT 2268 - 2300 F2d 27370 LAKE CT 2226 - 2267 F2d 27370 LAKE CTRY DR 1400 - 1556 E4c 27205 LAKE CTRY DR EXT 1489 - 2100 E4c 27205 LAKE DARR RD 4878 - 5100 G2g 27370 LAKE DR 101 - 803 H2n 27263 LAKE DR 700 - 755 D4o 27205 LAKE DR 700 - 755 D4p 27205 LAKE JUNO RD 5400 - 5657 H8 27298 LAKE LUCAS RD 1300 - 3095 E4c 27350 LAKE LUCAS RD 2200 - 3095 E4e 27350 LAKE LUCAS RD 2200 - 3095 E4a 27350 LAKE PARK RD 100 - 414 E2d 27205 LAKE PARK RD 100 - 168 E2c 27205 LAKE RIDGE CT 4145 - 4400 E7a 27316 LAKECREST RD 200 - 260 D5j 27203 LAKESIDE DR 108 - 128 H2t 27263 LAKESIDE DR 108 - 128 H3q 27263 LAKESIDE DR 3700 - 3837 F3a 27350 LAKESIDE PARK RD 100 - 273 E6s 27248 LAKESIDE PARK RD 100 - 273 D6b 27248 LAKEVIEW CT 4500 - 4548 G1g 27360 LAKEVIEW RD 1934 - 2035 E5m 27203 LAKEVIEW RD 1934 - 2035 E5n 27203 LAKEWAY RD 5489 - 5696 D2 27239 LAKEWOOD CIR 3900 - 4361 G1p 27370 LAKEWOOD CIR 4300 - 4361 G1l 27370 LAKEWOOD CT 6600 - 6650 G1p 27370 LAKEWOOD CT EXT 4000 - 4021 G1p 27370 LAKEWOOD CT EXT 4100 - 4126 G1l 27370 LAKEWOOD CT EXT 4100 - 4126 G1p 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-63 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP LAMAR DR 2040 - 2132 E5i 27203 LAMB CTRY RD 2300 - 2626 E4k 27205 LAMB CTRY RD 2300 - 2626 E4o 27205 LAMB ST 4400 - 4609 F5e 27317 LAMB ST 4532 - 4609 G5c 27317 LAMBE LN 200 - 222 E6p 27248 LAMBERT DR 119 - 2449 D4s 27205 LAMBERT DR 100 - 203 D4o 27205 LAMBERT MINE ST 371 - 400 D4s 27205 LAMBERT TRL 4700 - 4760 E7n 27316 LAMBETH MILL RD 3142 - 5279 C8 27208 LAMINA LN 5200 - 5313 G7a 27298 LAMPLIGHT DR 3300 - 3529 F5m 27317 LAMPLIGHT DR 3400 - 3529 F5i 27317 LANCASTER LN 3300 - 3392 H6d 27233 LANCASTER LN 3300 - 3392 H6t 27233 LANCELOT DR 956 - 1100 E7a 27316 LANCER DR 5300 - 5636 G3j 27263 LAND DALE DR 5800 - 5848 H2m 27263 LAND ESTATES DR 1707 - 1900 F7 27355 LAND ESTATES DR 1707 - 1900 F8c 27355 LANDIS CT 219 - 255 E5e 27203 LANE DR 100 - 310 G3e 27370 LANE DR 100 - 125 G2h 27370 LANES MILL RD 6000 - 6686 C7 27316 LANES MILL RD 6400 - 8421 C8 27208 LANGLEY LOOP 1500 - 1785 F8c 27355 LANGLEY MEADOW RD 7100 - 7209 E8 27355 LANGLEY RD 700 - 1752 E8 27355 LANGLEY RD 1171 - 1752 F8s 27355 LANIER AVE 100 - 430 D4l 27203 LANIER HILL RD 5980 - 6326 B1 27239 LANIER HILL RD 5800 - 6326 B2 27239 LANIER HILL RD 5800 - 5979 A2 27239 LANIER RD 4600 - 5673 B3 27205 LANIER RD 5143 - 5673 A3 27205 LANSDOWNE LAKES LN 1000 - 1117 E5r 27203 LANSDOWNE PL 7300 - 7419 G1j 27360 LANSDOWNE PL 7100 - 7365 G1k 27360 LANSDOWNE RD 683 - 900 D5f 27203 LANTERN DR 1694 - 1900 D6d 27205 LANVALE AVE 4900 - 5183 G2k 27370 LARK DR 3004 - 3246 C2 27239 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-64 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP LARKWOOD AVE 800 - 823 D5m 27205 LASSITER LN 100 - 246 B5c 27205 LASSITER MILL RD 3647 - 4376 C2 27205 LASSITER MILL RD 3000 - 4376 C3c 27205 LASSITER MILL RD 3647 - 7880 B2 27205 LASSITER MILL RD 1600 - 2213 D3c 27205 LASSITER MILL RD 1600 - 3626 C3a 27205 LASSITER MILL RD 6500 - 8185 A2 27371 LATHAM HARVELL RD 1900 - 2161 C5 27205 LAUGHLIN RD 1617 - 1900 E5b 27317 LAUGHLIN RD EXT 1514 - 1610 E5b 27317 LAURA AVE 230 - 241 H2o 27263 LAURA CT 100 - 105 F5e 27317 LAURA CT 1800 - 1927 E4s 27205 LAUREL DR 700 - 875 D5q 27205 LAUREL LN 4000 - 4076 F5b 27317 LAURELWOOD PL 1800 - 1844 C3b 27205 LAUREN TAYLOR DR 4800 - 4919 G3n 27370 LAWRENCE DR 3200 - 3212 H2j 27263 LAWRENCE DR 3200 - 3212 H2n 27263 LAWRENCE DR 252 - 400 D5m 27205 LAWRENCE DR 252 - 400 D5n 27205 LAWRENCE FARM LN 6613 - 7098 H5c 27317 LAWRENCE FARM RD 6600 - 6702 A5 27341 LAWRENCE HEIGHTS AVE 1542 - 1600 D5g 27205 LAWRENCE SMITH DR 100 - 137 G5a 27317 LAWSON CT 2932 - 3044 F5q 27317 LAWSON DR 3842 - 3900 G2c 27370 LAZELL AVE 1115 - 1300 D5n 27205 LAZY LN 1349 - 1549 D1 27239 LAZY PINE RD 2639 - 2900 E4g 27317 LAZY PINE RD 2639 - 2724 E4k 27317 LEACH MEADOW RD 2900 - 3319 B6 27341 LEACH MEADOW RD 2900 - 3319 B6b 27341 LEACH ST 5400 - 5435 H2r 27370 LEAH JUSTINE DR 6500 - 6795 G1t 27370 LEATHER RD 103 - 249 A5 27341 LEDBETTER RD 6100 - 6263 H6d 27233 LEDWELL RD 2600 - 2728 C5c 27205 LEE LAYNE RD 100 - 1886 E7d 27316 LEE LAYNE RD 800 - 1886 D7b 27316 LEE ST 500 - 861 D4l 27203 LEE ST 600 - 1036 D4p 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-65 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP LEE ST 400 - 407 F4l 27317 LEE ST 400 - 407 F5i 27317 LEE VALLEY RD 1400 - 1481 C5f 27205 LEESVILLE ST 5500 - 5581 G2c 27370 LEGEND DR 200 - 503 D4t 27205 LEIGH LN 4900 - 5084 G4c 27350 LEO CRANFORD RD 100 - 247 C4k 27205 LEO CRANFORD RD 100 - 247 C4o 27205 LEO CRANFORD RD 100 - 247 C4p 27205 LEO LN 2479 - 2695 E5e 27203 LEONAE DR 1773 - 2600 E5e 27317 LEONARD DR 3200 - 3241 F8a 27355 LEONARD MEADOW RD 300 - 341 E7l 27316 LEONARD MEADOW RD EXT 5560 - 5600 E7l 27316 LEONARD PARK ST 2026 - 2038 E7q 27316 LEONARD ST 1600 - 1603 E7q 27316 LEONARD YORK DR 1908 - 2000 E5b 27317 LEONARD YORK DR 1908 - 2000 E6a 27317 LEROY SMITH DR 100 - 133 G5c 27317 LESLIE ST 1529 - 1600 C3b 27205 LESTER FARM RD 6903 - 6966 A6 27341 LESTER RD 942 - 1190 E6n 27248 LESTER RUSSELL DR 100 - 229 C4s 27205 LESTER RUSSELL DR 100 - 229 C4t 27205 LEVANCE ST 1818 - 1931 E5m 27203 LEVANCE ST 1818 - 1931 E5n 27203 LEVEL PLAINS RD 3800 - 4176 F3a 27350 LEWALLEN RD 100 - 651 D4k 27205 LEWALLEN RD 100 - 541 D4o 27205 LEWIS BROWN RD 4200 - 5438 B8 27208 LEWIS BROWN RD 4200 - 4968 C8 27208 LEWIS CTRY DR 100 - 162 B4b 27205 LEWIS DAVIS RD 6100 - 6618 G4a 27317 LEWIS DAVIS RD 6219 - 6618 H4c 27317 LEWIS ST 800 - 845 D4k 27203 LEWIS ST 800 - 845 D4l 27203 LEWIS THOMAS RD 2300 - 2331 C5c 27205 LEXINGTON COMMONS DR 1100 - 1200 D4k 27205 LEXINGTON PL 200 - 242 D4k 27205 LEXINGTON RD 100 - 427 D4k 27205 LEXINGTON RD 304 - 751 D4g 27205 LEYLAND TER 1000 - 1420 G3m 27370 LIBBY RD 5000 - 5141 H2s 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-66 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP LIBERTY CHURCH DR 5513 - 5600 G2c 27370 LIBERTY CIR 876 - 900 C5i 27205 LIBERTY CIR EXT 1500 - 1551 C5i 27205 LIBERTY GROVE RD 4600 - 5460 G8b 27298 LIBERTY GROVE RD 5316 - 5706 H8 27298 LIBERTY GROVE RD 4600 - 4870 G8k 27298 LIBERTY PARK AVE 7230 - 7300 F8b 27298 LIBERTY PL 102 - 516 H2o 27263 LIBERTY PLZ 204 - 417 G8n 27298 LIBERTY RD 100 - 475 H2o 27263 LIBERTY RD 431 - 504 H2k 27263 LIBERTY ST 700 - 742 E7r 27316 LIBERTY ST 100 - 317 D4h 27203 LIBERTYS RUN DR 3500 - 3790 F3c 27350 LIBRA PL 500 - 621 G5r 27317 LILAC LN 2600 - 2681 C4t 27205 LILLIAN TRL 3660 - 3800 B6 27341 LILLIAN TRL 3483 - 3800 B7 27341 LILLIE LN 7200 - 7635 A7 27341 LILLIEWOOD LN 3700 - 3922 G6d 27233 LILLIEWOOD LN 3700 - 3922 F6 27233 LILLY FLOWER RD 5400 - 5476 G3f 27263 LILLY FLOWER RD 5400 - 5476 G3j 27263 LINCOLN AVE 500 - 772 D4g 27205 LINDA DR 100 - 260 H3q 27263 LINDA DR 100 - 262 G3e 27263 LINDA LN 4500 - 4783 E2b 27205 LINDALE DR 1000 - 1220 C4h 27205 LINDLEY AVE 300 - 357 D4l 27203 LINDLEY AVE 300 - 357 D5i 27203 LINDLEY ST 300 - 332 E6o 27248 LINDSAY DR 100 - 120 H3c 27263 LINDSAY DR 100 - 120 H3q 27263 LINDSEY AVE 433 - 566 D4p 27203 LINDSEY AVE 517 - 566 D5m 27203 LINEBERRY LN 3503 - 3600 G6d 27233 LINEBERRY ST 2002 - 2037 E5i 27203 LINEBERRY ST 1200 - 1211 E7r 27316 LINK CT 4763 - 4800 G2j 27370 LINK RD 5152 - 5300 G2j 27370 LINK RD 5152 - 5200 G2k 27370 LINNIE CT 2400 - 2497 C6a 27205 LIONS REST RD 2700 - 3329 C5 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-67 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP LIONS REST RD 2700 - 3329 C5c 27205 LIONS REST RD 2700 - 3329 B5a 27205 LISBON RD 100 - 178 B4b 27205 LITTLE BEANE STORE RD 5500 - 6266 B6 27341 LITTLE BEANE STORE RD 4399 - 5684 B6b 27341 LITTLE BEANE STORE RD 4000 - 4398 C7 27316 LITTLE BEANE STORE RD 4000 - 4828 B7 27316 LITTLE BROOK RD 2900 - 3274 A6 27341 LITTLE CREEK DR 2904 - 3100 G1s 27360 LITTLE CREEK DR 2904 - 2994 G1t 27360 LITTLE FOX RD 4526 - 4821 F4h 27317 LITTLE GATE DR 1300 - 1542 D4h 27203 LITTLE GOLDEN TRL 5300 - 5333 E7k 27316 LITTLE LAKES TRL 1071 - 1312 E4c 27205 LITTLE LAKES TRL 1071 - 1312 D4a 27205 LITTLE POINT RD 1100 - 1360 E5k 27317 LITTLE RD 6100 - 6152 F8o 27355 LITTLE RD 6100 - 6152 F8p 27355 LITTLE RIVER RD 500 - 917 A5a 27341 LITTLE RIVER RD 262 - 599 A5j 27341 LITTLE RIVER RD 1000 - 2758 A4 27205 LITTLE RIVER RD 674 - 1632 A5 27205 LITTLE UWHARRIE RD 6900 - 7393 F1 27360 LITTLES DR 3200 - 3313 F6 27248 LITTLES DR 3200 - 3313 F6c 27248 LLOYD ST 200 - 285 E2d 27205 LOACH ST 300 - 557 D5i 27203 LOACH ST 446 - 588 D5e 27203 LOBLOLLY DR 3079 - 3400 G3s 27350 LOBLOLLY DR 3327 - 3400 G3r 27350 LOCK HIGHLAND CT 3021 - 3100 G6b 27233 LOCKHART ST 106 - 118 H3q 27263 LOCUST GROVE DR 1862 - 2100 F6 27248 LOCUST MTN TRL 4503 - 4616 D2 27205 LOE FALL AVE 2787 - 3000 D6c 27205 LOFLIN DAIRY RD 2408 - 2500 G3d 27350 LOFLIN FARLOW LN 2194 - 2312 F3d 27350 LOFLIN HILL RD 900 - 1933 D1 27370 LOFLIN HILL RD 900 - 1559 E1 27370 LOFLIN POND RD 400 - 1293 E6m 27203 LOFLIN POND RD 194 - 704 E5d 27203 LOFLIN POND RD 100 - 704 E6q 27203 LOFLIN POND RD 100 - 193 D6e 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-68 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP LOG CABIN RD 4200 - 5734 B8 27316 LOG CABIN RD 4200 - 5117 C8 27316 LOGAN LN 607 - 730 G8k 27298 LOIS LN 6005 - 6100 H2q 27263 LONDELLE LN 100 - 300 D4O 27205 LONG MEADOW DR 5366 - 5600 H8 27298 LONG MEADOW DR 5366 - 5600 G8b 27298 LONGVIEW AVE 6400 - 6466 G1p 27370 LONGVIEW DR 3409 - 4011 H2p 27263 LONITA ST 100 - 128 H2p 27263 LORD RANDOLPH CIR 560 - 600 D4g 27205 LORENE AVE 4600 - 4699 G7a 27298 LORIEN CHARTER DR 6965 - 7100 H4c 27317 LOTUS LN 1720 - 1733 C5 27205 LOU CRANFORD RD 6200 - 6680 A1 27239 LOU CRANFORD RD 5100 - 6680 A2 27239 LOU CRANFORD RD 5100 - 6190 B2 27239 LOU MYERS LN 3833 - 3900 F5f 27317 LOVELL DR 2300 - 2405 F5d 27317 LOW BRIDGE RD 1300 - 2951 F7 27298 LOW BRIDGE RD 800 - 1863 E7b 27298 LOW BRIDGE RD 800 - 1211 E7k 27316 LOW BRIDGE RD 800 - 1211 E7l 27316 LOW BRIDGE RD 2629 - 2951 E7a 27248 LOWDERMILK RD 4300 - 4429 B5c 27205 LOWE CTRY RD 2800 - 3139 D3a 27205 LOWE CTRY RD 2800 - 3139 D3b 27205 LOWE DR 6300 - 6413 H5c 27317 LOWE DR 6300 - 6413 G5a 27317 LOWERYWOOD CIR 6070 - 6300 G1l 27370 LOWERYWOOD CIR 6070 - 6200 G2i 27370 LUCK DR 3600 - 3713 H2o 27263 LUCK DR 400 - 456 A5k 27341 LUCK RD 527 - 1301 D5b 27205 LUCK RD 100 - 785 D5k 27205 LUCK RD 1000 - 1744 D5d 27205 LUCK RD 1596 - 1744 D6c 27205 LUCY LN 2200 - 2277 C3b 27205 LUDLUM LN 741 - 1000 C4j 27205 LUDLUM LN 741 - 833 C4f 27205 LULA RAY RD 794 - 891 F4d 27317 LUNAR DR 801 - 1010 H2p 27263 LUTHER CTRY LN 2000 - 2102 C3b 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-69 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP LUTHER HURLEY RD 3913 - 4100 A3 27371 LUXURY LN 700 - 799 D4r 27205 LYNBROOK DR 410 - 512 H2p 27263 LYNBROOK DR 410 - 417 H2o 27263 LYNDON LN 3739 - 3800 F4a 27350 LYNN CIR E 2179 - 2300 F1b 27370 LYNN CIR W 2177 - 2300 F1b 27370 LYNN DR 100 - 212 H2n 27263 LYNN OAKS DR 3715 - 4900 G3n 27370 LYNNWAY DR 807 - 900 F5r 27317 MAC CRISCOE RD 4100 - 4210 B7 27341 MACARTHUR ST 100 - 175 D4l 27203 MACEDONIA LOOP RD 5600 - 6081 H7d 27298 MACEDONIA LOOP RD 5800 - 6081 H8 27298 MACHALA DR 2142 - 2167 E5j 27317 MACK LINEBERRY RD 2692 - 3429 F5d 27248 MACK LINEBERRY RD 4640 - 5670 G6c 27233 MACK LINEBERRY RD 3200 - 3916 F6c 27248 MACK LINEBERRY RD 3430 - 4849 F6 27248 MACK LINEBERRY RD 5507 - 5806 G6d 27233 MACK RD 2300 - 2699 C4c 27205 MACK RD 900 - 1617 C4f 27205 MACK RD 1400 - 2380 C4j 27205 MACK RD 800 - 952 D4r 27205 MACK RD 100 - 267 D4o 27205 MACK RD 200 - 893 D4s 27205 MACKIE AVE 911 - 1120 D5m 27205 MACON DR 4800 - 5009 H3q 27263 MACON FARM RD 2900 - 3778 C7 27316 MACON ST 900 - 1037 D4p 27203 MADDY LN 3100 - 3143 H3c 27263 MADISON CIR 245 - 471 D5g 27205 MAE MATILDA CT 101 - 106 H3c 27263 MAGNOLIA DR 100 - 111 F5e 27317 MAGNOLIA DR 100 - 111 F5f 27317 MAGNOLIA LN 7200 - 7293 H4p 27317 MAGNOLIA LN 101 - 308 H3q 27263 MAIN ST 1501 - 1544 E7r 27316 MAJESTIC OAK DR 4153 - 4297 F5f 27317 MALLARD DR 400 - 737 G5n 27317 MAMIE MAY RD 2700 - 3905 F6 27248 MAMIE MAY RD 2091 - 3148 G6c 27248 MAMIE MAY RD 1500 - 2626 F5b 27248 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-70 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP MAMIE MAY RD 2091 - 2626 G5d 27248 MANDARIN CT 4900 - 4946 G5n 27317 MANDOVER CT 800 - 903 D4a 27205 MANESS COBLE DR 3000 - 3084 C6b 27205 MANESS COBLE DR 3000 - 3084 C6d 27205 MANESS DR 100 - 113 F5f 27317 MANESS RD 3918 - 4557 A7 27341 MANOR CIR 523 - 597 D5q 27205 MANOR PARK DR 4100 - 4146 G3q 27350 MANOR RIDGE DR 5100 - 5227 G3j 27263 MANOR ROCK RD 7400 - 8216 D8 27344 MANOR ROCK RD 7400 - 8125 C8 27344 MANORVIEW RD 1500 - 1994 C4l 27205 MAPLE AVE 637 - 680 D5i 27203 MAPLE AVE 427 - 680 D5m 27203 MAPLE AVE 300 - 343 D4p 27203 MAPLE GROVE CT 100 - 600 H2o 27263 MAPLE HILL CT 2562 - 2600 C3c 27205 MAPLE LEAF CT 6600 - 6631 F1b 27370 MAPLE OAK DR 4749 - 4796 G1h 27263 MAPLE RIDGE DR 1990 - 2095 E6a 27248 MAPLE RIDGE RD 900 - 999 E5r 27203 MAPLE RIDGE RD 900 - 999 E5s 27203 MAPLE RUN DR 5664 - 5741 G5a 27317 MAPLE SPRINGS RD 5704 - 6870 A5 27341 MAPLE SPRINGS RD 6223 - 6870 A4 27341 MAPLE SPRINGS RD 5704 - 5900 A5a 27341 MAPLE WAY 3148 - 3200 F8a 27355 MAPLEGATE LN 6500 - 6709 H5d 27313 MAPLEWOOD CIR 500 - 566 G8s 27298 MAPLEWOOD CT 200 - 214 G2h 27370 MAPLEWOOD LN 3191 - 3579 G6d 27233 MARATHON DR 3355 - 3600 D6c 27205 MARATHON DR 3355 - 3600 D6d 27205 MARCAL CIR 3100 - 3444 G3o 27350 MARCLIF RD 2800 - 2970 F6c 27248 MARGARET CHAPEL RD 7100 - 7299 F8o 27355 MARIE DR 3142 - 3500 G2c 27370 MARIE DR 3142 - 3500 F2a 27370 MARIGOLD LN 1700 - 1870 D3c 27205 MARIGOLD LN 1700 - 1870 C3a 27205 MARK AVE 800 - 935 D5q 27205 MARKWOOD ST 921 - 935 D4o 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-71 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP MARKET AVE 116 - 142 G8o 27298 MARKET DR 1673 - 1800 G4c 27350 MARLBORO CHURCH RD 2400 - 3270 G3d 27350 MARLBORO CHURCH RD 2400 - 2446 G4c 27350 MARLBORO CHURCH RD 3100 - 3327 G3s 27350 MARLBROOK CT 4900 - 5546 G3j 27370 MARLEY CIR 7100 - 7191 F8o 27355 MARLEY FARM RD 4300 - 4641 B7 27341 MARMADUKE CIR 300 - 345 D4l 27203 MARMADUKE CIR 300 - 345 D5i 27203 MARQUISE CT 100 - 110 G3m 27370 MARSH CTRY LN 613 - 700 G4b 27317 MARSH MTN RD 2000 - 2717 F3d 27350 MARSH MTN RD 2000 - 2474 F3b 27350 MARSH MTN RD 2000 - 2474 F4a 27350 MARSHALL LN 100 - 400 D6e 27205 MARSHALL ST 100 - 125 H2p 27263 MARTHA CT 100 - 111 F5i 27317 MARTHA DR 6200 - 6366 C1 27239 MARTIN HILL AVE 259 - 398 B4b 27205 MARTIN LUTHER KING JR DR 423 - 1384 D5i 27203 MARTIN LUTHER KING JR DR 1253 - 1597 D5j 27203 MARY ROBBINSON RD 4217 - 4300 G6c 27233 MARY VIOLA DR 2513 - 2611 G4c 27350 MARY VIOLA DR 2400 - 2611 F4a 27350 MARY VIOLA DR 2400 - 2512 F3b 27350 MARYLAND DR 100 - 205 G1f 27360 MARYLAND DR 113 - 205 G1g 27360 MARYLAND DR 101 - 112 G1j 27360 MASON CIR 6400 - 6654 H5c 27317 MASON CIR 6400 - 6654 G5a 27317 MASONS DR 1900 - 1967 D6d 27205 MATTHEWS ST 400 - 609 E6p 27248 MAULDIN DR 5500 - 5566 G3f 27263 MAURINE DR 902 - 1000 D4c 27205 MAYBERRY LN 706 - 789 D4c 27205 MAYFLOWER DR 2000 - 2111 H6c 27313 MAYNARD DR 100 - 299 H2s 27370 MAYNARD DR 201 - 299 G2g 27370 MCALISTER ST 100 - 143 D5i 27203 MCCLINTOCK RD 2878 - 3100 H6d 27233 MCCOLLUM FARM RD 812 - 900 F5r 27317 MCCOLLUM ST 300 - 467 F4p 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-72 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP MCCOLLUM ST 100 - 467 F5m 27317 MCCRANFORD RD 100 - 328 C4l 27205 MCCRARY CTRY LN 100 - 150 A5 27341 MCDANIEL DR 1385 - 1600 C3b 27205 MCDANIEL RD 1500 - 1614 D3d 27205 MCDERMOTT ST 500 - 1000 C4h 27205 MCDERMOTT ST 456 - 600 D4t 27205 MCDOWELL CTRY TRL 450 - 900 E6m 27203 MCDOWELL CTRY TRL 450 - 900 E6q 27203 MCDOWELL RD 100 - 758 C4g 27205 MCDOWELL RD 700 - 1146 D4s 27205 MCDOWELL RD 100 - 514 C4h 27205 MCKAY RD 100 - 159 A6 27341 MCKNIGHT ST 100 - 509 E4h 27203 MCKNIGHT ST 100 - 433 E5e 27203 MCLAREN LN 1850 - 1887 C5 27205 MCLARKLING LN 450 - 492 D4s 27205 MCLAURIN DR 208 - 236 E4t 27203 MCMASTERS ST 100 - 348 D4h 27203 MCNEAL ST 200 - 229 D4h 27203 MCNEILL RD 2211 - 2300 H3d 27263 MCPHERSON FARM DR 5085 - 5200 G8a 27298 MCPHERSON ST 1948 - 2034 E5i 27203 MCPHERSON ST 1948 - 2034 E5m 27203 MCQUEEN RD 5400 - 5522 E7k 27316 MCQUEEN RD 5425 - 5522 E7l 27316 MCWAY CT 4844 - 4900 G1g 27360 MEADE DR 5400 - 5459 G3e 27370 MEADOW ACRES LN 3100 - 3232 F3d 27350 MEADOW CT 3537 - 3600 G1p 27370 MEADOW CT 3537 - 3600 G1t 27370 MEADOW DR 6500 - 6654 G1p 27370 MEADOW LAKE LN 1802 - 1902 F4a 27350 MEADOW LARK LN 2998 - 3200 G3s 27350 MEADOW LARK LN 3098 - 3400 G3r 27350 MEADOW RD 100 - 281 D6f 27205 MEADOW RIDGE CT 3940 - 4000 D6d 27205 MEADOWBRANCH RD 6300 - 7754 A6 27341 MEADOWBROOK DR 3400 - 4585 G2c 27370 MEADOWBROOK DR 5000 - 6215 G2f 27370 MEADOWBROOK DR 4360 - 5101 G2j 27370 MEADOWBROOK DR 6100 - 6215 H2r 27370 MEADOWBROOK RD 500 - 1319 D5e 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-73 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP MEADOWBROOK RD 1200 - 1410 E5q 27203 MEADOWBROOK RD 500 - 539 D5i 27203 MEADOWBROOK RD EXT 1620 - 1656 E5q 27203 MEADOWBROOK VIEW RD 4200 - 4431 G1k 27360 MEADOWDALE LN 3500 - 3625 G3j 27370 MEADOWGATE DR 680 - 686 E5i 27317 MEADOWLANDS DR 1108 - 2100 B4 27205 MEADOWLARK CT 5209 - 5300 G5b 27317 MEADOWOOD CT 4400 - 4423 G2j 27370 MEADOWOOD DR 1001 - 1008 E7r 27316 MEADOWS CTRY LN 3160 - 3300 F6 27248 MECHANIC RD 3500 - 3886 C2 27205 MECHANIC RD 3500 - 3767 C3a 27205 MEDFIELD CIR 400 - 445 D6f 27205 MEGAN DR 2500 - 2512 D7e 27316 MELISSA CT 5670 - 5700 H3q 27263 MELLIE RD 3700 - 4012 C8 27316 MELODY LN 100 - 148 F5m 27317 MEMORIAL ST 100 - 132 D4l 27203 MEMORY LN 800 - 860 E6m 27203 MENDENHALL PL 6145 - 6200 H1l 27263 MENDENHALL PL 6145 - 6200 H2i 27263 MENDENHALL RD 7000 - 7163 H1o 27263 MENDENHALL RD 6574 - 7163 H1p 27263 MENDENHALL RD 5700 - 6268 H2q 27263 MENDENHALL RD 6100 - 6734 H1t 27263 MENDENHALL RD EXT 5500 - 5985 H2r 27263 MENDENHALL RD EXT 5800 - 5985 H2q 27263 MEREDELL FARM RD 4105 - 4200 G7 27298 MEREDITH CTRY RD 3200 - 3531 B4b 27205 MEREDITH DR 100 - 318 H2n 27263 MERLE DR 5500 - 5686 G2f 27370 MEYERS ST 5000 - 5133 H1t 27263 MEYERS ST 5000 - 5054 G1h 27263 MICHAEL DR 6500 - 6874 D8 27316 MIDDLE POINT RD 6500 - 6685 H1o 27263 MIDDLE POINT RD 6500 - 6685 H1p 27263 MIDDLETON CIR 1300 - 1388 D4a 27205 MIDWAY ACRES RD 3400 - 3831 B5a 27205 MIDWAY FORREST DR 100 - 155 H4p 27317 MIDWAY VIEW DR 3309 - 3400 F5m 27317 MILBROOK DR 1400 - 1450 D4a 27205 MILES MOFFITT RD 1263 - 1646 D5d 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-74 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP MILES MOFFITT RD 1377 - 1646 C5 27205 MILL CREEK RD 1100 - 2648 D7a 27316 MILL CREEK RD 1211 - 2648 D7 27316 MILL CREEK RDG 4031 - 4100 D6d 27205 MILL CREEK RDG 3989 - 4030 D6d 27205 MILL HOUSE LN 988 - 1100 E6n 27248 MILL POND DR 2000 - 2100 E4a 27350 MILL POND DR EXT 2159 - 2193 E4a 27350 MILL RACE CT 2085 - 2200 E3b 27350 MILL RACE CT 2085 - 2200 E4e 27350 MILL RACE CT 2085 - 2200 E4a 27350 MILL ST 100 - 208 F5i 27317 MILLBORO RD 2012 - 2563 F5o 27248 MILLBORO RD 2012 - 2985 F5d 27248 MILLER CTRY DR 1596 - 1700 D4a 27205 MILLER FARM DR 3099 - 3500 G2c 27370 MILLER FARM DR 3099 - 3500 F2a 27370 MILLERS MILL RD 3400 - 5145 G2d 27370 MILLERS MILL RD 3400 - 4495 F2b 27370 MILLERS MILL RD 4792 - 5145 G3q 27370 MILLIE LN 5300 - 5619 A4 27205 MILLIKAN AVE 402 - 415 E5m 27203 MILLIKAN FARM RD 3700 - 3946 F5b 27248 MILLIKAN RD 3587 - 4082 F4a 27350 MILLIKAN WAY 500 - 635 H5c 27317 MILTON DR 5559 - 5600 G6b 27233 MILTON RD+-B4372 7104 - 7200 A6 27341 MIMOSA CT 2900 - 2975 F5q 27317 MIN LEE DR 1366 - 1600 D3c 27205 MINT HILL DR 4742 - 4900 F7 27298 MISSION HTS 100 - 209 E7q 27316 MISSIONARY CHURCH DR 3600 - 3631 H1k 27260 MISTY DR 100 - 447 E1 27360 MISTY LN 100 - 103 H2o 27263 MITCHELL ESTATES ST 4242 - 4273 G3s 27350 MITCHELL ST 100 - 110 H2o 27263 MOBILE CT 3461 - 3500 H6t 27233 MOBILE CT 3461 - 3500 G6b 27233 MOBILE DR 5594 - 5697 G3b 27263 MOBILE DR 5594 - 5697 G3k 27263 MOFFITT MILL RD 4100 - 4877 B7 27316 MOFFITT MILL RD 4100 - 4425 C7 27316 MOFFITT RD 715 - 1100 D3d 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-75 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP MOFFITT RD EXT 654 - 680 D3d 27205 MOFFITT ST 800 - 811 E7r 27316 MONARCH LN 1777 - 1900 E4s 27205 MONDA RD 2775 - 3000 G6b 27233 MONROE AVE 700 - 1020 D4r 27205 MONROE AVE 700 - 962 D4s 27205 MONTANA DR 4200 - 4235 G1j 27360 MONTANA DR 4200 - 4350 G1k 27360 MONTCLAIR CT 3100 - 3237 B4b 27205 MONTEREY RD 2900 - 3906 B4b 27205 MONTLEY VIEW DR 1000 - 1075 C4f 27205 MOODY ST 1322 - 1341 E4t 27203 MOONLIGHT MEADOW RD 4000 - 4060 B2 27205 MOONS CHAPEL RD 1036 - 1036 E8 27344 MOORE AVE 100 - 199 F5j 27317 MOORE AVE 100 - 115 F5f 27317 MOORE RD 1000 - 1927 D3a 27205 MOORE RD 1200 - 2300 D3c 27205 MORAN DR 4319 - 4500 B5 27205 MORELAND RD 6019 - 6100 C7 27344 MORGAN AVE 700 - 850 D4o 27205 MORGAN AVE 700 - 850 D4p 27205 MORGAN AVE 700 - 850 D4s 27205 MORGAN CTRY RD 400 - 649 D5f 27203 MORGAN ST 5500 - 5689 G2f 27370 MORGAN ST 100 - 121 F5i 27317 MORNING GLORY RD 294 - 748 E5e 27317 MORNING GLORY RD 660 - 811 E5f 27317 MORNING SIDE LN 4333 - 4500 F2d 27370 MORNING VIEW RD 881 - 1200 A5 27341 MORNINGDEW DR 2810 - 3017 F4c 27350 MORNINGDEW DR 2810 - 3017 E4e 27350 MORNINGSIDE RD 111 - 230 F4d 27317 MORRIS RD 3600 - 4021 G2c 27370 MORTON AVE 507 - 740 C4h 27205 MOSE DR 5800 - 5932 H3q 27263 MOUNTAIN AVE 100 - 247 F4h 27317 MOUNTAIN BROOK RD 300 - 522 E3c 27205 MOUNTAIN BROOK RD EXT 3554 - 3600 E3c 27205 MOUNTAIN CREEK RD 3620 - 4200 B4 27205 MOUNTAIN LAKE RD 2300 - 2668 E4o 27205 MOUNTAIN LAKE RD 2418 - 2668 E4c 27205 MOUNTAIN LAUREL LN 2600 - 2729 C5c 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-76 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP MOUNTAIN MEADOW DR 1600 - 1894 E2b 27205 MOUNTAIN MEADOW DR 1600 - 1894 E3a 27205 MOUNTAIN OAK VIEW DR 2500 - 2752 D6a 27205 MOUNTAIN OAKS DR 2500 - 2606 E6a 27248 MOUNTAIN OF FAITH RD 1700 - 1895 D6c 27205 MOUNTAIN RD 500 - 1255 D4g 27205 MOUNTAIN TER 3600 - 3717 E3c 27205 MOUNTAIN TOP DR 400 - 500 D5j 27203 MOUNTAIN VALLEY DR 900 - 1092 E4o 27205 MOUNTAIN VALLEY PL 846 - 900 E4o 27205 MOUNTAIN VIEW DR 1205 - 1500 E2b 27205 MOUNTAIN VIEW RD 2400 - 2527 B3 27205 MOUNTAIN VIEW WAY 7300 - 7451 G1r 27360 MOUNTAINVIEW ST 3200 - 3437 G2c 27370 MOUNTAINVIEW ST 3200 - 3437 F2a 27370 MT CROSS ST 400 - 577 D4h 27203 MT GILEAD CHURCH RD 3800 - 4685 F3a 27350 MT GILEAD CHURCH RD 4105 - 4739 F2b 27350 MT GILEAD CHURCH RD 4105 - 4685 F2d 27350 MT LEBANON RD 5024 - 6824 A3 27205 MT LEBANON RD 5024 - 5784 B3 27205 MT OLIVE CHURCH RD 3135 - 3900 F3a 27350 MT OLIVE CHURCH RD 3685 - 3900 F3b 27350 MT OLIVET CHURCH RD 900 - 1096 E7b 27298 MT SHEPHERD RD 100 - 1105 E2d 27205 MT SHEPHERD RD EXT 400 - 1049 E2b 27205 MT SHEPHERD RD EXT 400 - 1049 E2d 27205 MT TABOR CHURCH RD 1151 - 1256 D6c 27205 MT VIEW CHURCH RD 700 - 1552 E3c 27205 MT VIEW CHURCH RD 1314 - 1965 E3a 27205 MT VIEW CHURCH RD 1600 - 1965 E3b 27205 MT VIEW CHURCH RD 1600 - 2081 E3d 27205 MUDDY CREEK RD 5600 - 6150 G3b 27263 MUDDY CREEK RD 5600 - 5777 G3k 27263 MUDDY CREEK RD 5973 - 7124 H3d 27263 MULBERRY ACADEMY ST 1400 - 2281 E6b 27248 MULBERRY ACADEMY ST 1400 - 2760 E7a 27248 MURIEL LN 1192 - 1300 C4e 27205 MURRAY CIR 2400 - 2425 H2m 27263 MUSTANG TRL 6533 - 6700 A6 27341 MYRTLE ST 400 - 711 D4s 27205 N ASHEBORO ST 700 - 845 G8k 27298 N ASHEBORO ST 100 - 845 G8o 27298 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-77 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP N BRADY ST 100 - 157 E7r 27316 N BROAD ST 100 - 491 A5j 27341 N BROAD ST 400 - 671 A5f 27341 N CHERRY ST 100 - 399 D4l 27203 N CHERRY ST 300 - 420 D4k 27203 N CHURCH ST 300 - 530 D4h 27203 N CHURCH ST 151 - 383 D4l 27203 N COBLE ST 100 - 131 F5e 27317 N COX ST 100 - 350 D4l 27203 N DEPOT ST 100 - 161 G8o 27298 N ELM ST 100 - 433 D5i 27203 N ELM ST 260 - 667 D5e 27203 N FAUST ST 100 - 230 G8o 27298 N FAYETTEVILLE ST 400 - 1229 D4h 27203 N FAYETTEVILLE ST 1932 - 2333 E5i 27203 N FAYETTEVILLE ST 1238 - 1561 E5q 27203 N FAYETTEVILLE ST 2284 - 4509 E5e 27203 N FAYETTEVILLE ST 1528 - 1965 E5m 27203 N FAYETTEVILLE ST 700 - 818 G8k 27298 N FAYETTEVILLE ST 100 - 818 G8o 27298 N FAYETTEVILLE ST 100 - 472 D4l 27203 N FAYETTEVILLE ST 1106 - 1249 E4t 27203 N FOSTER ST 100 - 652 G8n 27298 N GREENBRIAR ST 700 - 820 G8k 27298 N GREENBRIAR ST 500 - 820 G8o 27298 N GREENSBORO ST 700 - 922 G8k 27298 N GREENSBORO ST 100 - 844 G8o 27298 N HIGH ST 100 - 139 D5i 27203 N KIRKMAN ST 300 - 337 G8n 27298 N MAIN ST 400 - 1129 F5e 27317 N MAIN ST 100 - 338 F5i 27317 N MAIN ST 226 - 536 F8o 27355 N MAIN ST 100 - 426 F8p 27355 N MAIN ST 10400 - 11652 H2o 27263 N MAIN ST 10000 - 10476 H2p 27263 N MAIN ST 100 - 324 D4l 27203 N MAIN ST 11600 - 11652 H2k 27263 N MAIN ST 100 - 225 F8t 27355 N MCCRARY ST 300 - 771 D4g 27205 N MCCRARY ST 100 - 433 D4k 27203 N MYRTLE ST 400 - 499 G8o 27298 N OAKDALE ST 500 - 606 D4a 27205 N OAKDALE ST 500 - 606 D4k 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-78 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP N OAKDALE ST 500 - 606 D4n 27205 N OAKDALE ST 500 - 606 D4o 27205 N PARK DR 926 - 1024 D4g 27205 N PARK ST 100 - 400 D4l 27203 N PARK ST 329 - 400 D4h 27203 N RANDOLPH AVE 100 - 139 D5i 27203 N RANDOLPH ST 100 - 229 G8o 27298 N REECE ST 100 - 240 G8n 27298 N ROCKRIDGE RD 1041 - 1260 D4g 27205 N ROCKRIDGE RD 1167 - 1260 E4s 27205 N SMITH ST 200 - 647 G8n 27298 N STALEY ST 500 - 638 G8n 27298 N STALEY ST 100 - 510 F8p 27355 N STOUT ST 217 - 302 F5e 27317 N STOUT ST 100 - 234 F4l 27317 N STOUT ST 217 - 234 F5i 27317 N TIMBERLEA ST 500 - 616 G8o 27298 N TREMONT DR 1526 - 1561 E4t 27203 N TREMONT DR 1547 - 1561 E4p 27203 NANCE CTRY DR 3100 - 3356 H6d 27233 NANCE CTRY DR 3293 - 3356 H6t 27233 NANCE RD 1100 - 1542 E6a 27248 NANCE RD 1100 - 1292 E6n 27248 NANCE RD EXT 1400 - 1475 E6a 27248 NANCY LN 6600 - 6688 F1g 27370 NAOLA CT 100 - 208 H2m 27263 NAOMI RD 1142 - 1922 F5f 27317 NAOMI RD 1700 - 2383 F5b 27248 NASSAU TRL 364 - 838 C4t 27205 NASSAU TRL 364 - 549 B4b 27205 NATHAN LN 7579 - 7700 A6 27341 NATHANS TRL 1875 - 2100 C4c 27205 NATHANS TRL 1875 - 2100 C4o 27205 NAVAJO DR 301 - 408 H2t 27263 NC HWY 109 8700 - 8978 A1 28127 NC HWY 134 4000 - 5247 B4 27205 NC HWY 134 2600 - 4633 B4b 27205 NC HWY 134 2600 - 3011 C4s 27205 NC HWY 134 2600 - 3011 C4t 27205 NC HWY 134 4905 - 7296 A4 27205 NC HWY 22 42 4900 - 5334 C7 27316 NC HWY 22 42 5220 - 6568 C8 27316 NC HWY 22 42 6200 - 8774 B8 27208 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-79 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP NC HWY 22 N 6700 - 8476 G6b 27233 NC HWY 22 N 8219 - 9216 H6d 27233 NC HWY 22 N 523 - 771 E7m 27316 NC HWY 22 N 5839 - 7204 G6d 27233 NC HWY 22 N 3300 - 6281 F6 27233 NC HWY 22 N 100 - 535 E7q 27316 NC HWY 22 N 1951 - 3022 E6o 27248 NC HWY 22 N 3100 - 3791 E6b 27248 NC HWY 22 N 700 - 955 E6p 27316 NC HWY 22 S 3300 - 4863 C7 27344 NC HWY 22 S 1892 - 3480 D7 27316 NC HWY 22 S 785 - 1117 D7a 27316 NC HWY 22 S 900 - 2178 D7b 27316 NC HWY 42 N 100 - 414 D5j 27203 NC HWY 42 N 300 - 633 D5i 27203 NC HWY 42 S 800 - 2401 D5d 27205 NC HWY 42 S 2300 - 3009 C5 27205 NC HWY 42 S 2900 - 4634 C6a 27205 NC HWY 42 S 6500 - 8899 C7 27316 NC HWY 42 S 4900 - 6497 C6d 27316 NC HWY 42 S 100 - 821 D5n 27205 NC HWY 42 S 4300 - 5290 C6b 27205 NC HWY 42 S 100 - 185 D5j 27205 NC HWY 47 6400 - 7402 B1 27239 NC HWY 49 N 100 - 725 E7n 27316 NC HWY 49 N 600 - 1370 E7o 27316 NC HWY 49 N 2200 - 4520 F8c 27316 NC HWY 49 N 1800 - 2681 E7b 27316 NC HWY 49 N 2200 - 2681 E8 27316 NC HWY 49 N 1200 - 1784 E7k 27316 NC HWY 49 N 7386 - 7483 G8b 27298 NC HWY 49 N 6865 - 7483 G8d 27298 NC HWY 49 N 6833 - 6979 G8o 27298 NC HWY 49 N 1600 - 2124 E7l 27316 NC HWY 49 N 4400 - 5271 F8a 27298 NC HWY 49 N 5200 - 5865 F8b 27298 NC HWY 49 N 100 - 257 E7r 27316 NC HWY 49 N 5824 - 5865 G8s 27298 NC HWY 49 S 1066 - 1963 D4c 27205 NC HWY 49 S 200 - 1237 D4r 27205 NC HWY 49 S 7000 - 7567 C1 27239 NC HWY 49 S 7400 - 10127 B1 27239 NC HWY 49 S 2900 - 4472 C3a 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-80 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP NC HWY 49 S 4000 - 7146 C2 27239 NC HWY 49 S 1700 - 3433 C3b 27205 NC HWY 49 S 100 - 335 D4o 27205 NC HWY 49 S 1700 - 1963 D3d 27205 NC HWY 49 S 200 - 335 D4s 27205 NC HWY 62 6600 - 7621 H2r 27370 NC HWY 62 4106 - 5040 G1k 27360 NC HWY 62 4100 - 4214 G1j 27360 NC HWY 62 5700 - 6709 G2e 27370 NC HWY 62 6600 - 6709 G2f 27370 NC HWY 62 4951 - 5620 G1l 27370 NC HWY 62 5500 - 6007 G1h 27370 NC HWY 62 7600 - 7621 H2n 27370 NC HWY 705 900 - 2120 A5 27341 NC HWY 705 770 - 1032 A5k 27341 NC HWY 705 2121 - 2659 A6 27341 NEAL ST 100 - 125 F5i 27317 NEE NEE LN 6400 - 6447 H3o 27263 NEE NEE LN 6400 - 6447 H3d 27263 NEEDHAMS TRL 4880 - 5500 B5 27341 NEEDHAMS TRL 4880 - 5500 A5 27341 NEEDHAMS TRL 4880 - 5500 A6 27341 NEELY DR 1000 - 1342 E4s 27205 NEELY DR 1000 - 1243 D4g 27205 NEELY RD 700 - 1001 D4c 27205 NELSON PARK RD 4500 - 4804 G4c 27350 NELSON PARK RD 4500 - 4693 F4a 27350 NELSON PL 2900 - 3183 F5d 27248 NELSON POND DR 3800 - 3891 F6 27248 NELSON RD 3499 - 4000 F3a 27350 NEVIT LN 1200 - 1461 E6a 27248 NEVIT LN 1200 - 1461 E6n 27248 NEW CENTER CHURCH RD 6300 - 7264 A6 27341 NEW CENTURY DR 700 - 960 C4g 27205 NEW HOPE CHURCH RD 3400 - 3870 B4b 27205 NEW HOPE CHURCH RD 4535 - 6358 A4 27205 NEW HOPE CHURCH RD 3750 - 5041 B4 27205 NEW HOPE RD 4900 - 7199 B1 27239 NEW HOPE RD 6900 - 8592 A1 27239 NEW HOPE RD 6100 - 6876 B2 27239 NEW SALEM RD 2500 - 3826 G6a 27233 NEW SALEM RD 2200 - 3271 G6c 27233 NEW SALEM RD 600 - 2436 G5d 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-81 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP NEW SALEM RD 100 - 416 G5c 27317 NEW SALEM RD 217 - 1254 G5r 27317 NEW SALEM RD 3502 - 4197 G6b 27233 NEW SALEM RD 100 - 191 F5e 27317 NEW YORK DR 100 - 217 G1f 27360 NEWB HILL RD 4276 - 4500 F4a 27350 NEWBERN AVE 303 - 964 D5q 27205 NEWBERN AVE 160 - 500 D4t 27205 NEWELL ST 1732 - 1746 E5m 27203 NEWELL ST 1800 - 1835 E5m 27203 NEWELL ST 2106 - 2115 D7e 27316 NEWELL ST EXT 4427 - 4455 D7e 27316 NEWLIN FARM RD 5000 - 5103 G3d 27350 NEWMAN TRL 833 - 900 F5r 27317 NICHOLS CRANFORD RD 7400 - 7816 A1 27239 NICKI ST 400 - 500 D4s 27205 NIGHTHAWK RD 1605 - 1700 E3a 27205 NIGHTWOOD DR 5320 - 5597 G5b 27317 NINA COLTRANE LN 1812 - 1894 G4a 27317 NIXON FARM RD 4000 - 4339 G5d 27248 NIXON FARM RD 4000 - 4339 F5b 27248 NOAH RD 5200 - 5260 E7o 27316 NOAHS TRL 3752 - 3797 F3a 27350 NOLA ST 5300 - 5345 G2j 27370 NOLA ST EXT 4700 - 4766 G2j 27370 NOLEN AVE 100 - 340 D4t 27205 NOLEN AVE EXT 300 - 352 D4t 27205 NORMAN AVE 200 - 225 H2s 27370 NORMAN AVE 100 - 215 G2g 27370 NORMAN ST 700 - 851 D4k 27205 NORRIS ST 100 - 163 E6o 27248 NORTH ASHEBORO SCHOOL RD 1814 - 2300 E4p 27203 NORTH CLUB DR 252 - 400 E3c 27205 NORTH LAKE DR 600 - 801 C5c 27205 NORTH LAKE DR 600 - 801 C5i 27205 NORTH MEADOWS LOOP 2320 - 2584 E5f 27317 NORTH MEADOWS LOOP 2320 - 2362 E5i 27317 NORTH MEADOWS LOOP 2320 - 2353 E5j 27317 NORTH MEADOWS LOOP 2354 - 2557 E5e 27317 NORTH PIN OAK DR 4200 - 4282 F5f 27317 NORTH POINTE DR 1724 - 1800 C5j 27205 NORTH ST 100 - 143 A5j 27341 NORTH ST 100 - 191 D4l 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-82 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP NORTHAMPTON DR 400 - 646 D4t 27205 NORTHAMPTON DR 400 - 610 D5q 27205 NORTHEAST DR 100 - 215 H2o 27263 NORTHLAND DR 5200 - 5378 G3k 27263 NORTHMONT DR 1900 - 2562 E4o 27205 NORTHMONT DR 1900 - 2103 E4s 27205 NORTHMONT LAKE DR 2400 - 2590 E4o 27205 NORTHRIDGE DR 100 - 127 D4k 27205 NORTHSHORE DR 791 - 1000 E5q 27203 NORTHSHORE DR 791 - 835 D5e 27203 NORTHSIDE TER 1100 - 1321 E4t 27203 NORTHSIDE TER 908 - 1236 D4h 27203 NORTHVIEW DR 100 - 312 D5g 27203 NORTHVIEW PL 100 - 106 H2o 27263 NORTHWOOD DR 100 - 520 E4h 27203 NORTHWOOD DR 100 - 520 E5e 27203 NORTHWOODS CT 600 - 606 G5r 27317 NORWOOD CT 2300 - 2322 F2d 27370 NORWOOD LN 2974 - 3000 D6f 27205 NOTTINGHAM ST 1590 - 1668 E4p 27203 NUBY PURVIS RD 8300 - 8522 A8 27325 NUGGETT CT 4853 - 4900 G1g 27360 O H STALEY RD 6300 - 7148 D8 27316 OAK BEND DR 700 - 900 E5m 27203 OAK BROOK CT 4300 - 4357 F2b 27370 OAK BUCKET RD 7323 - 7400 G1r 27360 OAK CT 6575 - 6600 G1l 27370 OAK DR 1800 - 1941 D4s 27205 OAK FOREST LN 100 - 227 G2h 27370 OAK FOREST LN 100 - 105 G2l 27370 OAK GROVE CHURCH RD 3900 - 5501 C2 27205 OAK GROVE CHURCH RD 4273 - 6109 B2 27205 OAK HAVEN CT 4200 - 4215 G1l 27370 OAK HAVEN DR 4100 - 4326 G1l 27370 OAK HILL DR 4200 - 4411 G6d 27233 OAK HOLLOW DR 2600 - 2849 C3a 27205 OAK HOLLOW DR 2600 - 2734 C3b 27205 OAK HOLLOW TRL 2900 - 3095 F6 27248 OAK KNOLL CT 6600 - 6720 G1g 27360 OAK KNOLL CT 6600 - 6640 G1h 27360 OAK KNOLL DR 5734 - 5900 H2m 27370 OAK LEAF PL 4200 - 4231 F5f 27317 OAK LEAF RD 100 - 700 D4r 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-83 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP OAK LEAF RD 324 - 673 D4s 27205 OAK LEAF RD 100 - 283 D4n 27205 OAK LN 100 - 212 F5e 27317 OAK RIDGE DR 100 - 317 H3m 27263 OAK ST 100 - 148 E6p 27248 OAK ST 460 - 477 E7r 27316 OAK TREE RD 4007 - 4200 B4 27205 OAK VIEW LN 100 - 587 B5c 27205 OAK WAY 100 - 121 H3m 27263 OAKDALE AVE 600 - 606 G8k 27298 OAKDALE DR 1100 - 1190 C4c 27205 OAKDALE ST 996 - 1038 D4p 27203 OAKGROVE RD 100 - 817 D4n 27205 OAKGROVE RD 746 - 817 D4o 27205 OAKHURST DR 0 - 123 D4k 27205 OAKHURST RD 100 - 544 C4l 27205 OAKHURST RD 100 - 382 C4h 27205 OAKLAND AVE 1100 - 1442 D4h 27203 OAKLAND CHURCH RD 300 - 317 E7o 27316 OAKLEY CT 100 - 112 H3q 27263 OAKLEY RD 3500 - 3598 F6 27248 OAKMONT CIR 101 - 809 H2p 27263 OAKMONT DR 400 - 1139 D4g 27205 OAKMONT DR 1000 - 1139 E4s 27205 OAKMONT DR 1200 - 1700 E4s 27205 OAKMONT VIEW RD 1300 - 1376 H1o 27260 OAKRIDGE LN 1032 - 1100 G5b 27317 OAKSPRING LN 100 - 199 H2p 27263 OAKVIEW DR 4400 - 4795 G3n 27370 OAKWOOD ACRES RD 800 - 855 D4r 27205 OAKWOOD ACRES RD 800 - 1237 C4f 27205 OAKWOOD CT 7200 - 7235 F1f 27360 OAKWOOD DR 4472 - 4800 G2j 27370 OAKWOOD DR 4687 - 4800 G2f 27370 OAKWOOD TRL 4517 - 4700 G5r 27317 OCCONEECHEE AVE 800 - 918 D4k 27203 ODAT TRL 1937 - 2000 C6a 27205 OFFICE PKWY 1 - 99 H2n 27370 OGLES CREEK ST 4600 - 4682 E6t 27316 OLD 421 RD 2427 - 4040 F8b 27298 OLD 421 RD 2400 - 2729 F8p 27355 OLD 421 RD 7500 - 8704 H7d 27298 OLD 421 RD 6700 - 7784 H8 27298 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-84 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP OLD 421 RD 8705 - 9235 H7c 27283 OLD 421 RD 5700 - 6931 G8a 27298 OLD 421 RD 5431 - 5951 G8k 27298 OLD 421 RD 5700 - 5951 G8j 27298 OLD 421 RD 3900 - 4040 G8s 27298 OLD ASHEBORO RD 1800 - 2000 D6d 27205 OLD ASHEBORO RD EXT 2001 - 2050 D6d 27205 OLD BACHELOR CREEK RD 3300 - 3639 B6b 27341 OLD BELL RD 300 - 354 G5c 27317 OLD BROWER MILL RD 3300 - 3515 F6 27248 OLD BUFFALO FORD RD 1600 - 1833 D5d 27205 OLD CASTLE DR 601 - 828 E5f 27317 OLD CASTLE DR 500 - 635 F5q 27317 OLD CASTLE DR 601 - 635 F5r 27317 OLD CEDAR FALLS RD 2900 - 3653 E5d 27203 OLD CEDAR FALLS RD 1900 - 3299 E5s 27203 OLD CEDAR FALLS RD 1345 - 2892 D5f 27203 OLD CEDAR FALLS RD 3500 - 3971 E6m 27317 OLD CEDAR FALLS RD 1117 - 1401 D5i 27203 OLD CEDAR FALLS RD 1900 - 2892 D5g 27203 OLD CEDAR FALLS RD 1345 - 1401 D5j 27203 OLD CEDAR SQUARE RD 5400 - 5600 G3k 27263 OLD CLIMAX RD 2100 - 2537 H6c 27313 OLD COLERIDGE RD 2889 - 5371 C8 27344 OLD COLERIDGE RD 4600 - 5371 C7 27344 OLD COLERIDGE RD 1400 - 3090 D8 27344 OLD COUNTY FARM RD 1988 - 2797 E4a 27350 OLD COUNTY FARM RD 1700 - 2308 E3b 27350 OLD COUNTY FARM RD 1400 - 1987 E3d 27350 OLD COUNTY FARM RD 2600 - 3071 E4e 27350 OLD COURTHOUSE RD 3820 - 4199 F4k 27350 OLD COURTHOUSE RD 3820 - 4067 F4a 27350 OLD COURTHOUSE RD 3820 - 4067 F4c 27350 OLD COX RD 1800 - 3774 C5 27205 OLD COX RD 1200 - 1737 C5f 27205 OLD COX RD 1385 - 2247 C5j 27205 OLD COX RD 3200 - 4460 B5 27205 OLD COX RD 1200 - 1286 C5e 27205 OLD CROSSING DR 3000 - 3143 E5b 27317 OLD CROSSING DR 3000 - 3143 E6a 27317 OLD DEPOT DR 100 - 200 C4o 27205 OLD EDGAR RD 4400 - 5433 G3o 27350 OLD EDGAR RD 4400 - 5039 G3d 27350 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-85 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP OLD EDGAR RD 4400 - 5039 G3s 27350 OLD ENGLISH FARM RD 100 - 999 H2n 27370 OLD ENGLISH FARM RD 100 - 999 H2o 27370 OLD ENGLISH FARM RD 100 - 999 H2s 27370 OLD FARM RD 7400 - 7479 G1n 27360 OLD FARMER RD 1100 - 1873 D4k 27205 OLD FARMER RD 1800 - 2177 D4o 27205 OLD FARMER RD 2100 - 2561 D4n 27205 OLD FLINT HILL RD 3340 - 3499 F3a 27350 OLD FLINT HILL RD EXT 3169 - 3340 F3a 27350 OLD FOREST CT 1027 - 1100 D3d 27205 OLD GLENOLA RD 3200 - 4133 G3j 27263 OLD GLENOLA RD 3700 - 4247 G3i 27370 OLD GLENOLA RD 3200 - 3280 G3k 27263 OLD GREENSBORO RD 4656 - 5474 G5n 27317 OLD GREENSBORO RD 4500 - 4869 G5r 27317 OLD GREENSBORO RD 5475 - 5713 G5a 27317 OLD HIGH POINT ST 4200 - 4701 F4k 27317 OLD HOCKETT LN 7041 - 7100 H4d 27317 OLD HOCKETT LN EXT 6980 - 7014 H4d 27317 OLD HOPEWELL CHURCH RD 4700 - 4731 G2e 27370 OLD HOPEWELL CHURCH RD 4600 - 4698 G2i 27370 OLD HUMBLE MILL RD 1700 - 2921 C5 27205 OLD LEXINGTON RD 2800 - 4417 E3d 27205 OLD LEXINGTON RD 1630 - 3256 E4c 27205 OLD LEXINGTON RD 4306 - 5514 E3c 27205 OLD LEXINGTON RD 1458 - 1895 D4a 27205 OLD LEXINGTON RD 1458 - 1629 D4g 27205 OLD LIBERTY RD 3500 - 5256 F6c 27248 OLD LIBERTY RD 936 - 1427 E5j 27203 OLD LIBERTY RD 4800 - 7043 F6 27248 OLD LIBERTY RD 217 - 935 E5m 27203 OLD LIBERTY RD 100 - 238 E5q 27203 OLD LIBERTY RD 1413 - 2270 E5k 27203 OLD LIBERTY RD 7044 - 9525 G7 27298 OLD LIBERTY RD 6900 - 7425 F7 27298 OLD LIBERTY RD 2805 - 3858 F5d 27248 OLD LIBERTY RD 2000 - 3023 E5b 27317 OLD LIBERTY RD 9416 - 10286 G8c 27298 OLD LIBERTY RD 10000 - 10286 G8n 27298 OLD LIBERTY RD 10000 - 10286 G8r 27298 OLD LIBERTY RD 900 - 1050 E5n 27203 OLD MAPLE SPRINGS RD 5700 - 5756 A5j 27341 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-86 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP OLD MARLBORO RD 3100 - 3660 G3s 27350 OLD MARLBORO RD 4022 - 5099 F3a 27350 OLD MARLBORO RD 3600 - 4341 G3r 27350 OLD MEADOWBROOK RD 5229 - 5300 H2r 27370 OLD MENDENHALL RD 5700 - 6457 H1l 27263 OLD MENDENHALL RD 5600 - 6267 H1p 27263 OLD MILL FORD TRL 1137 - 1430 D6d 27205 OLD MILL FORD TRL 1137 - 1199 D6b 27205 OLD MILL RD 1800 - 1918 D3c 27205 OLD MOFFITT RD 3500 - 4028 B6b 27341 OLD MOFFITT RD 3500 - 4028 B7 27341 OLD MOUNTAIN RD 1921 - 3515 F1b 27370 OLD MOUNTAIN RD 1600 - 2011 F1 27360 OLD MOUNTAIN RD 2513 - 3086 F1g 27370 OLD MOUNTAIN RD 3191 - 3673 G1t 27370 OLD NC HWY 13 4900 - 7222 B5 27205 OLD NC HWY 13 3000 - 4836 C6c 27205 OLD NC HWY 13 6400 - 7993 B5c 27205 OLD NC HWY 13 4600 - 5489 B6 27205 OLD NC HWY 13 3000 - 4041 C6d 27205 OLD NC HWY 13 3000 - 3616 C6a 27205 OLD NC HWY 49 3400 - 5210 D3c 27205 OLD NC HWY 49 4310 - 7350 C2 27239 OLD NC HWY 49 2000 - 3684 D3d 27205 OLD NC HWY 49 900 - 1369 D4r 27205 OLD NC HWY 49 1100 - 2101 D4c 27205 OLD NC HWY 49 4310 - 5210 D2 27205 OLD PARK RD 4300 - 4477 F2b 27370 OLD PLACE RD 3543 - 3800 C2 27239 OLD PLANK RD 1800 - 2157 F4a 27350 OLD PLANK RD 100 - 671 A5j 27341 OLD PLANK RD 100 - 136 A5k 27341 OLD PLANK RD 500 - 731 A5f 27205 OLD POOLE RD 5600 - 5898 G3f 27263 OLD POST OFFICE RD 6415 - 6932 E1 27360 OLD PROVIDENCE RD 5800 - 5912 G5b 27317 OLD RED CROSS RD 3644 - 4227 H7c 27283 OLD RED CROSS RD 3100 - 3643 G6b 27233 OLD RED CROSS RD 3615 - 4058 H6t 27233 OLD ROAD DR 100 - 142 E2d 27205 OLD ROCKETT RD 7100 - 7430 H4p 27317 OLD ROCKETT RD 7100 - 7341 H4d 27317 OLD SCHOOL RD 10 - 5542 H2s 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-87 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP OLD SECOND ST 7310 - 7310 H7c 27283 OLD SETTLEMENT RD 1800 - 1939 F5d 27248 OLD SILER CITY RD 5400 - 6641 D7b 27316 OLD SILER CITY RD 6400 - 8211 D8 27316 OLD SPENCER RD 3198 - 3399 G3k 27263 OLD SPRUCE DR 100 - 161 D5g 27203 OLD STAGECOACH RD 2500 - 2920 D6f 27205 OLD STAGECOACH RD 2500 - 2686 D6e 27205 OLD STALEY RD 6300 - 7173 F8c 27355 OLD STALEY RD 6900 - 7778 F8s 27355 OLD STALEY RD 7400 - 7778 F8t 27355 OLD STATE HWY 1000 - 1299 C4h 27205 OLD STATE HWY 1106 - 1299 C4l 27205 OLD THOMASVILLE RD 986 - 1240 H1k 27260 OLD THOMASVILLE RD 1200 - 5899 H1o 27260 OLD THOMASVILLE RD 5400 - 5637 H1n 27263 OLD TOBACCO RD 3400 - 3671 G3n 27370 OLD TREE RD 3200 - 3377 C1 27239 OLD TROY RD 5800 - 6572 A4 27205 OLD TURNPIKE RD 4800 - 4999 G2e 27263 OLD US 220 HWY 5900 - 6788 A5 27341 OLD US HWY 64 6400 - 8218 E1 27292 OLD US HWY 64 6400 - 6682 E2c 27370 OLD UWHARRIE RD 3815 - 4100 B2 27205 OLD WALKER MILL RD 4675 - 5900 G4b 27317 OLD WALKER MILL RD 4141 - 5032 G4d 27317 OLD WALKER MILL RD 5520 - 6200 G5a 27317 OLD WAY RD 4013 - 4242 F4a 27350 OLDE MAIN TERRACE DR 100 - 142 D4l 27203 OLDE TOWNE PKWY 1100 - 1253 D4a 27205 OLIVER ST 100 - 169 F5i 27317 OLIVER ST 600 - 637 E7r 27316 OLIVERS CHAPEL RD 2600 - 2812 F8b 27355 OLIVERS CHAPEL RD 2400 - 2664 F8o 27355 OLIVERS LN 2100 - 2162 E6a 27317 ONEAL FARM RD 5000 - 5238 G2k 27370 ORA LN 5100 - 5256 E2a 27370 ORCHARD TRL 2156 - 2200 F1j 27360 ORIOLE DR 1480 - 1527 E5N 27203 ORLENDO DR 2776 - 2899 E6r 27203 OSBORN MILL RD 4166 - 6717 B6b 27341 OSBORN MILL RD 3507 - 4557 C6d 27205 OSBORN MILL RD 6100 - 6717 B6 27341 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-88 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP OSBORN ST 5146 - 5300 G2f 27370 OSPREY DR 1233 - 1300 D5d 27205 OSSIE HAYES RD 6925 - 7100 A7 27341 OTIS RD 200 - 428 D4a 27205 OTIS RD 200 - 265 D4n 27205 OVERLOOK DR 2100 - 2267 D2 27239 OVERMAN RD 7200 - 7561 F8b 27298 OXENDINE RD 5589 - 5900 G5a 27317 OXFORD DR 2100 - 2232 F8p 27355 PAIGE CT 400 - 449 C4l 27205 PAINTER RD 100 - 219 C4o 27205 PAINTER RD 100 - 219 C4p 27205 PALOMINO DR 1728 - 1900 C4i 27205 PAMPASS PL 709 - 768 E5e 27317 PANTHER CREEK RD 1700 - 2204 C5 27205 PANTHER CREEK RD 1700 - 2027 B5 27205 PANTHER MTN RD 3200 - 3758 B3 27205 PAR DR 5600 - 5655 F7 27355 PARINNA DR 5200 - 5695 E2a 27370 PARK DR 900 - 1327 D4g 27205 PARK DR 100 - 214 H3q 27263 PARK RD 1300 - 1348 D7a 27316 PARK RD 1300 - 1487 D7 27316 PARK ST 1708 - 1715 E7q 27316 PARK ST 200 - 365 F8t 27355 PARK ST 100 - 198 A5j 27341 PARK ST 401 - 421 F5i 27317 PARK TRL 100 - 140 E5e 27317 PARKER DR 1100 - 1271 C4c 27205 PARKER MILL RD 4542 - 4900 D2 27239 PARKER ST 5774 - 5900 H2m 27263 PARKS CROSSRDS CHURCH RD 100 - 1125 E8 27316 PARKS CROSSRDS CHURCH RD 1100 - 3253 D8 27316 PARKS CROSSRDS CHURCH RD 2100 - 3253 D7 27316 PARKS PALMER RD 5200 - 5655 H8 27298 PARKS PALMER RD 5200 - 5380 G8a 27298 PARKS ST 300 - 442 E6p 27248 PARKSFIELD TRL 400 - 471 E7d 27316 PARKSIDE DR 404 - 421 E4p 27203 PARKVIEW CT 101 - 116 H3q 27263 PARKVIEW ST 600 - 1048 D5i 27203 PARKWAY DR 4600 - 4793 G3m 27370 PARKWOOD RD 5285 - 5500 D7b 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-89 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP PARRISH DR 1 - 4 F4h 27317 PARRISH DR 1 - 4 F4l 27317 PARRISH FARM RD 2312 - 2600 F1g 27370 PARRISH FARM RD 2312 - 2600 F1b 27370 PARRISH HAMPTON TRL 2236 - 2400 F6 27248 PARTRIDGE LN 3338 - 3400 G3r 27350 PARTRIDGE LN 3338 - 3400 G3s 27350 PASTUREVIEW RD 1600 - 1822 C4l 27205 PASTUREVIEW RD 1600 - 1845 C4p 27205 PATRICIA DR 1100 - 1225 H5c 27313 PATRICIA DR 1100 - 1225 H5d 27313 PATRIOT WOODS DR 2080 - 2161 E4a 27205 PATRIOT WOODS DR 2000 - 2161 E4c 27205 PATTERSON GROVE RD 500 - 2139 E7a 27316 PATTERSON GROVE RD 400 - 1217 E7m 27316 PATTON AVE 200 - 485 D5j 27203 PAUL DR 300 - 400 D1 27292 PAULS AIRPORT RD 1303 - 1305 F1 27360 PAWNEE CT 100 - 105 H2t 27263 PAYNE ST 5136 - 5200 G2e 27370 PEACE FOREST LN 4600 - 4701 G6c 27233 PEACE HAVEN RD 2505 - 2974 D7 27316 PEACE HAVEN RD 2505 - 2974 C7 27316 PEACE RD 4453 - 4900 G2l 27370 PEACE RD 4453 - 4900 G2d 27370 PEACEFUL LN 4659 - 4700 G2d 27370 PEACH ST 6100 - 6137 H6d 27233 PEACHTREE ST 238 - 963 D4h 27203 PEACHTREE ST 210 - 361 D4l 27203 PEACOCK LN 4486 - 4700 G2k 27370 PEACOCK LN 4486 - 4700 G2l 27370 PEARL AVE 3700 - 4263 F3a 27350 PEARL CT 976 - 1100 E5j 27317 PEARL CT 976 - 1100 E5k 27317 PEARL LN 1900 - 2163 C4c 27205 PEARL LN 1900 - 2163 C4o 27205 PEARL FERGUSON RD 4776 - 5000 G7 27298 PEARL FERGUSON RD 4776 - 5000 G8a 27298 PEBBLE RDG 4523 - 4897 B2 27205 PEELER DR 600 - 641 G5a 27317 PENNS DR 4600 - 4643 F4h 27317 PENNSYLVANIA AVE 1416 - 1444 E5k 27203 PENNSYLVANIA AVE 1320 - 1427 E5j 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-90 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP PENNWOOD DR 600 - 629 D5e 27203 PENNY ST 100 - 116 F5i 27317 PENTECOSTAL CHURCH RD 400 - 658 E6r 27248 PEPPERIDGE RD 1400 - 1813 D5q 27205 PEPPERIDGE RD 1100 - 1664 D5m 27205 PEPPERIDGE WAY 6100 - 6195 H6t 27233 PEPPERSTONE DR 1620 - 1734 E6a 27248 PEPPERTREE RDG 2524 - 2596 E5f 27317 PERRY BLVD 2971 - 3026 F6 27248 PERRY BLVD 2971 - 3026 F6c 27248 PERRY ST 1000 - 1031 D4g 27205 PERRYMAN RD 4017 - 4200 C6d 27316 PERSHING ST 200 - 323 D4l 27203 PETE LN 4400 - 4510 G2l 27370 PETTY ST 100 - 116 H2o 27263 PHEASANT RIDGE DR 4100 - 4347 G3r 27350 PHILLIPPIE LN 3578 - 3702 G7 27355 PHILLIPS CTRY TRL 1800 - 1870 D3d 27205 PHILLIPS CTRY TRL 1800 - 1961 D4c 27205 PHILLIPS RD 782 - 900 E5j 27317 PICKETT CIR 224 - 326 G8n 27298 PICKETTS MILL RD 4400 - 6357 B7 27341 PICKETTS MILL RD 5900 - 6357 B6 27341 PIEDMONT DAIRY RD 1800 - 1875 F4a 27350 PIEDMONT ESTATES RD 3100 - 3469 H6d 27233 PIEDMONT ESTATES RD 3414 - 3737 H6t 27233 PIEDMONT ST 500 - 600 D4h 27203 PIEDMONT ST 6000 - 6038 H6d 27233 PIERCE LN 4500 - 4563 F2d 27370 PIERCE MEADOW RD 2905 - 3200 D1 27239 PIERCE MEADOW RD 2905 - 3200 C1 27239 PIKE FARM RD 2698 - 3254 F8b 27355 PIKE ST 4771 - 4900 G1h 27263 PIKE ST EXT 4644 - 4700 G1h 27263 PIKE VIEW DR 6673 - 7100 G1g 27360 PILOT CT 2106 - 2310 D6d 27205 PILOT CT 2106 - 2310 C6b 27205 PILOT MOUNTAIN RD 2687 - 3000 C6b 27205 PILOTS VIEW RD 2000 - 2228 C3b 27205 PIN OAK CT 6478 - 6500 F1b 27360 PINE CONE CT 4800 - 4846 G2d 27370 PINE CREEK RDG 2187 - 2463 D6e 27205 PINE CT 2793 - 2900 D6f 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-91 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP PINE GROVE DR 1723 - 1863 D5q 27205 PINE HILL RD 900 - 1250 D5r 27205 PINE HILL RD 1100 - 1768 C5f 27205 PINE HILL RD 1420 - 1768 C5j 27205 PINE HOLLOW DR 1821 - 1900 E5b 27317 PINE KNOLL CT 1700 - 1743 E5m 27203 PINE LAKES DR 3510 - 3700 D6d 27205 PINE LN 800 - 941 D3a 27205 PINE NEEDLE LN 4400 - 4459 G3s 27350 PINE NEEDLE LN EXT 4500 - 4562 G3s 27350 PINE NEEDLE TRL 600 - 699 E1 27360 PINE NEEDLES DR 1638 - 1700 E4c 27205 PINE RIDGE DR 3664 - 4000 G3i 27370 PINE RIDGE RD 2849 - 3000 D6f 27205 PINE ST 1200 - 1249 D4g 27205 PINE ST 100 - 225 E6o 27248 PINE TOP LN 2500 - 2525 D6a 27205 PINE VALLEY CT 201 - 226 G8s 27298 PINE VALLEY DR 4424 - 4600 F2d 27370 PINEBROOK DR 6100 - 6335 H3m 27263 PINEBROOK DR 6100 - 6335 H3q 27263 PINECREST DR 2900 - 3045 F2a 27370 PINECREST DR 113 - 145 H2p 27263 PINEFIELD DR 1379 - 1500 F4c 27350 PINEHURST DR 3100 - 3244 F5m 27317 PINEKNOLL ST 900 - 1026 G8k 27298 PINEVIEW AVE 3700 - 3833 H1k 27260 PINEVIEW DR 4600 - 4805 G3n 27370 PINEVIEW RD 736 - 1096 E4h 27203 PINEVIEW RD 1400 - 1946 E4a 27317 PINEVIEW RD 1000 - 1832 E4g 27317 PINEVIEW ST 100 - 515 E4h 27203 PINEVIEW ST 100 - 229 E5e 27203 PINEWOOD CIR 445 - 453 E7r 27316 PINEWOOD DR 6100 - 6153 G4a 27263 PINEWOOD FOREST DR 500 - 747 C4t 27205 PINEWOOD FOREST DR 587 - 903 C5c 27205 PINEWOOD RD 200 - 602 C4t 27205 PINEWOOD RD 200 - 395 C4s 27205 PINEY RIDGE CHURCH RD 4800 - 5067 B6 27341 PINEY RIDGE CHURCH RD 4800 - 5067 B6b 27341 PINNACLE DR 400 - 414 G5c 27317 PINNACLE DR 400 - 420 F5e 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-92 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP PINNACLE DR 415 - 420 F5f 27317 PINTAIL CT 4887 - 4900 G5n 27317 PISGAH CHURCH RD 2400 - 2926 B3 27205 PISGAH CHURCH RD 2400 - 2926 A3 27205 PISGAH CHURCH RD 2400 - 2926 A4 27205 PISGAH COVERED BRIDGE RD 6100 - 9253 A3 27205 PISGAH COVERED BRIDGE RD 5000 - 6526 A4 27205 PISGAH COVERED BRIDGE RD 2600 - 4681 C4c 27205 PISGAH COVERED BRIDGE RD 2000 - 2534 C4o 27205 PISGAH COVERED BRIDGE RD 3000 - 5625 B4 27205 PISGAH COVERED BRIDGE RD 2300 - 2799 C4s 27205 PISGAH RD 5400 - 6398 A4 27205 PITTSBORO ST 98 - 400 F8t 27355 PITTSBORO ST 300 - 400 F8p 27355 PLAINFIELD RD 3300 - 4590 F4c 27350 PLAINFIELD RD 3100 - 3437 E4e 27350 PLAINFIELD RD 4493 - 5048 F4a 27350 PLAINFIELD RD 4957 - 5048 F4k 27350 PLANTATION CIR 1600 - 1719 D5q 27205 PLANTATION CIR 1300 - 1663 D5m 27205 PLANTATION CT 1333 - 1400 G5d 27317 PLANTATION DR 5600 - 5691 E2a 27370 PLANTATION MANOR DR 4574 - 4700 G5d 27317 PLANTATION WAY 1000 - 1156 E2a 27370 PLANTERS PL 6454 - 6500 F1 27360 PLAYGROUND RD 300 - 605 H2j 27263 PLAYGROUND RD 600 - 704 H2n 27263 PLAYGROUND RD 300 - 319 H2k 27263 PLEASANT CROSS RD 100 - 1266 E6r 27248 PLEASANT CROSS RD 100 - 944 E6q 27203 PLEASANT CROSS RD 100 - 944 D6e 27203 PLEASANT CROSS RD 1100 - 1266 E6o 27248 PLEASANT CROSS RD 1100 - 1266 E6s 27248 PLEASANT GROVE CHURCH RD 5700 - 7177 B8 27208 PLEASANT GROVE CHURCH RD 6900 - 7720 A8 27208 PLEASANT HILL RD 4818 - 5820 B6 27341 PLEASANT HILL RD 4818 - 5820 B6b 27341 PLEASANT LOOP 2000 - 2178 F1b 27360 PLEASANT LOOP 2000 - 2178 F1 27360 PLEASANT RIDGE CHURCH RD 600 - 1318 D7e 27316 PLEASANT RIDGE CHURCH RD 1023 - 1318 D7a 27316 PLEASANT RIDGE RD 900 - 1858 D7a 27316 PLEASANT RIDGE RD 100 - 340 E6t 27248 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-93 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP PLEASANT RIDGE RD 1752 - 2432 D7 27316 PLEASANT RIDGE RD 200 - 1062 D6b 27248 PLEASANT ST 1732 - 1909 E5m 27203 PLEASANT UNION RD 900 - 2648 D2 27370 PLINEY FARLOW RD 4400 - 5074 G3n 27370 PLINEY FARLOW RD 4400 - 5074 G3o 27370 PLINEY FARLOW RD 4400 - 5074 G3r 27370 PLOTT HOUND TRL 2342 - 3000 F3d 27350 PLUM TREE RD 3600 - 4313 F6 27233 PLUM TREE RD 4205 - 4455 G6c 27233 PLUMMER DR 100 - 215 H2o 27263 PLUMMER ST 100 - 449 D4h 27203 PLYMOUTH DR 1900 - 2005 G6a 27313 PLYMOUTH ST 3200 - 3206 H2n 27263 POE RD 2700 - 2832 F8a 27355 POINTE SOUTH DR 300 - 599 F4l 27317 POINTE SOUTH DR 101 - 599 F4p 27317 POINTER LN 4100 - 4145 G3s 27350 POLLYFIELD RD 3900 - 4604 B7 27341 POLO CROWNE AVE 200 - 250 D5e 27203 POND CIR 200 - 276 E6o 27248 POND CIR 200 - 276 E6p 27248 POND SIDE DR 5800 - 5998 A3 27205 PONDEROSA HEIGHTS PL 800 - 1013 D5b 27205 PONDEROSA HEIGHTS PL 800 - 1013 D5d 27205 PONDEROSA HEIGHTS PL 1080 - 1297 D5d 27205 PONDEROSA RD 5715 - 5900 G5b 27317 POOLE RD 5461 - 6274 H3c 27263 POOLE RD 5461 - 6078 G3f 27263 POOLE RD 5292 - 6078 G3b 27263 POOLE RD 5200 - 5460 G3k 27263 POOLE RD EXT 5765 - 5807 G3k 27263 POOLE TOWN RD 1700 - 2478 D4a 27205 POOLE TOWN RD 1800 - 2478 D3b 27205 POPLAR BEND CT 156 - 200 G5a 27317 POPLAR FOREST LN 3100 - 3282 D3a 27205 POPLAR RIDGE RD 4497 - 5273 F2d 27370 POPLAR ST 100 - 255 F5i 27317 POPLAR ST 300 - 415 E5m 27203 POPLAR ST 214 - 255 F5e 27317 PORSCHE WAY 800 - 995 C5 27205 PORTAGE PKWY 1806 - 1833 E5m 27203 POST OAK RD 200 - 215 E6t 27248 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-94 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP POST RD 6030 - 6409 F1b 27360 POST RD 6079 - 6996 F1 27360 POTOMAC DR 4100 - 4164 G3i 27370 POTTERS WAY RD 500 - 730 A5 27341 POTTERY RD 2500 - 2653 A6 27341 POWELL WAY 400 - 620 H3q 27263 POWELL WAY 200 - 401 H3c 27263 POWER LINE RD 7100 - 7202 H4p 27317 POWHATAN AVE 900 - 1040 D4k 27203 PRAIRIE TRL 336 - 400 D6f 27205 PRESNELL ST 101 - 305 F5i 27317 PRESTON CT 100 - 110 H3c 27263 PRICE NOBLE RD 100 - 265 G5c 27317 PRIMROSE LN 100 - 152 E8 27316 PRINCETON CT 2958 - 3000 D6f 27205 PRISTINE VALLEY RD 3500 - 3536 F4d 27317 PROSPECT CHURCH RD 6900 - 7173 H1o 27360 PROSPECT CHURCH RD 6900 - 6988 H1s 27360 PROSPECT CHURCH RD 6989 - 7173 H1n 27360 PROSPECT CT 5400 - 5482 H1o 27263 PROSPECT ST 1700 - 6325 H1o 27263 PROSPECT ST 5000 - 5615 H1s 27360 PROSPECT ST 1585 - 1749 H1l 27260 PROSPECT ST 1700 - 1749 H1k 27260 PROVIDENCE CHURCH RD 617 - 1872 G5b 27317 PROVIDENCE CHURCH RD 1873 - 3398 G6a 27313 PROVIDENCE CHURCH RD 100 - 842 G5a 27317 PROVIDENCE CHURCH RD 2800 - 3398 G6b 27233 PROVIDENCE DR 6000 - 6166 H6c 27313 PROVIDENCE DR 6000 - 6166 G6a 27313 PROVIDENCE FARM DR 5352 - 5600 G5b 27313 PUGH DR 2700 - 2822 F6c 27248 PURVIS LN 200 - 303 H2o 27263 QUAIL CORNER RD 400 - 444 E7l 27316 QUAIL CREEK DR 1839 - 1900 E6a 27248 QUAIL CT 7400 - 7427 G1r 27360 QUAIL HOLLOW DR 6100 - 6326 H5d 27313 QUAIL HOLLOW DR 6100 - 6253 G5b 27313 QUAIL MEADOW DR 4200 - 4348 G3s 27350 QUAIL MEADOW ESTATES RD 3069 - 3300 G3s 27350 QUAIL MEADOW ESTATES RD 3237 - 3300 F3b 27350 QUAIL ROOST DR 4200 - 4300 B4 27205 QUAIL WAY 4058 - 4100 G1k 27360 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-95 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP QUAKER DR 5862 - 6200 G6a 27313 QUAKER DR 300 - 430 E4h 27203 QUAKER LAKE DR 202 - 606 H2s 27263 QUAKERWOOD DR 100 - 116 H2n 27263 QUARTER HORSE DR 6800 - 7047 G1o 27370 QUARTZ ST 3500 - 3530 D6b 27248 QUARTZ ST 3531 - 3563 D6b 27248 QUEENS MEADOW CT 1847 - 1876 D5q 27205 QUEENS RD 400 - 510 D4h 27203 QUEENS WAY 298 - 445 G5n 27317 QUENTIN DR 3600 - 3702 C6d 27205 R H DR 3300 - 3737 B3 27205 R L ROUTH DR 2208 - 2300 F6 27248 RACE TRACK RD 2200 - 2480 E3b 27350 RACE TRACK RD 2200 - 2480 E4a 27350 RACE TRACK RD EXT 2487 - 2528 E3b 27350 RACINE RD 4342 - 5419 G6c 27233 RACINE RD 5420 - 8222 G5b 27313 RACINE RD 8200 - 8906 H5d 27313 RACINE RD 8800 - 9284 H6c 27313 RACINE RD 5363 - 5554 G5d 27317 RADIANT PATH 100 - 120 G3m 27370 RAGSDALE RD 200 - 428 D5j 27203 RAILROAD AVE 200 - 699 F5i 27317 RAILROAD AVE 600 - 699 F5m 27317 RAILROAD ST 200 - 451 D4k 27203 RAILROAD ST 320 - 451 D4g 27203 RAINBOW DR 100 - 309 E5q 27203 RAINBOW LOOP 3000 - 3199 B4b 27205 RAINBOW TRL 4600 - 4763 D7 27316 RAINEY RD 1217 - 1400 F8c 27355 RAINTREE CT 750 - 832 E5f 27317 RALEIGH DR 2730 - 2900 F6c 27248 RALPH LAWRENCE RD 1100 - 2433 A6 27341 RALPH LAWRENCE RD 1100 - 1699 A5 27341 RAMBLEWOOD RD 3000 - 3136 F3a 27350 RAMBLEWOOD RD 3000 - 3136 F3b 27350 RAMBLEWOOD RD 3000 - 3136 F3c 27350 RAMBLING RD 800 - 971 E6m 27317 RAMP 0 - 0 D4p 27205 RAMPEY ST 5300 - 5368 H2r 27370 RAMSEUR JULIAN RD 1600 - 4056 F7 27298 RAMSEUR JULIAN RD 300 - 1757 E7a 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-96 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP RAMSEUR JULIAN RD 300 - 1178 E7n 27316 RAMSEUR JULIAN RD 5100 - 5852 G7a 27298 RAMSEUR JULIAN RD 3500 - 5380 G7 27298 RAMSEUR LAKE RD 500 - 649 E6p 27316 RAMSEUR LAKE RD 500 - 649 E7m 27316 RAMTEX DR 5154 - 5200 E7d 27316 RAND BLVD 201 - 508 H2p 27263 RAND BLVD 100 - 232 H2t 27263 RANDALL HURLEY RD 6300 - 7098 A3 27371 RANDALL ST 1736 - 1753 E4p 27203 RANDLEBORO RD 289 - 327 E5e 27317 RANDLEMAN LAKE RD 4400 - 4876 G5c 27317 RANDLEMAN LAKE RD 4400 - 4876 F5e 27317 RANDLEMAN RD 10300 - 11337 H5c 27317 RANDLEMAN RD 10300 - 10589 G5a 27317 RANDLEMAN RD 10900 - 11112 H4p 27317 RANDLEMAN RD 10604 - 10970 H4d 27317 RANDOLPH CHURCH RD 3100 - 3957 G6b 27233 RANDOLPH CHURCH RD 3745 - 4613 G7a 27298 RANDOLPH CHURCH RD 4300 - 4857 G7 27298 RANDOLPH MEADOW RD 5700 - 5793 H6t 27233 RANDOLPH ST 100 - 250 F5i 27317 RANDOLPH ST 230 - 250 F5e 27317 RANDOLPH TABERNACLE RD 900 - 1486 E5r 27203 RANDOLPH TABERNACLE RD 1100 - 1541 E5s 27203 RANDOLPH TABERNACLE RD 1487 - 1541 E5d 27203 RANDOM WOODS RD 3989 - 4100 H7c 27298 RATTLERS RUN 665 - 700 F4h 27317 RAVEN CT 6100 - 6143 G5b 27313 RAVENWOOD DR 154 - 190 E4l 27203 RAVENWOOD DR 154 - 190 E5i 27203 RAY AVE 100 - 108 H2s 27370 RAY DR 3600 - 3674 B5a 27205 RAYBURN ST 1800 - 1834 E5n 27203 RAYLE FARM CT 6634 - 6700 H5d 27313 RAYLE FARM RD 1800 - 2185 H5d 27313 RAYMOND GRAY LN 2700 - 2880 H3d 27263 REAVIS ST 5100 - 5202 G2f 27370 REAVIS ST 5100 - 5202 G2g 27370 RED BIRD CT 1000 - 1057 G5b 27317 RED CEDAR CT 227 - 300 G5a 27317 RED CROSS CT 2500 - 2566 G6a 27233 RED FOX RD 3893 - 4100 G1l 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-97 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP RED FOX RD 3660 - 4100 G1p 27370 RED FOX TRL 5000 - 5181 E2b 27205 RED LANE RD 1082 - 1400 G5b 27313 RED MAPLE TRL 5800 - 6138 H6t 27233 RED OAK CT 4179 - 4200 F5f 27317 RED OAK DR 4200 - 4264 F5f 27317 RED OAK LN 1800 - 1860 H4q 27317 RED ROBIN LN 6586 - 6800 H3o 27263 RED ROCK RD 100 - 158 E6t 27248 RED ROCK RD 100 - 158 D6b 27248 RED WOLF LN 1530 - 1687 C5i 27205 REDBUD LN 6800 - 7014 G8b 27298 REDBUD LN 100 - 111 F5e 27317 REDBUD LN 100 - 111 F5f 27317 REDBUD LN EXT 4900 - 5044 G8b 27298 REDDICK ST 5000 - 5076 H1t 27263 REDDICK ST 5000 - 5076 G1h 27263 REDDICK VIEW ST 5276 - 5300 G2f 27370 REDDING CT 4500 - 4625 G3m 27370 REDDING CTRY RD 3844 - 4200 G3m 27370 REDDING RD 400 - 1045 D5i 27203 REDDY FOXX LN 6900 - 7402 F1g 27360 REDDY FOXX LN 7200 - 7402 F1f 27360 REDWOOD DR 900 - 1059 C4f 27205 REECE AVE 100 - 308 F4l 27317 REECE CT 100 - 120 F4l 27317 REED CREEK CT 5024 - 5100 E7d 27316 REED CREEK CT 5024 - 5100 E7r 27316 REED CREEK RD 100 - 448 E7o 27316 REED CREEK RD 100 - 643 E7d 27316 REEDER RD 4800 - 5383 A4 27205 REEDER RD EXT 5390 - 5646 A4 27205 REEVES TRL 552 - 600 E7k 27316 REFLECTION LN 300 - 333 D3b 27205 REFUGE CHURCH DR 2600 - 2882 F1g 27370 REGAL DR 100 - 192 G5a 27317 REGALWOOD CT 6900 - 7067 G1k 27360 REGALWOOD DR 4100 - 4143 G1k 27360 REGENCY DR 2112 - 2469 E5j 27317 REGINA ST 4449 - 4500 G1h 27370 REGINA ST 4449 - 4500 G1l 27370 REGINALD RD 3209 - 3300 F6 27248 REGINAS WAY 2901 - 2931 F5q 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-98 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP REGISTER ST 783 - 900 D4o 27205 REITZEL ST 100 - 199 G8o 27298 RENOLA DR 100 - 154 H2t 27263 REVELLE TRL 500 - 668 D4c 27205 REYNOLDS RD 100 - 210 F4h 27317 RHONDA DR 3400 - 3799 G3n 27370 RICE DR 3942 - 4100 B4 27205 RICE ST 200 - 235 E6o 27248 RICE ST 200 - 235 E6p 27248 RICH AVE 200 - 340 D4p 27203 RICH CTRY DR 4500 - 4566 E2d 27205 RICH FARM TRL 1300 - 1404 F4c 27350 RICHARDS CIR 1412 - 1500 D3d 27205 RICHARDS CIR 1412 - 1500 C3b 27205 RICHARDSON FARM RD 1629 - 1700 E4c 27350 RICHARDSON LN 2400 - 2601 A6 27341 RICHARDSON RD 100 - 183 F5e 27317 RICHARDSON RD 3200 - 3362 G3k 27263 RICHARDSON ST 1120 - 1134 E7r 27316 RICHARDSON ST 1120 - 1134 D7a 27316 RICHEY RD 3000 - 3992 C1 27239 RICHFIELDS RD 3800 - 3983 F4a 27350 RICHLAND CHURCH RD 6200 - 7681 H8 27298 RICHLAND PARK DR 100 - 222 B5c 27205 RICHLAND PARK DR 100 - 222 A5f 27205 RICHLAND PL 1 - 15 D5q 27205 RIDGE DR 5200 - 5373 H2r 27370 RIDGE DR 5200 - 5252 G2f 27370 RIDGE LNDG 100 - 217 H3m 27263 RIDGE RD 200 - 5918 A5k 27341 RIDGE RD 4909 - 5918 A5 27341 RIDGE RD 4600 - 5623 B5 27341 RIDGE RD 100 - 238 A5j 27341 RIDGE ST 100 - 515 D4t 27205 RIDGE TOP CT 1900 - 1993 F2c 27370 RIDGEBACK RD 4300 - 4576 B3 27205 RIDGECREEK CIR 100 - 136 G3e 27370 RIDGECREEK DR 100 - 215 G3e 27370 RIDGECREST LN 1680 - 1800 C5i 27205 RIDGECREST LN 1680 - 1800 C5c 27205 RIDGECREST RD 100 - 427 D5i 27203 RIDGES MTN RD 400 - 1203 D3a 27205 RIDGES MTN RD 600 - 1571 D2 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-99 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP RIDGES MTN TRL 4060 - 4400 D2 27205 RIDGES MTN TRL 4157 - 4500 E2d 27205 RIDGETOP RD 4400 - 4493 D7a 27316 RIDGETOP RD 4400 - 4493 D7 27316 RIDGEVIEW RD 4928 - 5200 G3k 27263 RIDGEWAY CIR 500 - 591 D4k 27205 RIDGEWAY CIR 500 - 591 D4o 27205 RIDGEWAY DR 764 - 900 D4o 27205 RIDGEWOOD CIR 1300 - 1496 E5n 27203 RIDGEWOOD CIR 1300 - 1496 E5r 27203 RIDGEWOOD CT 6700 - 6772 F1g 27370 RIDGEWOOD RD 1306 - 1700 E6b 27248 RIDGEWOOD RD 1306 - 1700 E7a 27248 RIDGEWORTH CT 3145 - 3200 F3d 27350 RILLA ST 1700 - 1862 D6c 27205 RISING SUN WAY 281 - 555 E6t 27248 RISING SUN WAY 355 - 555 E6p 27248 RISING VIEW WAY 1000 - 1486 C4k 27205 RISING VIEW WAY 1000 - 1378 C4g 27205 RIVER BLUFF DR 4200 - 4338 D2 27239 RIVER CT 4058 - 4100 B4 27205 RIVER ESTATES DR 4400 - 4649 B4 27205 RIVER FLOW DR 1569 - 1600 E5k 27317 RIVER GATE CT 6674 - 6700 G1s 27360 RIVER HEIGHTS DR 6000 - 6113 C7 27316 RIVER MILL RD 9030 - 9272 H4d 27317 RIVER MILL RD 9153 - 9788 H4c 27317 RIVER PARK RD 100 - 112 F5n 27317 RIVER PARK RD EXT 200 - 213 F5n 27317 RIVER POINTE DR 1 - 6 F4h 27317 RIVER RAT RD 2400 - 2521 E6a 27248 RIVER RAT RD 2400 - 2521 E6m 27248 RIVER RIDGE LN 3100 - 3229 G1s 27360 RIVER RUN DR 1400 - 1545 B4 27205 RIVER WALK DR 100 - 146 F5i 27317 RIVERCHASE DR 6959 - 7100 F1 27360 RIVERMEADE DR 200 - 225 H2p 27263 RIVERMEADE DR 200 - 225 H2t 27263 RIVEROAKS CT 1000 - 1043 G5d 27317 RIVEROAKS DR 4500 - 4818 G5d 27317 RIVERS BEND DR 100 - 114 F5j 27317 RIVERSIDE ACRES CT 5500 - 5680 F2c 27370 RIVERSIDE RD 6700 - 9456 A7 27341 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-100 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP RIVERSIDE RD 4300 - 6918 B7 27341 RIVERSIDE RD 3900 - 5605 C7 27316 RIVERVIEW CT 3878 - 3900 G3m 27370 RIVERVIEW CT 3878 - 3900 G3n 27370 RIVERVIEW DR 4500 - 4743 G3m 27370 RIVERWOOD RD 978 - 1398 G4a 27317 RIVERWOOD RD 978 - 1398 G4b 27317 RIVERWOOD RD EXT 925 - 937 G4b 27317 ROADRUNNER DR 500 - 608 D4a 27205 ROB CRUTHIS RD 2600 - 3018 H3d 27263 ROBBINS CIR 4500 - 4933 E2d 27205 ROBBINS CTRY RD 5089 - 5748 G2l 27370 ROBBINS CTRY RD 5475 - 6064 G2h 27370 ROBBINS CTRY RD 4700 - 5088 G2d 27370 ROBBINS CTRY RD 4700 - 5088 G3m 27370 ROBBINS FARM DR 3205 - 3500 G2c 27370 ROBBINS FARM DR 3205 - 3500 F2a 27370 ROBBINS SCOTT RD 3200 - 3282 F5o 27317 ROBBINS ST 926 - 1055 D4o 27203 ROBERT HINSHAW DR 200 - 256 F5e 27317 ROBERT LN 1015 - 1020 G3e 27263 ROBERT MACON RD 5300 - 5567 B7 27341 ROBERT MACON RD 5300 - 5567 B8 27341 ROBERT WAY 1400 - 1497 C4k 27205 ROBERTS RANCH LN 6907 - 6960 H3o 27263 ROBIN CIR 202 - 238 H2t 27263 ROBIN CIR 202 - 238 G2h 27263 ROBIN CT 500 - 507 H2t 27263 ROBIN CT 500 - 507 G2h 27263 ROBIN LN 468 - 909 H2t 27263 ROBIN LN 468 - 1099 G2h 27263 ROBIN LN 5158 - 5298 G5b 27317 ROBIN LN 5158 - 5298 G5d 27317 ROBIN LN 1003 - 1099 G3e 27263 ROBIN VIEW RD 4600 - 4671 G5c 27317 ROBIN WAY 5400 - 5511 H2r 27370 ROBINS NEST DR 1339 - 1700 E5n 27203 ROBINS NEST DR 1300 - 1399 E5r 27203 ROBY COE RD 5804 - 7030 E8 27316 ROBY COE RD 5804 - 7030 E7d 27316 ROBY DR 4690 - 4817 H2t 27263 ROBY DR 4690 - 4817 H3q 27263 ROCK CRUSHER RD 221 - 606 D5f 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-101 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP ROCK CRUSHER RD 200 - 492 D5j 27203 ROCK DAM CT 3800 - 3879 G1p 27370 ROCK QUARRY RD 400 - 668 E4l 27203 ROCK SPRING RD 200 - 314 D4n 27205 ROCK SPRING RD 200 - 314 D4o 27205 ROCK ST 325 - 416 F4l 27317 ROCK WRENN TRL 2742 - 2803 D6c 27205 ROCKAWAY DR 218 - 300 E5e 27317 ROCKCLIFF CT 775 - 800 D5q 27205 ROCKCLIFF TER 800 - 1018 D5q 27205 ROCKCLIFF TER 800 - 995 C5e 27205 ROCKETT RD 100 - 731 H4p 27317 ROCKETT RD 100 - 173 H5c 27317 ROCKFORD DR 5500 - 5877 H2n 27370 ROCKFORD DR 5500 - 5877 H2r 27370 ROCKFORD DR EXT 5400 - 5453 H2n 27370 ROCKIE RIVER ST 4200 - 4499 E6t 27316 ROCKLANE DR 3502 - 3616 H2o 27263 ROCKLANE DR 3400 - 3507 H2p 27263 ROCKLANE DR 1300 - 1362 D4n 27205 ROCKLEDGE LN 4300 - 4372 G1k 27360 ROCKOW RD 986 - 1079 F5b 27317 ROCKRIDGE CT 3600 - 3673 G3j 27370 ROCKRIDGE RD 1000 - 1132 D4g 27205 ROCKWOOD RD 2400 - 2465 E4k 27205 ROCKY KNOLL RD 111 - 158 D5b 27205 ROCKY KNOLL RD EXT 159 - 389 D5b 27205 ROCKY LN 1700 - 1835 D5q 27205 ROCWOOD DR 400 - 550 C4l 27205 ROCWOOD DR 500 - 718 C5i 27205 RODEO DR 274 - 310 E1 27292 ROELEE ST 100 - 212 H2s 27370 ROELEE ST 100 - 125 H2t 27370 ROLAND LN 300 - 376 C4s 27205 ROLIS RD 672 - 700 F4h 27317 ROLLIN HILLS RD 1500 - 1826 A6 27341 ROLLING FARM RD 4984 - 5303 G5b 27317 ROLLING FARM RD 4800 - 5303 G5d 27317 ROLLING MEADOWS RD 5400 - 5972 G5b 27317 ROLLING RD 4661 - 4800 G2k 27370 ROLLING RD 1300 - 1615 D4k 27205 ROLLING RD 4661 - 4704 G2g 27370 ROLLINGWOOD CT 3900 - 3939 G3q 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-102 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP ROLLINGWOOD DR 3900 - 4384 G3q 27370 ROLLS LN 1740 - 1752 C5 27205 ROMAN RD 498 - 663 D5b 27205 RONNIEDALE RD 5300 - 5767 G2f 27370 RONNIEDALE RD 4900 - 5331 G2g 27370 RONNIEDALE RD 4900 - 5058 G2k 27370 ROOSEVELT RD 100 - 225 D4n 27205 ROSCOE RD 6274 - 6500 B1 27239 ROSE AVE 3155 - 3292 B4b 27205 ROSE GARDEN TRL 975 - 1000 D4n 27205 ROSE HILL RD 1539 - 1700 D6c 27205 ROSE LN 2138 - 2199 E4l 27203 ROSE ST 100 - 201 E6o 27248 ROSEBORO DR 200 - 329 E5m 27203 ROSEDALE ST 5200 - 5289 H2r 27370 ROSELEE DR 4512 - 4900 G2k 27370 ROSELEE DR 4759 - 4900 G2g 27370 ROSEMARY DR 2100 - 2746 E5f 27317 ROSEMARY ST 100 - 306 H2n 27263 ROSEMONT RD 200 - 385 D5j 27203 ROSEWAY RD 4800 - 4981 G3n 27370 ROSEWOOD DR 6700 - 6759 G1l 27370 ROSIN RUN 3153 - 3200 G3s 27350 ROSS HARRIS RD 600 - 2250 B5a 27205 ROSS HARRIS RD 1500 - 2250 B5 27205 ROSS ST 334 - 543 D4h 27203 ROSS ST 200 - 385 D4l 27203 ROSS WOOD RD 500 - 2061 E1 27370 ROSS WOOD RD 1844 - 2707 D1 27370 ROSS WOOD RD 2100 - 2959 D2 27370 ROUNDCLIFF DR 100 - 121 E2c 27205 ROUNDLEAF RD 2073 - 4734 D7e 27316 ROUNDLEAF RD 4646 - 4792 D7a 27316 ROUTH COX DR 1900 - 1955 F5d 27248 ROUTH RD 3300 - 3907 F6 27248 ROUTH RD 2400 - 3907 F7 27248 ROY FARLOW RD 3200 - 4357 G3r 27350 ROY FARLOW RD 3200 - 3440 G3s 27350 ROY FARLOW RD 3900 - 4357 G3q 27370 ROYAL DR 2202 - 2300 E5f 27317 ROYAL PINES DR 100 - 105 G3m 27370 ROYAL RIDGE RD 6500 - 6902 D8 27316 ROYALSHIRE LN 1000 - 1027 C4g 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-103 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP ROYCE LN 1760 - 1781 C5 27205 RUMBLEY PINE ST 3325 - 3400 F5m 27317 RUNNING CEDAR RD 1000 - 1196 D3a 27205 RUNNING CEDAR RD 1000 - 1196 D3c 27205 RUNWAY DR 3700 - 3882 F3a 27350 RUSH MTN RD 200 - 1075 E2c 27370 RUSH MTN RD 200 - 1075 D2 27370 RUSH MTN RD EXT 5205 - 5385 E2c 27205 RUSHWOOD RD 600 - 738 D4k 27205 RUSSELL DR 0 - 0 E1 27292 RUSSELL ST 600 - 821 D4k 27205 RUSSELL SUMMEY DR 600 - 668 E1 27360 RUSSELL WALKER AVE 100 - 218 F5n 27317 RYAN DR 2152 - 2402 E5f 27317 S ALLISON ST 400 - 502 G8r 27298 S ASHEBORO ST 200 - 545 G8s 27298 S ASHEBORO ST 100 - 255 G8o 27298 S BRADY ST 100 - 120 E7r 27316 S BROAD ST 100 - 384 A5j 27341 S CAROLINA ST 200 - 401 G8n 27298 S CAROLINA ST 200 - 401 G8r 27298 S CARTER ST 100 - 325 G8r 27298 S CARTER ST 100 - 212 G8n 27298 S CHAPEL HILL CHURCH RD 1365 - 1643 A1 27239 S CHERRY ST 100 - 147 D4l 27203 S CHERRY ST 126 - 147 D4k 27203 S CHURCH ST 100 - 843 D4l 27203 S CHURCH ST 700 - 1141 D4p 27203 S COBLE ST 100 - 130 F5i 27317 S COOK ST 114 - 199 G8o 27298 S COOK ST 197 - 239 G8s 27298 S COX ST 600 - 1324 D4p 27203 S COX ST 100 - 735 D4l 27203 S ELM ST 100 - 258 D5i 27203 S FAIRVIEW ST 200 - 338 G8n 27298 S FAIRVIEW ST 200 - 338 G8r 27298 S FAYETTEVILLE ST 186 - 911 G8s 27298 S FAYETTEVILLE ST 1 - 740 D4l 27203 S FAYETTEVILLE ST 628 - 1654 D4p 27203 S FAYETTEVILLE ST 100 - 199 G8o 27298 S FAYETTEVILLE ST 1625 - 2650 D4t 27205 S FAYETTEVILLE ST 2500 - 2650 C4h 27205 S FOSTER ST 200 - 423 G8r 27298 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-104 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP S FOSTER ST 100 - 216 G8n 27298 S GARDEN ST 800 - 908 G8s 27298 S GREENSBORO ST 210 - 778 G8s 27298 S GREENSBORO ST 100 - 262 G8o 27298 S GREGG ST 150 - 190 G8o 27298 S HIGH ST 100 - 323 D5i 27203 S KIRKMAN ST 100 - 1008 G8r 27298 S KIRKMAN ST 100 - 122 G8n 27298 S MAIN ST 100 - 707 F5i 27317 S MAIN ST 100 - 821 D4l 27203 S MAIN ST 100 - 768 F8t 27355 S MAIN ST 10200 - 10710 H3q 27263 S MAIN ST 700 - 950 F5m 27317 S MAIN ST 900 - 1299 F4p 27317 S MAIN ST 1200 - 1499 F4d 27317 S MAIN ST 700 - 821 D4p 27203 S MAIN ST 10001 - 10407 H2t 27263 S MAIN ST 10001 - 10004 H2p 27263 S MARTIN ST 242 - 422 G8s 27298 S MARTIN ST 150 - 199 G8o 27298 S MCCRARY ST 100 - 816 D4k 27203 S MCCRARY ST 600 - 816 D4o 27203 S MURPHY ST 100 - 215 G8n 27298 S MURPHY ST 100 - 324 G8r 27298 S NEW ST 100 - 213 G8n 27298 S NEW ST 100 - 325 G8r 27298 S PARK ST 700 - 1530 D4p 27203 S PARK ST 100 - 896 D4l 27203 S RANDOLPH AVE 100 - 342 D5i 27203 S SMITH ST 100 - 154 G8n 27298 S STALEY ST 100 - 659 F8t 27355 S STALEY ST 100 - 150 F8p 27355 S STOUT ST 100 - 424 F4l 27317 S TREMONT DR 1500 - 1523 E4t 27203 S VALLEY ST 100 - 241 G8o 27298 S VALLEY ST 200 - 688 G8s 27298 SABINE ST 5700 - 5775 G2e 27370 SADDLE BROOK DR 3497 - 3840 G1o 27370 SADDLE CLUB DR 3900 - 6970 G1o 27370 SADDLEWOOD CT 1814 - 1859 E4p 27203 SADIE RD 4385 - 4598 B7 27341 SADIE RD 4100 - 4598 A7 27341 SAGEBRUSH TRL 4793 - 5200 C1 27239 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-105 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP SAGEBRUSH TRL 4793 - 5200 B1 27239 SAGEWOOD LN 1001 - 1410 H3q 27263 SAGEWOOD LN 1001 - 1022 H3m 27263 SALEM CHURCH RD 4000 - 5078 C1 27239 SALEM CHURCH RD 4895 - 5078 B1 27239 SALEM CT 800 - 806 D5q 27205 SALEM CT 100 - 107 F4d 27317 SALEM FOREST ST 219 - 324 G5r 27317 SALEM HEIGHTS AVE 4500 - 4560 G5c 27317 SALEM RIDGE DR 200 - 631 G5n 27317 SALEM ST 170 - 500 G5r 27317 SALISBURY ST 1350 - 1374 E7r 27316 SALISBURY ST 3800 - 3907 H2o 27263 SALMONS DR 1000 - 1023 D3d 27205 SAM JACKSON RD 3500 - 3664 D3a 27205 SAM LEONARD RD 5500 - 6095 B8 27208 SANDALWOOD DR 5571 - 5700 B2 27239 SANDERS RD 5273 - 5400 A8 27341 SANDSTONE TRL 3900 - 3978 C1 27239 SANDTRAP LN 2597 - 2700 C4t 27205 SANDY CREEK CHURCH RD 5800 - 7248 F8a 27355 SANDY CREEK CHURCH RD 4700 - 5949 F7 27298 SANDY CREEK DR 4500 - 4619 G7a 27298 SANDY LAKE DR 2300 - 2446 F7 27248 SANDY RIDGE DR 1487 - 1800 F7 27298 SANDY RIDGE DR 1487 - 1800 E7a 27298 SANFORD CT 3300 - 3351 H3c 27263 SANFORD ST 1000 - 1122 E5n 27203 SAPLING WAY 1637 - 1700 G5b 27317 SAPLING WAY 1637 - 1700 G6a 27317 SARAH LN 2600 - 2693 F1g 27360 SARINA DR 2140 - 2168 E5j 27317 SARTIN RD 5877 - 5900 G4b 27317 SAUNDERS DR 100 - 507 E5q 27203 SAUNDERS TRL 659 - 778 D3d 27205 SAUNDERS TRL 600 - 658 D3b 27205 SAUNDERS TRL 600 - 1000 D3d 27205 SAVANNAH DR 1615 - 1700 E3a 27205 SAWYER RD 2656 - 3000 F3d 27350 SAWYER RD EXT 2300 - 2655 F3d 27350 SAWYER RD EXT 2300 - 2488 F4c 27350 SAWYERSVILLE RD 298 - 1151 D3a 27205 SCALEYBARK LN 1700 - 2121 C3b 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-106 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP SCALEYBARK LN 1600 - 1788 C4e 27205 SCARBORO ST 100 - 179 D4l 27203 SCARLET OAK DR 6390 - 6600 B1 27239 SCENIC DR 500 - 520 E5q 27203 SCENIC POINT DR 100 - 374 E2d 27205 SCHOOL RD 100 - 403 H2s 27370 SCHOOL RD 300 - 403 H2r 27370 SCHOOL RD 0 - 0 E6o 27248 SCHOOL ST 100 - 548 F8t 27355 SCIENCE HILL RD 4200 - 4356 C3a 27205 SCOTT FARM RD 100 - 584 B5c 27205 SCOTT MTN RD 2400 - 2525 C3d 27205 SCOTT MTN RD 2400 - 2525 C4c 27205 SCOTT MTN RD EXT 2600 - 2782 C3d 27205 SCOTT RD 100 - 211 A5 27341 SCOTTON RD 1800 - 2089 F8o 27355 SCOTTON RD 1800 - 2089 F8s 27355 SEAGROVE PARK VIEW DR 200 - 329 A5f 27205 SEAGROVE PLANK RD 4900 - 5504 A5f 27205 SEAGROVE PLANK RD 4300 - 5183 B5c 27205 SEAGROVE PLANK RD EXT 100 - 206 A5f 27205 SEALY DR 216 - 320 H2m 27370 SEALY DR 98 - 240 H2n 27370 SEARCY RD 5100 - 5327 A7 27341 SEARCY RD 5100 - 5327 A8 27341 SEARCY RD EXT 5300 - 5375 B8 27341 SEARCY RD EXT 5300 - 5375 A8 27341 SEAYS RD 1200 - 1399 F8c 27298 SECOND HEIGHTS DR 6600 - 6645 H1s 27263 SECOND PARK AVE 600 - 762 E5f 27317 SECOND PARK AVE 600 - 689 E5e 27317 SEMINOLE DR 100 - 208 H2t 27263 SEMINOLE DR 900 - 944 D4n 27205 SEMINOLE DR 900 - 944 D4o 27205 SENEPOLE RD 7206 - 7274 H4d 27317 SEQUOIA AVE 831 - 1029 D5m 27205 SERENITY TRL 4400 - 4513 G5d 27248 SEWELL DR 1832 - 1907 E4p 27203 SHADY BROOK DR 3500 - 3951 F6 27248 SHADY DR 1530 - 1561 E4p 27203 SHADY DR 1530 - 1561 E4t 27203 SHADY DR 539 - 556 E7r 27316 SHADY FOREST RD 3100 - 3334 F5n 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-107 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP SHADY FOREST RD EXT 3340 - 3393 F5n 27317 SHADY GROVE CHURCH RD 1000 - 2773 F8c 27355 SHADY GROVE CHURCH RD 100 - 1676 E8 27355 SHADY HOLLOW RD 5235 - 5600 F7 27355 SHADY KNOLL DR 3600 - 3848 D6d 27205 SHADY LAWN CT 3600 - 3646 G3f 27263 SHADY OAK LN 2001 - 2112 H3m 27263 SHADY WILLIAMS DR 2337 - 2400 C4s 27205 SHADYDALE ACRES LN 3944 - 4038 G1k 27370 SHADYDALE ACRES LN 3900 - 4038 G1o 27370 SHAGBARK DR 4410 - 4500 G2d 27370 SHALLOW RIVER DR 2600 - 2761 F1g 27360 SHAMROCK CT 100 - 616 H2o 27263 SHAMROCK RD 600 - 1632 D5m 27203 SHAMROCK RD 100 - 841 D5i 27203 SHAMROCK RD 1615 - 1632 D5q 27205 SHANA LN 1101 - 1301 D4o 27205 SHANNON DR 3962 - 4100 G2c 27370 SHANNON RD 600 - 944 D5m 27203 SHANNON RD 100 - 625 D5i 27203 SHARON ACRES DR 3100 - 3182 F3d 27350 SHARON AVE 100 - 617 E5m 27203 SHARON DALE DR 3365 - 3600 H3c 27263 SHARON LN 201 - 213 F5i 27317 SHARON LN 1100 - 1211 H5c 27313 SHARON LN 1100 - 1211 H5d 27313 SHARRON DR 2900 - 3086 D6f 27205 SHAW REEDER RD 6468 - 6600 A1 27239 SHAW ST 100 - 414 F5e 27317 SHAW ST 2700 - 2997 C3a 27205 SHAW ST 100 - 159 F8p 27355 SHAW ST 100 - 159 F8t 27355 SHAWNEE TRL 2910 - 3057 F3d 27350 SHEAN DR 104 - 117 H3q 27263 SHEFFIELD AVE 200 - 377 F5m 27317 SHEFFIELD ST 100 - 207 E5q 27203 SHELAR DR 4418 - 4602 G7 27298 SHELTON CTRY RD 4200 - 4683 G7a 27298 SHELTON CTRY RD 4200 - 4683 G7 27298 SHELTON CTRY RD EXT 4096 - 4200 G7 27298 SHEPHERDS VIEW RD 6900 - 7095 F1b 27360 SHEPHERDS VIEW RD 6900 - 7095 F1j 27360 SHEPHERDS WAY 1718 - 1769 D5q 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-108 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP SHERIDAN DR 1100 - 1236 D4c 27205 SHERIDAN DR 1100 - 1236 C4e 27205 SHERON CTRY DR 1951 - 2000 E5b 27317 SHERRIE DR 5318 - 5400 H1t 27263 SHERWOOD AVE 508 - 1029 D4s 27205 SHERWOOD FOREST DR 4000 - 4145 G1k 27370 SHERWOOD FOREST DR 3900 - 4145 G1o 27370 SHERWOOD FOREST DR EXT 6876 - 6900 G1o 27370 SHERWOOD OAKS DR 300 - 390 D4s 27205 SHERWOOD RD 721 - 860 D4s 27205 SHERWOOD RD 700 - 740 D4t 27205 SHILOH RD 6500 - 7502 G7a 27298 SHILOH RD 6200 - 6626 G7 27298 SHILOH RD 7000 - 7915 H7c 27283 SHINING WAY 100 - 113 G3m 27370 SHIRLEY JEAN DR 5000 - 5194 G2d 27370 SHOOTING STAR DR 4387 - 4500 H7c 27298 SHORE ST 2219 - 2415 H2m 27263 SHORE ST 2219 - 2231 H2i 27263 SHORT CUT RD 6500 - 6684 A8 27208 SHORT GRASS DR 1383 - 1600 F7 27355 SIBBETT ST 100 - 125 F5i 27317 SIDE CHURCH RD 7200 - 7841 A8 27341 SIGNET CT 1 - 99 G1f 27360 SILER ST 5500 - 5647 H2r 27370 SILK HOPE RD 7169 - 7516 G8s 27298 SILK HOPE RD 7200 - 7864 G8d 27298 SILKWOOD DR 200 - 365 E7n 27316 SILVER AVE 200 - 429 D4l 27203 SILVER AVE 400 - 429 D4p 27203 SILVER AVE 400 - 511 D5m 27203 SILVER FOX LN 100 - 106 F5f 27317 SILVER MAPLE RD 3200 - 3269 G3s 27350 SILVER MTN TRL 1426 - 1696 E3b 27350 SILVER MTN TRL 1426 - 1696 E4a 27350 SILVER MTN TRL 1426 - 1696 E4c 27350 SILVER SPRINGS RD 2204 - 2400 E3d 27350 SILVER SPRINGS RD 2204 - 2400 E4c 27350 SILVERWOOD LN 4692 - 4800 G5d 27317 SIMMONS CREEK CT 100 - 115 H2p 27263 SIMMONS CREEK CT 100 - 205 H3m 27263 SIMMONS TRL 4371 - 4400 C8 27208 SIMPSON AVE 100 - 117 E5m 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-109 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP SINK FARM RD 6739 - 7100 G1g 27360 SISTERS LN 5192 - 5400 H2q 27263 SIXTH PARK AVE 600 - 691 E5e 27317 SIXTH PARK AVE 600 - 691 E5f 27317 SIZEMORE AVE EXT 235 - 464 G8r 27298 SKEEN VIEW RD 1300 - 1618 D4c 27205 SKEEN VIEW RD 1300 - 1618 D4n 27205 SKEENS MILL RD 1300 - 1743 E2a 27370 SKEENS MILL RD 1427 - 1743 F2c 27370 SKY DR 1600 - 1647 E4p 27203 SKYCREST CTRY RD 396 - 900 C4g 27205 SKYCREST CTRY RD 527 - 900 C4f 27205 SKYHAVEN RD 3200 - 3296 F5n 27317 SKYLINE DR 1000 - 1251 D5j 27205 SKYLINE DR 1000 - 1251 D5n 27205 SKYVIEW CT 4100 - 4133 G3q 27370 SLATE AVE 400 - 426 C4l 27205 SLEEPY HOLLOW DR 7105 - 7264 H3o 27263 SLICK ROCK MTN RD 4300 - 4828 E2b 27205 SMALL CTRY RD 734 - 772 G4d 27317 SMALL RD 100 - 590 G5c 27317 SMITH ADKINS RD 1600 - 1859 F8c 27298 SMITH ADKINS RD EXT 1860 - 1987 F8c 27298 SMITH AVE 100 - 113 F5i 27317 SMITH HOLDEN RD 2021 - 2100 F6 27248 SMITH LN 100 - 118 H2p 27263 SMITH ST 100 - 161 E6o 27248 SMOKE WOOD RD 4900 - 5113 G5c 27317 SMYRNA GROVE DR 2300 - 2452 E3d 27205 SNOWBERRY TRL 1700 - 1985 E3b 27350 SNOWDON CT 1024 - 1100 E5r 27203 SNYDER CTRY RD 4600 - 5611 F2d 27370 SNYDER CTRY RD 6049 - 6537 F1 27370 SNYDER CTRY RD 5000 - 6537 F2c 27370 SNYDERS RD 1700 - 1820 F1 27370 SOAPSTONE DR 2200 - 2276 F8a 27355 SOAPSTONE DR 2200 - 2276 F8c 27355 SOAPSTONE MTN RD 2157 - 3158 F8c 27355 SOAPSTONE MTN RD 1700 - 2463 F7 27355 SOAPSTONE MTN RD 2658 - 3158 F8a 27355 SOHOMEY DR 114 - 224 D5b 27205 SOLITAIRE DR 100 - 115 G3i 27370 SOLITAIRE DR 100 - 115 G3m 27370 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-110 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP SONGBIRD LN 2520 - 2600 F3d 27350 SONNETT DR 2790 - 2900 F5q 27317 SONNYS DR 5300 - 5336 E7k 27316 SONORA DR 800 - 860 C5i 27205 SOURWOOD DR 814 - 899 D4r 27205 SOURWOOD DR 850 - 948 C4f 27205 SOUTH CREEK CT 900 - 1036 C5c 27205 SOUTH CT 2173 - 2200 F2d 27370 SOUTH FORK RD 2200 - 2345 D1 27239 SOUTH LAKE DR 1900 - 2486 C5c 27205 SOUTH PIN OAK DR 4153 - 4200 F5f 27317 SOUTH RD 201 - 239 H1k 27260 SOUTH RD 201 - 225 H1n 27260 SOUTH RD 201 - 225 H1o 27260 SOUTH ST 100 - 433 A5j 27341 SOUTHER RD 4949 - 5100 C7 27316 SOUTHERN DR 100 - 175 F4d 27317 SOUTHERN HILL RD 3000 - 3085 F3a 27350 SOUTHLAND DR 5102 - 5200 G3k 27263 SOUTHMONT DR 967 - 1447 C4g 27205 SOUTHMONT DR 1200 - 1447 C4k 27205 SOUTHMONT DR 1500 - 1640 C4k 27205 SOUTHMONT DR 900 - 1115 C4h 27205 SOUTHMONT HEIGHTS AVE 1000 - 1153 C4f 27205 SOUTHMONT SCHOOL RD 1600 - 2214 C4k 27205 SOUTHMONT SCHOOL RD 2046 - 2714 C4j 27205 SOUTHROCK ST 5875 - 6008 A5 27341 SOUTHROCK ST 5875 - 6008 A5j 27341 SOUTHWAY RD 300 - 427 D4g 27205 SOUTHWAY RD 100 - 238 D4k 27205 SOUTHWAY RD 300 - 329 D4k 27205 SOUTHWEST ST 690 - 699 H1k 27260 SOUTHWOOD DR 1600 - 1762 C5j 27205 SPAINHOUR ST 5600 - 5847 H6t 27233 SPAINHOUR ST 5600 - 5638 G6b 27233 SPANISH DR 1300 - 1532 C4e 27205 SPANISH LN 100 - 154 B4b 27205 SPARKY LN 3400 - 3534 G3r 27350 SPARROW TRL 2500 - 2668 D6e 27205 SPARTA DR 4800 - 4892 G3o 27350 SPENCER AVE 500 - 735 D4p 27203 SPENCER AVE 720 - 783 D4o 27203 SPENCER LAKE DR 5330 - 5400 G4a 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-111 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP SPENCER MEADOW RD 100 - 818 D3a 27205 SPENCER MEADOW RD 200 - 442 D3b 27205 SPENCER MEADOW RD 443 - 818 E3c 27205 SPENCER MEADOW RD 443 - 818 E3d 27205 SPENCER RD 2532 - 3137 G3b 27263 SPENCER RD 3019 - 3137 G3k 27263 SPENCER RD 2294 - 2662 G4a 27263 SPENCER ST 100 - 221 F5i 27317 SPENCER VIEW LN 4400 - 4512 G2l 27370 SPERO RD 1813 - 3054 E4a 27205 SPERO RD 1000 - 1416 E4o 27205 SPERO RD 530 - 1104 E4p 27203 SPERO RD 1342 - 2030 E4k 27205 SPERO RD 2700 - 3054 F4c 27317 SPICEWOOD LN 100 - 196 E7n 27316 SPINKS RD 3700 - 4535 D6d 27205 SPINKS ST 1900 - 1925 E5m 27203 SPIVEY LN 4800 - 4941 G2g 27370 SPIVEYS CORNER RD 5606 - 5675 A6 27341 SPOONS CHAPEL CHURCH RD 1787 - 1900 D6c 27205 SPOONS CHAPEL RD 2300 - 2551 D5d 27205 SPOONS CHAPEL RD 2600 - 3498 C6a 27205 SPOONS CHAPEL RD 2351 - 2946 D6c 27205 SPRING DR 948 - 1100 C4c 27205 SPRING FOREST RD 100 - 271 E2d 27205 SPRING GARDEN CT 2351 - 2400 E4e 27350 SPRING GARDEN ST 100 - 240 D4k 27203 SPRING HAVEN DR 500 - 672 F5q 27317 SPRING HAVEN DR 500 - 672 F5r 27317 SPRING ST 200 - 307 A5j 27341 SPRING ST 444 - 557 D5e 27203 SPRING ST 210 - 557 D5i 27203 SPRING ST 3718 - 3730 H2o 27263 SPRING VALLEY DR 100 - 125 F5i 27317 SPRING VALLEY RD 700 - 761 D4k 27205 SPRING VILLAGE DR 999 - 1084 C4c 27205 SPRINGDALE DR 400 - 690 C4l 27205 SPRINGDALE DR 600 - 690 C5i 27205 SPRINGDALE LN 1101 - 1133 D4g 27205 SPRINGFIELD ST 100 - 113 H2o 27263 SPRINGSIDE RD 2815 - 3000 F7 27298 SPRINGVIEW ST 5137 - 5200 D7b 27316 SPRINGWOOD CT 2000 - 2120 D4s 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-112 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP SPRINGWOOD LN 1001 - 1038 H2t 27263 SPRINGWOOD LN 1001 - 1038 G2h 27263 SPRINGWOOD RD 100 - 725 D4s 27205 SPRINGWOOD RD 100 - 725 D4t 27205 SPRUCE CT 2900 - 2934 F1g 27370 SPRUCEWOOD CT 102 - 108 H3q 27263 SQUIRREL CREEK RD 1855 - 2045 D6c 27205 SQUIRREL CREEK RD 1909 - 2045 C6a 27205 SQUIRREL DEN RD 3000 - 3123 D6c 27205 SQUIRREL HOLLOW LN 2200 - 2243 D6e 27205 ST PETER CHURCH RD 107 - 731 G5c 27317 ST PETER CHURCH RD 466 - 731 G4d 27317 STABLE BROOK RD 2300 - 2534 C3a 27205 STABLE BROOK RD 2300 - 2534 C3c 27205 STABLE BROOK RD 2300 - 2379 C3b 27205 STABLE BROOK RD 2300 - 2379 C3d 27205 STALEY COVE DR 2300 - 2438 F8o 27355 STALEY COVE TRL 7300 - 7366 F8o 27355 STALEY FAMILY PL 1300 - 1446 C5e 27205 STALEY FAMILY PL 1300 - 1446 C5i 27205 STALEY HILL RD 3757 - 3900 F4a 27350 STALEY VIEW TRL 7100 - 7148 F8b 27355 STALEYS DAIRY RD 4800 - 5096 G8b 27298 STALEYS FARM RD 3037 - 3462 C4o 27205 STALEYS FARM RD 2130 - 3355 C4p 27205 STALEYS FARM RD 3037 - 3355 C4t 27205 STALEYS FARM RD 2002 - 2947 C5c 27205 STALEYS FARM RD 1450 - 2100 C5i 27205 STALEYS FARM RD 1354 - 1500 C5j 27205 STALLION TRL 1700 - 1996 C4i 27205 STALLION TRL 1700 - 1835 C4j 27205 STALLION TRL 1900 - 1996 C4c 27205 STANLEY RD 2800 - 2994 G3b 27263 STANTON FARM RD 6561 - 7100 H4d 27317 STANTON FARM RD 6561 - 6681 G4b 27317 STANTON RD 968 - 1100 E2a 27370 STAR GAZER DR 1718 - 1813 C4j 27205 STARFLOWER DR 7000 - 7100 H1o 27263 STARLETTE LN 6379 - 6500 G1t 27370 STARMOUNT RD 4400 - 6090 G7 27298 STARMOUNT RD 4400 - 5142 G8c 27298 STARMOUNT RD 4200 - 5142 G8n 27298 STARR CT 350 - 374 D4l 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-113 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP STEED RD 929 - 1800 H4c 27317 STEED RD 1385 - 1800 H4q 27317 STEED RD 929 - 1200 G4a 27317 STEELE ST 500 - 610 D4t 27205 STEELE ST 1362 - 1369 E7r 27316 STEEPLECHASE DR 2600 - 2665 F1g 27360 STEEPLEGATE DR 3600 - 4040 G1o 27370 STEPPINGSTONE LN 2197 - 2400 D3b 27205 STERLING RIDGE DR 200 - 413 H3m 27263 STERLING RIDGE DR 100 - 210 H2p 27263 STERLING ST 100 - 209 D4h 27203 STERLING ST 100 - 209 D5e 27203 STEVENSON ST 100 - 221 F4l 27317 STEWART ST 4217 - 4493 F3b 27350 STEWART ST 4316 - 4493 G3d 27350 STEWART ST EXT 4140 - 4216 F3b 27350 STILL MEADOWS LN 1700 - 2084 F7 27355 STILL MEADOWS LN 1700 - 2084 F8c 27355 STIRRUP CT 7500 - 7550 G1n 27370 STONE ARBOR DR 771 - 804 E5f 27317 STONE BRIDGE RD 1900 - 2447 C3d 27205 STONE BRIDGE RD 2044 - 2240 C3b 27205 STONE CTRY LN 100 - 179 D3b 27205 STONE GABLES DR 6794 - 7049 G1k 27360 STONE HAVEN DR 500 - 587 D5f 27203 STONE RIDGE DR 4324 - 4500 G2j 27370 STONE RIDGE DR 4324 - 4400 G2i 27370 STONEHENGE PL 6953 - 7000 G1s 27360 STONEHENGE PL 6866 - 7000 F1g 27360 STONEHENGE RD 2779 - 3100 G1s 27360 STONEHENGE RD 2779 - 2800 F1g 27360 STONESIDE CIR 2778 - 3000 F1g 27360 STONESIDE CIR 2883 - 3000 G1s 27360 STONEWALL CT 2584 - 2600 C3c 27205 STONEY CREEK DR 600 - 757 D5q 27205 STONEY CREEK DR 2600 - 2677 G3b 27263 STONEY RIVER DR 5517 - 5600 E2a 27370 STOUT ACRES RD 900 - 1228 D7b 27316 STOUT FARM RD 500 - 612 B4b 27205 STOUT RD 500 - 1015 F4l 27317 STOUT RD 670 - 1015 F4p 27317 STOUT ST 1280 - 1283 E7r 27316 STOUT VIEW ST 1000 - 1069 D7b 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-114 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP STOWE AVE 200 - 542 D4p 27203 STOWE AVE 414 - 725 D5m 27203 STRAIGHT ST 900 - 997 D4p 27203 STRATFORD RD 200 - 337 H2k 27263 STRATFORD RD 300 - 337 H2o 27263 STRATFORD WAY 1353 - 1500 D5k 27205 STRAWBERRY LN 2524 - 2593 E5f 27317 STREAM WATCH TRL 2900 - 3018 C6a 27205 STREAM WATCH TRL 2900 - 3018 C6c 27205 STRIEBY CHURCH RD 5514 - 5800 A3 27205 STRIEBY CHURCH RD EXT 5360 - 5500 B3 27205 STRIEBY CHURCH RD EXT 5360 - 5500 A3 27205 STUART ST 480 - 494 E7r 27316 STUTTS RD 2020 - 3736 D3b 27205 STUTTS RD 2050 - 3270 D3d 27205 STUTTS RD 3306 - 3736 D3a 27205 SUBSTATION RD 1700 - 1945 D5b 27203 SUGAR CANE LN 6309 - 6400 F1 27360 SUGG DR 6160 - 6409 A6 27341 SUGG TEAGUE RD 6200 - 6294 B7 27341 SUGG TEAGUE RD 6200 - 6294 A7 27341 SUITS RD 5745 - 5912 H3q 27263 SUITS RD 5819 - 7212 H3c 27263 SUITS RD 5700 - 5782 G3e 27263 SUMMER SHADE DR 4438 - 4500 G1l 27370 SUMMER TRL 1447 - 1500 G5b 27313 SUMMERSET RD 4900 - 5050 G5n 27317 SUMMERVILLE DR 5000 - 5192 G2k 27370 SUMMERVILLE DR EXT 5204 - 5498 G2j 27370 SUMMERVILLE DR EXT 5204 - 5498 G2k 27370 SUMMERVILLE DR EXT 5204 - 5498 G2c 27370 SUMMEY TOWN RD 1100 - 2299 D1 27370 SUMMIT AVE 301 - 439 D4h 27203 SUMMIT AVE 200 - 359 D4l 27203 SUMMIT CT 400 - 504 D2 27205 SUMNER PL 100 - 117 E6o 27248 SUMNER RD 3003 - 3291 F2b 27370 SUNBEAM CT 2100 - 2135 C5 27205 SUNBURST RD 1578 - 1600 C3d 27205 SUNBURST RD 1578 - 1600 C4c 27205 SUNDANCE TRL 2700 - 2799 F1b 27370 SUNDEW DR 2800 - 2857 F4c 27350 SUNDEW DR 2800 - 2857 E4e 27350 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-115 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP SUNFLOWER DR 112 - 325 E5d 27203 SUNFLOWER DR 112 - 325 D5b 27203 SUNNY LN 1700 - 2105 D4s 27205 SUNNY LN 500 - 519 H2o 27263 SUNRISE AVE 100 - 522 E5i 27203 SUNRISE AVE 100 - 511 E6p 27248 SUNRISE CIR 100 - 125 F5e 27317 SUNSET AVE 800 - 1601 D4k 27205 SUNSET AVE 100 - 845 D4l 27203 SUNSET DR 100 - 429 F5i 27317 SUNSET DR 400 - 615 F4l 27317 SUNSET DR 1200 - 1534 D4k 27205 SUNSET DR N 200 - 370 D4g 27205 SUNSET DR N 200 - 370 D4k 27205 SUNSET KNOLL DR 4228 - 4300 G2d 27370 SUNSET KNOLL DR EXT 4010 - 4200 G2d 27370 SUNSET OAKS DR 5200 - 5267 D7b 27316 SUNSET VIEW DR 6000 - 6151 H1p 27263 SUNSET VIEW DR 6000 - 6151 H2m 27263 SUNSET VIEW DR EXT 6200 - 6270 H1p 27263 SUNSHINE HEIGHTS RD 300 - 360 E7n 27316 SURRATT CTRY RD 6100 - 6631 B1 27239 SURRETT DR 4924 - 5956 H2q 27263 SURRETT DR 4800 - 5336 G2e 27263 SURRETT DR 2221 - 6026 H2m 27263 SURRETT DR 2221 - 2227 H2i 27263 SURRIE TRL 5672 - 6200 G5b 27313 SUSAN DR 6046 - 6100 A5 27341 SUSSEX TRL 6100 - 6200 H5d 27313 SWAIM ST 100 - 421 F5i 27317 SWEETBRIAR RD 2559 - 2900 F3a 27350 SWEETBRIAR RD 2559 - 2900 F3c 27350 SWEETWATER TRL 3405 - 4021 C2 27205 SYCAMORE DR 7200 - 7366 H4p 27317 SYCAMORE TRL 3800 - 3919 D6b 27248 SYKES FARM RD 504 - 615 D4t 27205 SYKES FARM RD 424 - 615 D5q 27205 SYLVAN DR 2428 - 2459 E4h 27203 SYLVAN DR 200 - 279 D6f 27205 SYLVAN OAKS RD 4600 - 4746 G6c 27233 SYLVAN TRL 5100 - 5237 F2a 27370 SYLVAN TRL 5100 - 5237 F2b 27370 SYLVAN VIEW RD 1700 - 1746 G5d 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-116 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP SYLVAN WAY 1535 - 1700 E4c 27205 SYLVAN WOODS DR 1526 - 1700 C4i 27205 SYLVIA ST 3400 - 3410 H2o 27263 TABERNACLE CHURCH RD 200 - 1884 E2a 27370 TABERNACLE CHURCH RD 200 - 1058 E2c 27370 TABERNACLE CHURCH RD 1200 - 2227 F1 27370 TABERNACLE CHURCH RD 1200 - 1887 F2c 27370 TABERNACLE CHURCH RD EXT 100 - 228 E2c 27370 TABERNACLE SCHOOL RD 4800 - 5418 E2d 27205 TABERNACLE SCHOOL RD 5317 - 5418 E2c 27205 TABERNACLE ST 100 - 150 F5i 27317 TABOR CT 700 - 734 D5e 27203 TALL CEDAR LN 2859 - 3100 F2a 27370 TALL PINE ST 220 - 888 C4p 27205 TALL PINE ST EXT 518 - 555 C4p 27205 TALLWOOD DR 4600 - 4848 G3n 27370 TALLWOOD ESTATES DR 5400 - 5548 H1o 27360 TALMER WRIGHT RD 1925 - 2100 C5 27205 TAMWORTH RD 900 - 998 D4h 27203 TANGLEWOOD LN 2600 - 2746 D6e 27205 TANGLEWOOD LN 2700 - 2960 D6f 27205 TANNER CT 7200 - 7276 G1o 27370 TAR HEEL TRL 1800 - 1825 C5c 27205 TARHEEL DR 100 - 325 H2t 27263 TARHEEL DR 300 - 406 H3m 27263 TARHEEL DR 300 - 325 H3q 27263 TARMAC DR 3800 - 4061 G3q 27350 TARMAC DR 3800 - 3888 F3a 27350 TATE ST 570 - 577 E7r 27316 TAXI WAY 3800 - 3838 G3q 27350 TAYLOR CT 2400 - 2406 D7e 27316 TAYLOR CT 4955 - 5000 G3n 27370 TAYLOR DR 2900 - 3022 F4d 27203 TAYLOR DR 2900 - 2991 E4h 27203 TAYLOR WOODS LN 6700 - 6846 H5d 27313 TAYLORS CREEK DR 1702 - 2000 C3a 27205 TEACHEY SCHOOL DR 0 - 0 D4t 27205 TEAGUE FARM RD 2898 - 3632 A6 27341 TEAGUE FARM RD 3300 - 3915 A7 27341 TEAL CT 4872 - 4900 G5n 27317 TELEPHONE AVE 100 - 408 D4p 27205 TEMPLE VIEW RD 233 - 300 E7n 27316 TERESA WAY 700 - 954 A4 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-117 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP TERESA WAY 700 - 954 A5a 27205 TERRACE TRACE CT 102 - 320 H2n 27263 TERRY AVE 201 - 227 E4p 27203 TEXAS BLVD 6954 - 7145 G1j 27360 TEXAS BLVD 7100 - 7145 G1k 27360 THAYER DR 1200 - 1426 E4s 27205 THAYER DR 1200 - 1426 D4g 27205 THAYER RD 2600 - 3727 F2a 27370 THAYER RD 2600 - 3607 F2c 27370 THAYER RD 1000 - 1788 E2a 27370 THAYER RD 1600 - 3316 F2d 27370 THAYER RD 1600 - 1788 E2b 27370 THIRD B ST 4300 - 4349 H7c 27283 THIRD PARK AVE 600 - 689 E5e 27317 THIRD PARK AVE 600 - 689 E5f 27317 THIRD ST 1300 - 1533 D4p 27205 THIRD ST 1700 - 1775 D4t 27205 THIRD ST 100 - 120 F5i 27317 THOMAS ST 700 - 870 D5i 27203 THOMAS ST 800 - 870 D5j 27203 THOMPSON HEATH RD 3081 - 3400 F4c 27350 THOMPSON RD 6515 - 6600 H1o 27263 THOMPSON RD 6515 - 6600 H1p 27263 THOMPSON RD EXT 6396 - 6500 H1p 27263 THORNBROOK RD 300 - 361 E7o 27316 THORNBURG FARM TRL 4100 - 4447 B2 27205 THORNBURG RD 915 - 1000 D3d 27205 THORNSDALE DR 1600 - 1645 E4p 27203 THORNSDALE DR 1526 - 1561 E4p 27203 THORNSDALE DR 1526 - 1561 E4t 27203 THOROUGHBRED RD 1152 - 1301 C4i 27205 THOROUGHBRED RD 1100 - 1194 C4j 27205 THREE B RD 112 - 160 D4a 27205 THREE B RD 112 - 160 D4c 27205 THRU ROAD 0 - 0 F8t 27355 TIA CT 6900 - 6949 H1o 27360 TIGER FLOWER RD 2854 - 3080 B5a 27205 TIGERS DEN RD 4300 - 4962 F4h 27317 TIGERS DEN RD 4645 - 4962 G4d 27317 TILLEY LN 5600 - 5615 G5a 27317 TIMBAL CT 1100 - 1145 D4g 27205 TIMBER LEA LN 4200 - 4474 C7 27316 TIMBER LEA LN 4200 - 4474 C6d 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-118 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP TIMBER TRL 5100 - 5378 G6a 27317 TIMBER TRL 5100 - 5213 G6c 27317 TIMBERLANE 1100 - 1688 D5m 27205 TIMBERLANE 1400 - 1688 D5q 27205 TIMBERWOLF TRL 2400 - 2658 C5c 27205 TIMKEN PL 3500 - 3605 F4p 27317 TIP TOP RD 2300 - 2541 D1 27239 TIPPETT RD 1900 - 2033 E6a 27248 TIPTON DR 600 - 675 D5e 27203 TOBACCO RD 4900 - 5560 G3n 27370 TOBACCO RD 5347 - 6162 G3j 27370 TOBACCO RD 4900 - 5083 G3o 27370 TODD DR 2075 - 2400 F1b 27370 TODD HAGERMAN TRL 3226 - 3400 F3a 27350 TODD HAGERMAN TRL 3226 - 3400 F3b 27350 TOM BALL RD 6400 - 6828 H4c 27317 TOM BALL RD 6400 - 6765 H4q 27317 TOM BROWN RD 3000 - 3750 F5b 27248 TOM BROWN RD 3000 - 3444 F5d 27248 TOM HILL RD 5200 - 5958 G3e 27370 TOM HILL RD 5200 - 5510 G3i 27370 TOM HILL RD 5700 - 5958 H3q 27263 TOMMY COX RD 2900 - 4049 C7 27316 TOMS CREEK RD 3600 - 3970 C2 27205 TONY DR 4800 - 5025 G2f 27370 TONYS WAY 1300 - 1425 E5s 27203 TOPAZ DR 2141 - 2200 C4p 27205 TORCH DR 101 - 197 F5m 27317 TORTOISE LN 301 - 324 F5q 27317 TORY LN 1100 - 1481 E4a 27205 TORY LN 1100 - 1245 E4k 27205 TOT HILL FARM RD 1600 - 2847 C3b 27205 TOT HILL FARM RD 2532 - 4096 C3d 27205 TOT HILL FARM RD 3470 - 4154 C3a 27205 TOT HILL TRL 2700 - 2832 C3d 27205 TOWER AVE 1701 - 1805 H1k 27260 TOWER AVE 1701 - 1805 H1l 27260 TOWER VIEW LN 1300 - 1361 F4a 27350 TOWN CTRY RD 7200 - 7630 G8d 27298 TOYES DR 2492 - 2900 D1 27239 TRACI ST 1628 - 1641 E5m 27203 TRADE ST 100 - 139 D4l 27203 TRAILS END RD 5500 - 5732 H8 27298 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-119 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP TRAINING CENTER DR 800 - 897 E6m 27317 TRAINING CENTER DR 873 - 897 E5d 27317 TRANQUIL LN 2996 - 3100 E3c 27205 TRANQUIL LN 2996 - 3100 E3d 27205 TRANQUIL LN 2996 - 3100 D3a 27205 TRANSFER STATION PL 600 - 630 D5e 27203 TRAVELER DR 3746 - 3800 G1k 27370 TRAVELER DR 3746 - 3800 G1o 27370 TREE HOLLOW EXT 2592 - 2700 F1g 27360 TREE HOLLOW RD 7087 - 7200 F1f 27360 TREE HOLLOW RD 7003 - 7200 F1g 27360 TREE HOUSE LN 5190 - 5300 A3 27205 TREE SPARROW DR 3680 - 3800 F3a 27350 TREETOP CT 100 - 117 G2h 27370 TREMONT DR 100 - 445 E4t 27203 TREMONT DR 100 - 119 E5q 27203 TREY LN 101 - 307 H3c 27263 TREY LN 300 - 307 H3q 27263 TRINDALE RD 400 - 716 H2n 27263 TRINDALE RD 100 - 406 H2o 27263 TRINDALE SCHOOL DR 0 - 0 H2s 27263 TRINITY BLVD 4873 - 5400 G2f 27370 TRINITY CHURCH RD 2400 - 3467 A6 27341 TRINITY CHURCH RD 3200 - 3977 A7 27341 TRINITY COLLEGE RD 5500 - 5540 H2r 27370 TRINITY CT 5000 - 5038 G1h 27263 TRINITY HIGH SCHOOL DR 5500 - 5863 H2q 27370 TRINITY HIGH SCHOOL DR 5500 - 5863 H2r 27370 TRINITY RD 11700 - 11974 G2h 27370 TRINITY RD 12042 - 12779 H2s 27370 TRINITY RD 11766 - 12208 G2g 27370 TRINITY RD 12700 - 13121 H2r 27370 TROGDON CTRY TRL 4700 - 4921 G5d 27317 TROGDON HILL RD 1810 - 2215 D5b 27205 TROGDON POND RD 100 - 369 E5d 27203 TROGDON POND RD 100 - 369 E6q 27203 TROGDON POND RD 100 - 369 D5b 27203 TROGDON ST 1200 - 1232 D4g 27205 TROGDON WAY TRL 500 - 662 G5r 27317 TROLLINGER RD 800 - 964 D5m 27203 TROLLINGER ST 100 - 215 F5e 27317 TROLLINGER ST 200 - 329 F5f 27317 TROLLINGER ST 316 - 329 G5r 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-120 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP TROTTER CTRY RD 5600 - 5919 H3c 27263 TROTTER CTRY RD 5600 - 5891 G3f 27263 TROTTER LN 200 - 260 D4o 27205 TROTTER RD 3000 - 3175 C2 27205 TROTTERS RUN 7300 - 7459 G1n 27370 TROTTERS RUN 7200 - 7369 G1o 27370 TROY CAVENESS RD 6011 - 7611 D8 27316 TROY CAVENESS RD 6011 - 6705 D7 27316 TROY CAVENESS RD 6706 - 7611 C8 27316 TROY ESTATE RD 3200 - 3595 F8a 27355 TROY ESTATE RD 3300 - 3950 G8c 27355 TROY ESTATE RD 3300 - 3595 G8r 27355 TROY SMITH RD 5126 - 5616 H7d 27298 TROY SMITH RD 4500 - 5441 G7 27298 TRUMAN AVE 3500 - 3511 H2o 27263 TRYON ST 500 - 526 D4h 27203 TRYON ST 472 - 480 D4h 27203 TUCKER LN 5915 - 6000 G5a 27317 TUCKER ST 600 - 735 D5e 27203 TUCKER ST 600 - 735 D5i 27203 TUDOR DR 1600 - 1649 E4s 27205 TURNER DAIRY RD 904 - 1354 F4c 27317 TURNER DAIRY RD 904 - 1354 F4d 27317 TURNER LAKE RD 6773 - 6800 F8a 27298 TURNER LAKE RD 6773 - 6800 F8b 27298 TURNER ST 400 - 522 E5m 27203 TURNING OAKS TRL 1900 - 2066 C3a 27205 TURNPIKE CT 4622 - 4900 G1g 27360 TURNPIKE CT 4863 - 4900 H1s 27360 TURNPIKE RD 7500 - 8234 H1s 27263 TURNPIKE RD 6306 - 7299 G1h 27263 TURNPIKE RD 7300 - 7406 H1t 27263 TURNPIKE RD 6306 - 6568 G2e 27263 TURNPIKE RD 8123 - 8234 G1f 27360 TURNPIKE RD 8123 - 8234 G1g 27360 TURTLE LAKE BND 2810 - 2871 F5q 27317 TURTLEDOVE RD 2800 - 2927 F3d 27350 TUTLOHR DR 1100 - 1220 E2a 27370 TUTTLE RD 2700 - 3281 H3d 27263 TUTTLE RD 3245 - 3466 H3c 27263 TUTTLE RD 2700 - 3083 H3o 27263 TWAIN DR 400 - 576 D5e 27203 TWIN CREEK RD 1300 - 1447 C5j 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-121 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP TWIN CRYSTAL TRL 1300 - 1471 D5d 27205 TWIN CRYSTAL TRL 1300 - 1471 C5 27205 TWIN OAKS DR 6700 - 6925 F1g 27370 TWIN OAKS DR 6700 - 6740 F1b 27370 TWIN TREE DR 7600 - 7699 H8 27298 TWINFLOWER RD 1821 - 1900 D6d 27205 TWINLEAF DR 2130 - 2193 E3b 27350 TWINWOOD CT 6300 - 6341 G1l 27370 TWINWOOD DR 4300 - 4428 G1l 27370 TWO POND DR 100 - 398 G5a 27317 TY LN 7006 - 7100 F1f 27360 TY LN 7006 - 7100 F1g 27360 UDELL DR 3708 - 3800 F3c 27350 ULAH CT 600 - 707 C4p 27205 UNDERWOOD RD 2900 - 3133 G6b 27233 UNDERWOOD RD 2900 - 3133 G6d 27233 UNDERWOOD ST 100 - 240 E5m 27203 UNION CHURCH RD 1200 - 1546 D3d 27205 UNION CHURCH RD 1200 - 1546 C3b 27205 UNION GROVE CHURCH RD 5700 - 7952 A6 27341 UNITY ST 6213 - 6590 G1g 27360 UNITY ST 6543 - 6698 G1f 27360 UNITY ST 6000 - 6368 G1k 27360 UPTON ST 200 - 240 F5i 27317 US HWY 220 BUS N 10300 - 10902 G4b 27317 US HWY 220 BUS N 8906 - 10660 G5a 27317 US HWY 220 BUS N 7700 - 8905 G5c 27317 US HWY 220 BUS N 4510 - 4728 E4h 27203 US HWY 220 BUS N 4510 - 4550 E5e 27203 US HWY 220 BUS N 4600 - 5072 F4d 27317 US HWY 220 BUS N 7580 - 7895 F5e 27317 US HWY 220 BUS S 2700 - 3401 C4h 27205 US HWY 220 BUS S 3248 - 4109 C4l 27205 US HWY 220 BUS S 4400 - 5219 C4o 27205 US HWY 220 BUS S 5000 - 5543 C4s 27205 US HWY 220 BUS S 3900 - 4544 C4k 27205 US HWY 220 S 8685 - 9599 A5 27341 US HWY 220 S 5953 - 7362 B5c 27205 US HWY 220 S 7200 - 8005 A5f 27205 US HWY 220 S 5400 - 5952 B5a 27205 US HWY 220 S 4800 - 5552 B4b 27205 US HWY 220 S 4100 - 4370 C4s 27205 US HWY 220 S 4200 - 4768 C4t 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-122 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP US HWY 220 S 8685 - 8780 A5j 27341 US HWY 29 1200 - 1299 H1l 27263 US HWY 29 1000 - 1299 H1o 27263 US HWY 29 1200 - 1299 H1p 27263 US HWY 29 1000 - 1049 H1n 27263 US HWY 311 4700 - 6433 F4a 27350 US HWY 311 4166 - 4790 F4k 27317 US HWY 311 3870 - 4395 F4d 27317 US HWY 311 3800 - 3979 F4p 27317 US HWY 311 6800 - 8040 G3d 27350 US HWY 311 7600 - 8897 G3k 27263 US HWY 311 8700 - 9759 G3f 27263 US HWY 311 6353 - 6747 G4c 27350 US HWY 311 9800 - 9932 H3q 27263 US HWY 311 9538 - 9891 G3e 27263 US HWY 311 8700 - 8897 G3j 27263 US HWY 311 7600 - 8040 G3o 27263 US HWY 421 1200 - 1599 G7 27298 US HWY 421 1400 - 1699 G8c 27298 US HWY 421 1000 - 1199 H7c 27298 US HWY 421 1100 - 1299 G7a 27298 US HWY 421 1600 - 1899 F8a 27355 US HWY 421 1800 - 1999 F8b 27355 US HWY 421 1900 - 1999 F8p 27355 US HYW 64 3415 - 3438 C4e 27205 US HYW 64 3415 - 3438 C4f 27205 US HYW 64 3415 - 3438 C4j 27205 US HYW 64 3420 - 3457 C4k 27205 US HYW 64 3445 - 3460 C4l 27205 US HYW 64 3468 - 3486 C5f 27205 US HYW 64 3466 - 3487 C5i 27205 US HYW 64 3460 - 3466 C5j 27205 US HYW 64 2800 - 2326 D4a 27205 US HYW 64 2816 - 2326 D4c 27205 US HYW 64 2015 - 2325 D4n 27205 US HYW 64 3490 - 3529 D5b 27205 US HYW 64 3468 - 3521 D5d 27205 US HYW 64 3491 - 3529 D5g 27205 US HYW 64 5000 - 5272 E6s 27248 US HWY 64 E 5100 - 6057 E6t 27248 US HWY 64 E 9170 - 10688 E8 27316 US HWY 64 E 4000 - 4759 D6f 27248 US HWY 64 E 4500 - 5068 D6b 27248 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-123 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP US HWY 64 E 7400 - 8033 E7o 27316 US HWY 64 E 2200 - 2694 D5g 27203 US HWY 64 E 3329 - 4132 D6e 27203 US HWY 64 E 2700 - 3457 D5b 27203 US HWY 64 E 7600 - 8800 E7d 27316 US HWY 64 E 1775 - 2001 D5j 27203 US HWY 64 E 5611 - 6270 E7q 27316 US HWY 64 E 1900 - 2265 D5k 27203 US HWY 64 W 1236 - 2326 D4n 27205 US HWY 64 W 3000 - 4185 D3b 27205 US HWY 64 W 1000 - 1265 D4o 27205 US HWY 64 W 6600 - 8393 E2c 27370 US HWY 64 W 2400 - 2910 D4a 27205 US HWY 64 W 5200 - 6789 E2d 27205 US HWY 64 W 4800 - 5531 E3c 27205 US HWY 64 W 4040 - 5115 D3a 27205 US HWY 64 W 8100 - 9769 E1 27370 US HWY 64 W 2015 - 2488 D4c 27205 UWHARRIE RD 5400 - 5734 H2q 27263 UWHARRIE RD 2718 - 5903 H2m 27263 UWHARRIE RD 2714 - 2720 H2i 27263 UWHARRIE ST 600 - 1328 D4o 27203 UWHARRIE ST 200 - 870 D4k 27203 UWHARRIE ST 200 - 243 D4l 27203 VALEWOOD DR 2254 - 2700 D6f 27205 VALEWOOD DR 2080 - 2300 D6e 27205 VALLEY CIR 4200 - 4242 G1k 27360 VALLEY DALE LN 1100 - 1232 E5s 27203 VALLEY DALE LN 1100 - 1143 E5r 27203 VALLEY DR 3800 - 4023 F3a 27350 VALLEY FARM RD 4300 - 5274 C1 27239 VALLEY FARM RD 4300 - 5274 B1 27239 VALLEY FORGE DR 3900 - 4064 G3i 27370 VALLEY GROVE RD 1600 - 1695 C4j 27205 VALLEY GROVE RD 1600 - 1695 C4c 27205 VALLEY RD 100 - 501 E5q 27203 VALLEY RIDGE DR 3761 - 4200 G3q 27370 VALLEY RIDGE DR EXT 4100 - 4150 G3q 27370 VALLEY VIEW RD 4300 - 4424 G1j 27360 VALLEY VIEW RD 4200 - 4424 G1k 27360 VANCE ST 560 - 680 D5e 27203 VANCROFT ST 164 - 345 B4b 27205 VANCROFT ST 100 - 274 B5a 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-124 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP VARNER RD 1294 - 1370 D2 27239 VARNER RD EXT 1400 - 1533 D2 27239 VARNER ST 100 - 121 F5i 27317 VAUGHN YORK RD 100 - 1004 E8 27355 VERMONT DR 7200 - 7281 H4p 27317 VERNON ST 100 - 111 E4t 27203 VERNON ST 100 - 111 E5q 27203 VERTA AVE 704 - 722 H2n 27263 VESPER TRL 1400 - 1483 D6c 27205 VESTAL CREEK CT 700 - 782 D5q 27205 VETERANS LOOP RD 300 - 631 C4g 27205 VICKREY DR 1238 - 1300 E2a 27370 VICTORIAN CT 100 - 114 F5q 27317 VICTORY JUNCTION LN 5100 - 5209 G5d 27317 VIEWMONT CT 1700 - 1738 E4s 27205 VIEWMONT DR 700 - 1349 E4s 27205 VIEWMONT DR 1300 - 1435 E4c 27205 VIEWMONT DR 732 - 792 E4s 27205 VILLA DR 4700 - 4731 G3o 27350 VILLAGE AVE 100 - 211 F5n 27317 VILLAGE DR 3844 - 4346 G3m 27370 VILLAGE DR 3844 - 3898 G3n 27370 VILLAGE LN 5101 - 5127 H3q 27263 VILLAGE LN 5101 - 5127 G3e 27263 VINCENT DR 2018 - 2037 E5i 27203 VINCENT OAKS DR 3000 - 3025 F6c 27248 VIOLA DR 7390 - 7500 E1 27292 VIOLET RIDGE RD 6944 - 7000 H4d 27317 VIPER LN 1200 - 1215 C5 27205 VIRGIL HILL RD 100 - 263 C4l 27205 VIRGIL HILL RD 200 - 427 C4k 27205 VIRGINIA ACRES DR 2800 - 2841 C6a 27205 VIRGINIA AVE 100 - 415 E5m 27203 VIRGINIA CT 4579 - 4600 G3m 27370 VIRGINIA DR 4455 - 4500 G3m 27370 VIRGINIA TRL 4105 - 4300 G8d 27298 VISION DR 0 - 0 E4s 27203 VISION DR 0 - 550 E4t 27203 VISION DR 0 - 0 D4h 27203 VISION DR 100 - 550 E5q 27203 VISTA PKWY 100 - 287 D5k 27205 VISTA PKWY 100 - 188 D5j 27205 VISTA PKWY EXT 290 - 440 D5k 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-125 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP VOLUNTEER RESCUE RD 6300 - 8203 B1 27239 VOLUNTEER RESCUE RD 6300 - 6763 A1 27239 VONCANNON FARM RD 2700 - 3223 B3 27205 W A CRAVEN RD 3716 - 3900 A7 27341 W ACADEMY ST 100 - 252 D4l 27203 W ACADEMY ST 300 - 694 F4l 27317 W ACADEMY ST 604 - 900 F4h 27317 W ACADEMY ST 0 - 320 F5i 27317 W ALLRED ST 100 - 240 E4t 27203 W ALLRED ST 100 - 123 E5q 27203 W BAILEY ST 100 - 619 E4p 27203 W BAILEY ST 100 - 112 E5m 27203 W BALFOUR AVE 100 - 800 E4p 27203 W BALFOUR AVE 100 - 209 E5m 27203 W BEASLEY ST 100 - 424 E4p 27203 W BEASLEY ST 100 - 113 E5m 27203 W BOWMAN AVE 200 - 606 G8n 27298 W BOWMAN AVE 100 - 227 G8o 27298 W BROOKWOOD AVE 230 - 332 G8n 27298 W BROOKWOOD AVE 100 - 229 G8o 27298 W BROWER AVE 200 - 629 G8n 27298 W BROWER AVE 400 - 529 G8r 27298 W BROWER AVE 100 - 227 G8o 27298 W BROWER AVE 100 - 150 G8s 27298 W BROWN ST 100 - 126 F5i 27317 W BUTLER AVE 100 - 264 G8k 27298 W BUTLER AVE 200 - 264 G8j 27298 W BUTLER AVE EXT 300 - 407 G8j 27298 W CENTRAL AVE 100 - 600 E4l 27203 W CENTRAL AVE 500 - 600 E4p 27203 W CENTRAL AVE 100 - 299 E5i 27203 W DAMERON AVE 400 - 812 G8r 27298 W DAMERON AVE 100 - 154 G8s 27298 W DIXIE DR 500 - 1199 D4o 27205 W DIXIE DR 100 - 900 D4p 27205 W E HUNT RD 5900 - 6120 A5 27341 W FRANKLINVILLE ST 300 - 390 F8o 27355 W FRANKLINVILLE ST 100 - 390 F8p 27355 W FRANKLINVILLE ST 300 - 390 F8s 27355 W FRANKLINVILLE ST 100 - 296 F8t 27355 W FRAZIER AVE 100 - 156 G8s 27298 W HIGHFILL AVE 100 - 199 G8o 27298 W JONES ST 2100 - 2104 D7e 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-126 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP W KIME AVE 100 - 157 G8s 27298 W KIME AVE 400 - 516 G8r 27298 W KING AVE 100 - 151 A5j 27341 W KIVETT ST 100 - 551 D4l 27203 W KIVETT ST 600 - 745 D4k 27203 W LEWIS AVE 100 - 158 G8s 27298 W LUTHER AVE 200 - 334 G8n 27298 W LUTHER AVE 100 - 231 G8o 27298 W MAIN ST 100 - 890 E6o 27248 W MAIN ST 100 - 419 A5j 27341 W MILLER ST 100 - 153 D4h 27203 W MINE ST 600 - 661 D4s 27205 W MOFFITT AVE 200 - 617 G8n 27298 W MOFFITT AVE 100 - 229 G8o 27298 W NAOMI ST 100 - 225 F5i 27317 W NEWBERRY AVE 100 - 113 G8o 27298 W O W RD 2535 - 3240 F5r 27317 W O W RD 1924 - 2585 E5f 27317 W O W RD 1700 - 2283 E5j 27317 W O W RD 2939 - 3240 F5n 27317 W PATTERSON AVE 100 - 156 G8s 27298 W PATTERSON AVE 234 - 244 G8r 27298 W PRESNELL ST 0 - 800 D4h 27203 W PRESNELL ST 0 - 0 D4g 27203 W PRITCHARD ST 100 - 151 D4h 27203 W RAILROAD ST 200 - 651 F8t 27355 W RALEIGH AVE 100 - 270 G8o 27298 W RALEIGH AVE 200 - 270 G8n 27298 W RIDGE ST 1300 - 1341 E7r 27316 W RIVER DR 100 - 153 F5e 27317 W RIVER RUN 875 - 1200 E4c 27205 W SALISBURY ST 100 - 846 D4l 27203 W SALISBURY ST 800 - 1136 D4k 27203 W SIZEMORE AVE 200 - 232 G8r 27298 W SIZEMORE AVE 200 - 232 G8s 27298 W STARMOUNT AVE 206 - 558 G8n 27298 W STARMOUNT AVE 100 - 255 G8o 27298 W STRIDER ST 100 - 416 E5m 27203 W SWANNANOA AVE 206 - 910 G8n 27298 W SWANNANOA AVE 100 - 267 G8o 27298 W VANCE AVE 200 - 254 G8o 27298 W VANCE AVE 200 - 254 G8n 27298 W WAINMAN AVE 100 - 733 D4l 27203 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-127 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP W WAINMAN AVE 700 - 733 D4k 27203 W WALKER AVE 100 - 571 D4p 27203 W WARD ST 100 - 529 D4l 27203 W WHITE DR 100 - 140 H2o 27263 WADDELLS FERRY RD 5000 - 5705 A8 27341 WADDELLS FERRY RD 5000 - 5221 A7 27341 WADDELLS FERRY RD EXT 5800 - 5909 A8 27341 WAGON WHEEL RD 7400 - 7480 G1r 27360 WAGONER RD 5500 - 5719 G2e 27370 WAGONER RD 5500 - 5719 G2f 27370 WAGONER VIEW DR 5332 - 5500 G2j 27370 WAKETA DR 100 - 420 F4d 27203 WALDEN LN 6100 - 6216 H3d 27263 WALDEN POND RD 6092 - 6300 H5d 27313 WALDEN RD 1000 - 1156 C5f 27205 WALKER CIR 1100 - 1215 D4c 27205 WALKER CIR 1100 - 1215 C4e 27205 WALKER CTRY LN 695 - 870 D3b 27205 WALKER CTRY LN 695 - 870 D3c 27205 WALKER CTRY LN 695 - 870 D3d 27205 WALKER DR 3204 - 3300 D3a 27205 WALKER MILL RD 5500 - 6105 G4d 27317 WALKER MILL RD 4500 - 5926 F4a 27350 WALKER MILL RD 4500 - 5926 G4c 27350 WALKER RD 1300 - 1613 C3b 27205 WALKER ST 400 - 540 A5f 27341 WALKER ST 400 - 540 A5j 27341 WALKER STORE RD 2800 - 3646 F6 27248 WALKER STORE RD 2600 - 3132 F6c 27248 WALKING STICK DR 5524 - 5600 G2c 27370 WALL BROTHERS RD 4346 - 5012 F4a 27350 WALL BROTHERS RD 4900 - 5303 G4c 27350 WALL CTRY DR 1100 - 1166 F5d 27248 WALL FARM DR 4800 - 4953 G8b 27298 WALL LN 2900 - 2982 F2b 27370 WALL RD 2700 - 3122 F8a 27355 WALL ST 700 - 915 H2p 27263 WALLACE ST 100 - 226 E6p 27248 WALLACE ST EXT 226 - 309 E6p 27248 WALNUT CREEK LN 238 - 400 D6f 27205 WALNUT DR 288 - 500 B4b 27205 WALNUT DR 288 - 500 B5a 27205 WALNUT GROVE RD 100 - 425 H2n 27263 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-128 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP WALNUT RIDGE RD 2400 - 2593 E5e 27317 WALNUT RIDGE RD 300 - 2593 F5q 27317 WALNUT ST 2000 - 2025 E5i 27203 WALNUT ST 300 - 342 E6o 27248 WALT BROWN RD 4200 - 4357 C8 27208 WALTER MEADOWS RD 398 - 606 G4d 27317 WALTER SAUNDERS DR 1423 - 1500 E5s 27203 WALTON CT 900 - 942 D5m 27203 WANDA DR 4600 - 4727 G1h 27370 WARD FARM RD 800 - 903 D8 27316 WARD RD 2 - 1100 F8t 27355 WARD RD 2 - 1100 E8 27355 WARD VALLEY DR 800 - 951 E5j 27203 WARREN DR 2100 - 2200 F8c 27355 WARREN LN 5010 - 5100 G2g 27370 WARREN ST 100 - 207 F8p 27355 WARREN ST 100 - 207 F8t 27355 WASHINGTON AVE 212 - 325 D4p 27205 WATER OAK CT 4200 - 4220 F5f 27317 WATERBURY DR 7110 - 7114 H3m 27263 WATERCREST TRL 4900 - 5008 E2b 27205 WATERFORD DR 7000 - 7142 G1o 27370 WATERFRONT CT 245 - 299 E5e 27203 WATERLEAF LN 1864 - 1900 F1 27360 WATEROAK DR 400 - 495 D7e 27316 WATEROAK DR 400 - 443 E7q 27316 WATERS EDGE DR 101 - 210 H3q 27263 WATERSIDE DR 2400 - 2460 E5e 27203 WATERVIEW CT 460 - 533 E5e 27203 WATKINS ST 300 - 455 D5i 27203 WATKINS ST 442 - 516 D5e 27203 WATKINS ST 1700 - 1707 E7q 27316 WAYMON ST 100 - 346 A5j 27341 WAYNE RD 3000 - 3436 C6b 27205 WAYNE RD 3000 - 3436 C6d 27205 WAYNE WHITE RD 1996 - 3191 H6c 27233 WAYNE WHITE RD 3043 - 3611 G6a 27233 WAYNE WHITE RD 3192 - 3692 G6b 27233 WAYNICK MEADOW RD 4000 - 6033 C2 27205 WAYNICK MEADOW RD 4000 - 4833 B2 27205 WEANT RD 5832 - 6732 H3c 27263 WEANT RD 6789 - 7045 H3m 27263 WEATHERLY DR 5910 - 6100 H6c 27313 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-129 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP WEATHERLY DR 5910 - 6100 G6a 27313 WEATHERLY DR 100 - 335 E6o 27248 WEATHERLY SQ 100 - 108 E7r 27316 WEATHERLY ST 440 - 465 E7r 27316 WEAVER ST 100 - 208 F5e 27317 WEDGE PL 2496 - 2600 C4t 27205 WEDGEWOOD FOREST DR 273 - 500 D3a 27205 WEDGEWOOD RD 4477 - 4800 G5d 27317 WEDGEWOOD ST 132 - 229 H2o 27263 WEDGEWOOD TER 4100 - 4292 G2i 27370 WEEDEN ST 3300 - 3791 F8a 27355 WEEDEN ST 3151 - 3687 F8o 27355 WEEDEN ST 3300 - 3687 F8c 27355 WEEPING WILLOW CT 6200 - 6256 H6c 27313 WELBORN CIR 2047 - 2051 E7q 27316 WELBORN RD 6500 - 7306 G1l 27370 WELBORN RD 5700 - 6420 G2i 27370 WELBORN RD 6100 - 6420 G2c 27370 WELBORN RD 5700 - 6010 G2j 27370 WELBORN RD 7200 - 7649 G1k 27370 WELBORN RIDGE CT 6500 - 6590 F1 27360 WELCH LN 1600 - 1625 D5d 27205 WELLINGTON PL 846 - 900 E4o 27205 WELLS CIR 1100 - 1125 D4p 27203 WELLS LN 4900 - 5116 G5n 27317 WESLEY CT 300 - 327 D4l 27203 WESLEY FARM LN 2980 - 3100 F3c 27350 WESLEY FARM LN 2980 - 3100 F3d 27350 WESLEYAN RD 3200 - 3490 F4d 27317 WESLEYAN RD 3200 - 3490 F4p 27317 WEST BROOK CT 100 - 818 H2n 27263 WEST BROOK CT 800 - 1218 H2o 27263 WEST CT 6300 - 6327 H5d 27313 WEST EDGEWOOD CIR 100 - 210 A5f 27205 WEST FORK DR 3300 - 3330 D3a 27205 WEST LAKE DR 1300 - 1524 E4c 27205 WEST ST 100 - 300 D4k 27205 WEST ST 100 - 135 E6p 27248 WESTBURY DR 100 - 472 D4n 27205 WESTBURY DR 400 - 540 D4r 27205 WESTCHAPEL RD 1500 - 2414 D4a 27205 WESTCHAPEL RD 1500 - 1849 D4c 27205 WESTCHAPEL RD 1300 - 1849 D4n 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-130 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP WESTFIELD CHURCH RD 6700 - 6965 E1 27370 WESTGATE RD 2400 - 2634 C4c 27205 WESTHAVEN LN 4300 - 6014 G2h 27370 WESTHAVEN LN 6000 - 6014 G2l 27370 WESTMINSTER CT 155 - 615 D4a 27205 WESTMINSTER DR 400 - 575 E5q 27203 WESTMONT CIR 1400 - 1457 D4g 27205 WESTMONT CT 700 - 1530 D4g 27205 WESTMONT DR 700 - 1590 D4g 27205 WESTON WOODS CIR 100 - 303 H2s 27370 WESTOVER TER 1100 - 1309 E4s 27205 WESTOVER TER 1100 - 1169 D4g 27205 WESTSIDE CIR 100 - 267 D4n 27205 WESTVIEW AVE 1200 - 1328 D4g 27205 WESTWIND WAY 2380 - 2500 E4e 27350 WESTWOOD AVE 2200 - 2381 C3d 27205 WESTWOOD AVE 2300 - 2381 C4c 27205 WESTWOOD DR 1200 - 1429 D4k 27205 WESTWOOD DR 200 - 718 A5j 27341 WESTWOOD DR 220 - 718 A5a 27341 WEXFORD CIR 1 - 19 G1f 27360 WEXFORD CIR 20 - 40 G1g 27360 WHALE TAIL RD 3213 - 3500 C3c 27205 WHEATMORE CT 6807 - 6900 G1o 27370 WHIPPOORWILL DR 3000 - 3200 E3c 27205 WHIPPOORWILL DR 3000 - 3200 E3d 27205 WHIRLWIND LN 2400 - 2511 E5e 27203 WHISPER OAK DR 4715 - 5025 G2h 27370 WHISPERING PINE DR 1292 - 1400 F5d 27317 WHISPERING WAY 2646 - 3000 G3s 27350 WHISPERING WOODS CT 6700 - 6831 F1 27360 WHITAKER CTRY RD 4400 - 4522 G6d 27233 WHITAKER RD 3610 - 3880 B4 27205 WHITAKER RD 3610 - 3880 B4b 27205 WHITE HORSE DR 3766 - 3800 G1k 27370 WHITE HORSE DR 3766 - 3800 G1o 27370 WHITE LAKE DR 100 - 175 E8 27316 WHITE LN 2781 - 3000 G3k 27263 WHITE OAK DR 4200 - 4288 F5f 27317 WHITE OAK ST 339 - 631 D4h 27203 WHITE OAK ST 200 - 396 D4l 27203 WHITE OAK WAY 3155 - 3200 F8a 27355 WHITE PINES LN 2100 - 2358 A4 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-131 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP WHITE POPLAR ST 100 - 161 E8 27316 WHITE ST 100 - 125 F5i 27317 WHITES CHAPEL RD 4900 - 6548 F7 27355 WHITES CHAPEL RD 6145 - 6548 F8c 27355 WHITES MEMORIAL RD 1100 - 2759 E6a 27248 WHITES MEMORIAL RD 1900 - 3335 F6c 27248 WHITES MEMORIAL RD 1100 - 1222 E6m 27248 WHITETAIL DR 4238 - 4300 F2b 27370 WHITLEY CTRY RD 2900 - 3025 D6c 27205 WHITLEY ST 110 - 250 D4s 27205 WHITT HUNT RD 1500 - 2256 H5d 27313 WICKER LOVELL RD 1528 - 2660 E5b 27317 WICKER LOVELL RD 1400 - 1637 E6a 27317 WICKER LOVELL RD 1100 - 1527 E6m 27317 WICKER LOVELL RD 2400 - 2660 F5d 27317 WILD ROSE DR 1300 - 1397 F4a 27350 WILDERNESS TRL 300 - 670 E2a 27370 WILDERNESS TRL 300 - 670 E2c 27370 WILDFLOWER CT 2243 - 2400 D6e 27205 WILDLIFE WAY 1600 - 1674 C5j 27205 WILDWOOD LN 2356 - 2500 D6e 27205 WILDWOOD RD 2300 - 2717 F2a 27370 WILDWOOD TRL 6677 - 7100 G1g 27360 WILKES SNIDER RD 6600 - 7176 B1 27239 WILKES SNIDER RD 6600 - 7176 A1 27239 WILL COLTRANE RD 1569 - 1800 G4c 27350 WILLARD RD 5400 - 7444 F8a 27355 WILLARD RD 5400 - 5946 F7 27355 WILLIAM AVE 700 - 799 D4o 27203 WILLIAM AVE 700 - 799 D4p 27203 WILLIAM BURGESS RD 5600 - 5812 D7b 27316 WILLIAM DR 1570 - 1600 C3d 27205 WILLIAM DR 1570 - 1600 C4c 27205 WILLIAM HENLEY PL 2710 - 2800 F3c 27350 WILLIAM LEE PL 6200 - 6371 H3d 27263 WILLIAM PENN DR 2000 - 2065 E5b 27317 WILLIAMS CT 754 - 1000 H5c 27313 WILLIAMS CTRY RD 6921 - 7000 F8c 27355 WILLIAMS CTRY RD 6921 - 7000 F8s 27355 WILLIAMS DAIRY RD 3690 - 3935 G7 27298 WILLIAMS DAIRY RD 3000 - 3935 F7 27298 WILLIAMS FARM RD 3700 - 4169 B4 27205 WILLIAMS FARM RD 3700 - 4169 B4b 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-132 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP WILLIAMS RD 600 - 709 D7e 27316 WILLIAMS ST 1100 - 1115 E7r 27316 WILLIAMS ST 1100 - 1108 D7a 27316 WILLIAMSBURG DR 4100 - 4232 G3i 27370 WILLIE WRIGHT RD 1700 - 3520 D8 27316 WILLIE WRIGHT RD 2900 - 4197 C8 27316 WILLOW BEND RD 4700 - 4855 G2f 27370 WILLOW CHAPEL CT 1970 - 2100 H6c 27313 WILLOW CREEK CT 700 - 707 D5e 27203 WILLOW DOWNS CT 1300 - 1404 C5j 27205 WILLOW GROVE TRL 4356 - 4700 C2 27205 WILLOW GROVE TRL 4356 - 4700 B2 27205 WILLOW HILL CT 6343 - 6400 H6c 27313 WILLOW LAKE RD 256 - 300 E6r 27203 WILLOW MEADOWS DR 2100 - 2228 H6c 27313 WILLOW OAK DR 1900 - 2238 F1b 27360 WILLOW OAK DR 1900 - 2107 F1 27360 WILLOW RD 1900 - 1955 E5m 27203 WILLOW SPRINGS DR 2100 - 2209 H6c 27313 WILLOW TER 100 - 408 H3m 27263 WILLOW TOWER CT 6375 - 6400 H6c 27313 WILLOW WOOD RD 1211 - 1300 D4n 27205 WILLOWOOD DR 690 - 807 E5e 27317 WILLOWOOD DR 710 - 829 E5f 27317 WILLOWOOD DR 690 - 699 E5i 27317 WILSON CT 969 - 1000 E4s 27205 WILSON DR 1000 - 1124 E4s 27205 WILSON LN 1462 - 1600 C3d 27205 WILSON LN 1462 - 1500 C4c 27205 WILSON ST 700 - 731 D4g 27205 WILSON ST 600 - 643 D4g 27205 WILSON VIEW DR 5027 - 5100 H1s 27263 WINCHESTER CT 100 - 199 G2h 27370 WINCHESTER HEIGHTS DR 1764 - 1900 D5d 27205 WINCHESTER HEIGHTS DR 1764 - 1900 D6c 27205 WINCREST DR 7200 - 7325 H3o 27263 WINCY RD 4200 - 4239 C7 27316 WINCY RD 4200 - 4239 C6d 27316 WINDCREST RD 1750 - 1800 E5m 27203 WINDEMERE CIR 5000 - 5706 G3i 27370 WINDEMERE CIR 5000 - 5706 G3j 27370 WINDERMERE CT 800 - 861 D4p 27203 WINDFLOWER LN 400 - 490 D6e 27205 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-133 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP WINDING CEDAR RD 6100 - 6171 G5a 27317 WINDING TREE TRL 4945 - 5100 G5d 27317 WINDING TREE TRL 4945 - 5100 G6c 27317 WINDING WOODS LN 2400 - 2720 D3d 27205 WINDOVER RD 1100 - 1178 E5j 27317 WINDRIDGE CT 4366 - 4400 G2j 27370 WINDRIVER RD 4200 - 4516 B4 27205 WINDSONG RD 2314 - 2660 F3c 27350 WINDSOR DR 500 - 582 E5q 27203 WINDSOR PLACE CIR 100 - 343 F5m 27317 WINDSOR TRL 700 - 856 E5r 27203 WINDSTONE CT 2500 - 2553 E5e 27203 WINDY DR 2400 - 2561 E6a 27248 WINN DEE REST LN 3149 - 3400 F3c 27350 WINNERS CIR 6872 - 7000 G1o 27370 WINNETKA CT 600 - 635 E5q 27203 WINNETKA CT 600 - 635 E5r 27203 WINSLOW AVE 1200 - 1464 D4k 27205 WINTER ST 2023 - 2053 E5i 27203 WISCHUM WAY 1336 - 1400 E2b 27370 WISTERIA LN 1900 - 1933 C3b 27205 WISTERIA LN 1900 - 1933 C3d 27205 WOOD AVE 3700 - 4137 H3q 27263 WOOD AVE 4089 - 4137 H2t 27263 WOOD BLUFF TRL 1900 - 1975 C3b 27205 WOOD MEADOWS RD 4900 - 5101 F7 27355 WOOD MINT RD 400 - 461 B5a 27205 WOOD SAGE DR 6600 - 6903 A3 27371 WOOD VILLAGE DR 3508 - 3800 G3n 27370 WOODALE CT 2940 - 3100 G1s 27360 WOODALE DR 1400 - 1461 C4l 27205 WOODALE FOREST LN 7000 - 7078 G1s 27360 WOODBREEZE DR 2500 - 2603 E5e 27317 WOODBURY ST 100 - 129 E4t 27203 WOODBURY ST 100 - 129 E5q 27203 WOODCREST DR 700 - 884 D4t 27205 WOODCREST DR 800 - 884 C4h 27205 WOODCREST RD 100 - 346 E4t 27203 WOODCREST ST 3900 - 4146 G1l 27370 WOODCREST ST 3900 - 4022 G1p 27370 WOODELL AVE 2300 - 2309 E7q 27316 WOODELL AVE 2300 - 2309 E7r 27316 WOODELL AVE 2300 - 2309 D7a 27316 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-134 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP WOODELL CTRY RD 1900 - 2149 C5 27205 WOODFERN RD 3700 - 4299 C6c 27205 WOODFERN RD 3700 - 4948 B6 27205 WOODFERN RD 4300 - 4948 B6b 27341 WOODFIELD CT 2400 - 2455 E4e 27350 WOODFIELD CT EXT 2480 - 2524 E4e 27350 WOODFIELD DR 2400 - 2717 E3b 27350 WOODFIELD DR 2100 - 2608 E4e 27350 WOODFIELD DR 2100 - 2215 E4a 27350 WOODFIELD SCOUT TRL 300 - 491 E2d 27205 WOODGLO DR 1708 - 1900 D6d 27205 WOODHAVEN DR 2800 - 2926 C6a 27205 WOODLAND CIR 600 - 693 D5e 27203 WOODLAND TRL 2889 - 3000 E6r 27203 WOODLAND VIEW PL 3800 - 3977 D6d 27205 WOODLANE CT 1875 - 2000 C3a 27205 WOODLAWN ST 500 - 593 D5e 27203 WOODLAWN ST 400 - 593 D5i 27203 WOODLYN WAY 4100 - 4220 G3m 27370 WOODMEN CAMP TRL 578 - 900 F5r 27317 WOODMONT DR 210 - 300 E7m 27316 WOODMONT DR 210 - 255 E7q 27316 WOODMONT PL 4474 - 4500 E7m 27316 WOODOAK TRL 522 - 700 G4b 27317 WOODOAK TRL 522 - 700 G5a 27317 WOODRIDGE DR 2302 - 2500 D6e 27205 WOODROW JULIAN RD 1600 - 1763 F7 27355 WOODS DAIRY RD 8100 - 8936 D1 27239 WOODS DR 311 - 519 G5r 27317 WOODS DR 511 - 519 F5f 27317 WOODS STREAM LN 1943 - 2500 D6e 27205 WOODSIDE PL 1047 - 1100 E4c 27205 WOODSIDE PL 1047 - 1100 E4s 27205 WOODSTREAM RD 5545 - 5800 G5b 27317 WOODVERY DR 4500 - 4829 H7c 27298 WOODVIEW DR 2473 - 2500 F1g 27360 WOOLLEN DR 4859 - 4900 G5c 27317 WORTH ST 400 - 519 F5i 27317 WORTH ST 300 - 1044 D5i 27203 WORTH ST 100 - 344 D4l 27203 WORTHVILLE RD 1305 - 1979 F5o 27317 WORTHVILLE RD 100 - 866 F5m 27317 WORTHVILLE RD 674 - 1544 F5n 27317 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-135 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP WORTHVILLE ST 100 - 799 F5i 27317 WRENN SMITH RD 2314 - 2508 D8 27344 WRENWOOD CT 260 - 275 E5e 27203 WRIGHT CTRY RD 103 - 1469 E8 27316 WRIGHT CTRY RD 103 - 737 E7l 27316 WRIGHT CTRY RD 103 - 737 E7d 27316 WRIGHT CTRY RD 1087 - 1469 F8c 27316 WRIGHT FARM LN 3540 - 3800 D6b 27248 WRIGHT RD 6665 - 7300 G1s 27360 WRIGHT RD 7217 - 7400 G1r 27360 WRIGHT ST 100 - 342 A5j 27341 WRIGHT ST 100 - 222 E7q 27316 WYNNEWOOD DR 320 - 342 H2n 27263 WYNNEWOOD DR 320 - 342 H2o 27263 WYOMING CT 4300 - 4341 G1j 27360 YANCEY AVE 2042 - 2101 E5i 27203 YESTEROAKS CT 1847 - 1900 C3a 27205 YORK ACRES DR 4841 - 4900 F7 27298 YORK CTRY DR 400 - 557 E8 27355 YORK LN 300 - 398 E6p 27248 YORK MARTIN RD 4560 - 5824 G8a 27298 YORK MARTIN RD 4560 - 4995 G8j 27298 YORK RIVER RD 4500 - 4921 D7a 27316 YORK ST 489 - 504 E7r 27316 YORK ST 700 - 725 D4h 27203 YORKMONT CT 600 - 717 E5r 27203 YORKTOWN DR 4759 - 5000 G3i 27370 YORKTOWN LN 1807 - 1824 E4p 27203 YOUNG OAK DR 7103 - 7200 G1s 27360 YOUNG RD 4200 - 4618 D6d 27205 YOUNG RD 4260 - 4618 D7 27316 YOUNTS ST 5200 - 5324 H2r 27370 YOUNTS VIEW DR 5300 - 5345 H2r 27370 YOUTH CAMP RD 3500 - 3594 F3c 27350 YOUTH UNLIMITED DR 2746 - 3110 F3b 27350 YOUTH UNLIMITED DR 2746 - 3110 F3d 27350 YOW DR 100 - 392 A5j 27341 YOW RD 1060 - 1060 A6 27341 YZEX ST 102 - 305 E4l 27203 YZEX ST 102 - 215 E5i 27203 ZACHARY KENT DR 102 - 106 H2m 27263 ZELMA BLVD 5700 - 5876 H1o 27263 ZION CHURCH RD 7507 - 7921 E8 27355 APPENDIX A: ROAD NAME LIST Revised: 5/25/2022 Appendix A-136 of 136 ROAD NAME ADDRESS RANGE PAGE ZIP ZOO CONNECTOR 1700 - 2310 C5c 27205 ZOO CONNECTOR 1700 - 2310 C5j 27205 ZOO PKWY 4600 - 4604 C5c 27205 ZOO PKWY 1800 - 2504 D5q 27205 ZOO PKWY 5253 - 5972 B5a 27205 ZOO PKWY 2300 - 3525 C5e 27205 ZOO PKWY 1400 - 1647 D4p 27205 ZOO PKWY 5800 - 6239 B4b 27205 ZOO PKWY 1500 - 1822 D4t 27205 ZOO PKWY 3300 - 4297 C5j 27205 ZOO PKWY 0 - 5358 C5c 27205 ZOO PKWY 3300 - 3525 C5f 27205 ZOO PKWY 0 - 0 C5 27205 APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-1 of 63 ROAD NAME ADDRESS RANGE PAGE ASHEBORO (27203/27205) ALBEMARLE RD 600 - 1099 D4o ALBEMARLE RD 500 - 861 D4p AMELIA CT 1833 - 1842 E4p AMITY RD 600 - 1100 D4h ANNS CT 600 - 1100 D5q ANNS CT 700 - 915 D5r APRIL LN 700 - 791 D4t ARMADILLO DR 700 - 769 D4s ARMFIELD AVE 200 - 435 D4p ARNOLD ST 900 - 950 D4k ARROW WOOD RD 1200 - 1721 D5m ARROW WOOD RD 1600 - 1721 D5q ART BRYAN DR 100 - 419 E4h ART BRYAN DR 100 - 419 E5e ARTHUR ST 100 - 125 E4t ARTHUR ST 100 - 125 E5q ASHDOL ST 800 - 921 D4k ASHEFORD CT 900 - 1000 D4a ASHEWOOD CIR 1200 - 1510 E5e ASHEWOOD CIR 300 - 614 E5i ASHEWOOD CIR 1600 - 1810 E5e ASHEWOOD CIR 1600 - 1810 E5i ASHEWOOD CIR 100 - 214 E5i ASHEWOOD CIR 700 - 1110 E5e ASHEWOOD CIR 700 - 1110 E5i ASHLEY ST 110 - 209 E5q ASHLEY ST 1526 - 1530 E5q ASHMONT CT 401 - 439 D4s ASPEN CT 249 - 264 E4l ATLANTIC AVE 100 - 466 D4p AVANTI DR 1122 - 1169 C5 AVONDALE AVE 600 - 1041 D5m AYCOCK ST 1430 - 1441 E5j AYCOCK ST 1430 - 1441 E5k BANK ST 2500 - 2569 E4h BANK ST 2443 - 2458 E4h BARBER ST 215 - 234 E4t BARCLAY PL 2100 - 2119 E5j BAY LEAF CT 928 - 941 D5e BENNETT ST 600 - 833 E5m BERG ST 826 - 918 D4o APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-2 of 63 ROAD NAME ADDRESS RANGE PAGE BETTS ST 100 - 139 D4h BIRCH BARK LN 2355 - 2375 E5e BIRCH BARK LN 2355 - 2375 E5i BIRKHEAD ST 100 - 129 D4p BOBWHITE LN 1568 - 1619 En BOGEY LN 1800 - 1850 D4t BOLING DR 1300 - 1325 E5q BOLING DR 1300 - 1325 D5e BONKEMEYER DR 1000 - 1036 E5j BONKEMEYER DR 500 - 614 E5j BOSSONG DR 200 - 370 D4k BOSSONG DR 229 - 370 D4g BRADY AVE 600 - 748 D4p BRADY AVE 700 - 748 D4o BREEZE HILL RD 600 - 1035 D4o BREEZE HILL RD 600 - 920 D4k BREEZEWAY CT 1000 - 1014 D4o BRENTWOOD CT 600 - 605 D5e BREWER ST 400 - 1022 D5i BREWER ST 200 - 423 D5e BREWER ST 200 - 316 D4h BRITT AVE 700 - 791 D4o BRITT AVE 700 - 791 D4p BRITTAIN ST 100 - 212 E5q BRITTAIN ST 300 - 418 E5q BROOK DR 1700 - 1785 D4t BROOKDALE DR 1101 - 1723 D5m BROOKDALE DR 1400 - 1723 D5q BROOKSIDE DR 300 - 359 D4l BROOKSIDE DR 300 - 359 D5i BROOKWAY RD 50 - 100 D4o BROOKWOOD DR 500 - 579 D5e BROWERS CHAPEL RD 100 - 397 D5m BROWN TRL 565 - 700 D5q BROWNMIRE DR 653 - 700 D5q BRYAN AVE 822 - 921 D4p BUCKHORN DR 2608 - 2787 F5q BUCKHORN DR 2608 - 2787 F5r BUCKHORN DR 2608 - 2787 E5f BUGATTI AVE 1800 - 1820 C5 BULLA ST 100 - 113 D4p BURGESS ST 1814 - 1834 E5n BURGESS ST 1800 - 1813 E5n APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-3 of 63 ROAD NAME ADDRESS RANGE PAGE BURMIL RD 1700 - 1819 E4p BURNS ST 100 - 223 D4l BURNS ST 200 - 223 D5i BUTTERFLY TRL 2555 - 2595 E5f CALLICUT ST 400 - 471 D5i CANNON CT 300 - 351 D4g CANNON CT 300 - 351 D4k CANOY DR 1837 - 1837 E4p CANOY DR 1821 - 1833 E4p CANOY DR 1839 - 1940 E4p CARL DR 2000 - 2064 E4l CARL DR 2100 - 2151 E4l CARL DR 2152 - 2331 E4h CARL DR 2152 - 2331 E4l CAROLINA AVE 100 - 301 D4h CAROLINA AVE 100 - 301 D5e CASCADE AVE 600 - 658 D4h CASPN DR 200 - 219 D4p CAUDLE RD 200 - 399 F5q CAUSEY DR 383 - 400 F5q CAUSEY DR 383 - 400 E5e CECYLIA CT 262 - 290 F5q CEDAR FALLS RD 929 - 1047 D5i CEDAR RD 1900 - 1931 E5m CEDAR RD 1932 - 2075 E5m CEDARDALE CT 2409 - 2428 E5e CELESTE LN 500 - 519 E5m CENTER ST 800 - 985 D4p CENTRAL FALLS RD 700 - 810 E5m CENTRAL FALLS RD 908 - 1000 E5n CENTRAL FALLS RD 900 - 907 E5m CENTRAL FALLS RD 900 - 907 E5n CENTRAL FALLS RD 811 - 831 E5m CHAMBERLIN DR 900 - 1200 D4a CHAMBERLIN DR 1010 - 1200 E4c CHAMPAGNE DR 2000 - 2055 E4l CHAPELGATE LN 1100 - 1147 D4g CHEDDINGTON DR 700 - 766 E5r CHEROKEE ST 300 - 405 D4k CHESTNUT ST 200 - 516 D4h CHESTNUT ST 200 - 369 D4l CHICKADEE CIR 1323 - 1388 E5r CITY VIEW ST 400 - 723 D4h APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-4 of 63 ROAD NAME ADDRESS RANGE PAGE CLARENDON RD 900 - 1006 D4g CLAY ST 1104 - 1113 D4h CLEGG AVE 500 - 520 E4p CLEVELAND ST 1122 - 1317 D4g CLIFF RD 600 - 1317 D5m CLIFF RD 200 - 633 D5i CLOVER ST 908 - 921 D4h COLERIDGE RD 200 - 351 D5i COLONY RD 500 - 741 D5q COMMERCE PL 438 - 836 E4h COMMERCE PL 300 - 437 E4h COMMERCE PL 100 - 202 E4h COOL SPRING ST 700 - 836 D5i COOPER ST 200 - 554 D4p CORNELL ST 1000 - 1121 E5n CORVETTE AVE 1220 - 1437 C5 CORWITH ST 816 - 853 D4g COUNTRY CLUB DR 100 - 630 D4p COVENANT MOUNTAIN RD 1500 - 1600 D5j COX AVE 500 - 570 D4p COX AVE 500 - 570 D5m COXEMOOR PL 1800 - 1841 D5q CRACKLIN DR 222 - 241 E5q CRANFORD ST 100 - 177 D4l CREEKSIDE DR 265 - 277 E4l CREEKSIDE DR 278 - 280 E4l CREEKSIDE DR 285 - 287 E5i CREEKSIDE DR 149 - 292 E5i CREEKSIDE DR 281 - 284 E4l CREEKSIDE DR 281 - 284 E5i CRESTVIEW ST 200 - 229 D4k CROSS ST 300 - 822 D5i CROSS ST 500 - 864 D5e CROWNE PARK AVE 200 - 300 D5e CURRY DR 806 - 899 D4s CYPRESS DR 600 - 647 D5m DAIRY ST 900 - 933 D4o DAVES MTN CT 1000 - 1082 D4g DAVIS ST 100 - 153 D4l DEER RIDGE RD 2400 - 2518 C3c DEER RIDGE RD 2377 - 2423 C3a DELLWOOD AVE 500 - 646 D5m DENNIS ST 1800 - 1940 D4s APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-5 of 63 ROAD NAME ADDRESS RANGE PAGE DIXON AVE 600 - 803 D4l DIXON AVE 801 - 851 D4k DIXON ST 100 - 147 D4l DOOLEY DR 400 - 447 E5e DOVER ST 1932 - 1965 E5i DOVER ST 1932 - 1965 E5m DRAPER ST 1122 - 1142 E5n DRAPER ST 1000 - 1119 E5n DRAPER ST 900 - 929 E5m DRAPER ST 900 - 929 E5n DUBLIN RD 222 - 629 D5i DUBLIN RD 600 - 950 D5m DUBLIN RD EXT 171 - 200 D5m DUBLIN SQUARE RD 100 - 199 D5i DUMONT ST 2200 - 2209 E5k DUMONT ST 2210 - 2221 E5k DUNDEE ST 100 - 280 D4o DUNLAP ST 200 - 433 D5i DUNWOODY CT 224 - 248 E4l E ACADEMY ST 100 - 243 D4l E ALLRED ST 1400 - 1521 E5r E ALLRED ST 1254 - 1383 E5r E ALLRED ST 100 - 513 E5q E ALLRED ST 1522 - 1599 E5r E BAILEY ST 300 - 313 E5m E BAILEY ST 100 - 221 E5m E BAILEY ST 314 - 325 E5m E BALFOUR AVE 200 - 217 E5m E BALFOUR AVE 100 - 127 E5m E BALFOUR AVE 300 - 415 E5m E BALFOUR AVE 500 - 513 E5m E BEASLEY ST 100 - 110 E5m E BEASLEY ST 200 - 301 E5m E CENTRAL AVE 400 - 417 E5i E CENTRAL AVE 400 - 417 E5m E CENTRAL AVE 418 - 428 E5m E CENTRAL AVE 430 - 435 E5m E CENTRAL AVE 298 - 299 E5i E CENTRAL AVE 500 - 516 E5m E CENTRAL AVE 522 - 615 E5m E CENTRAL AVE 310 - 313 E5i E CENTRAL AVE 300 - 308 E5i E CENTRAL AVE 518 - 521 E5m APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-6 of 63 ROAD NAME ADDRESS RANGE PAGE E CENTRAL AVE 100 - 217 E5i E CENTRAL AVE 315 - 326 E5i E CHAMBERLIN DR 900 - 1100 D4a E DIXIE DR 500 - 1339 D5m E DIXIE DR 100 - 569 D4p E DIXIE DR 1135 - 1708 D5j E DIXIE DR 1135 - 1339 D5n E DORSETT AVE 100 - 573 D4p E DORSETT AVE 446 - 573 D5m E KIVETT ST 100 - 432 D4l E KIVETT ST 404 - 640 D5i E MILLER ST 100 - 123 D4h E MINE ST 1100 - 1249 D4s E PRESNELL ST 200 - 948 D5e E PRESNELL ST 100 - 239 D4h E PRESNELL ST 1300 - 2062 D5f E PRITCHARD ST 200 - 846 D5e E PRITCHARD ST 100 - 241 D4h E SALISBURY ST 300 - 1365 D5i E SALISBURY ST 1300 - 1807 D5j E SALISBURY ST 100 - 349 D4l E STRIDER ST 100 - 218 E5m E TAFT AVE 100 - 149 D4p E WAINMAN AVE 100 - 250 D4l E WALKER AVE 100 - 250 D4p E WARD ST 100 - 363 D4l E WARD ST 300 - 363 D5i EAGLE OAKS LN 1200 - 1320 C5f EAST ST 100 - 166 D4k EASTON EXT 300 - 322 D4r EASTVIEW DR 700 - 825 D5e ECKERD ST 208 - 421 E5i EDGE CT 952 - 963 D5q EDGEWOOD RD 500 - 875 D4g ELDORADO RD 463 - 487 D4t ELWOOD STOUT ST 200 - 283 D4o EMERSON DR 600 - 713 D5m ENGLISH ST 104 - 207 E5q ENGLISH ST 208 - 309 E5q ENTERPRISE ST 2216 - 2337 D4t ENZO LN 1825 - 1833 C5 EXECUTIVE WAY 900 - 940 D5m FAIRFAX CT 481 - 497 D4h APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-7 of 63 ROAD NAME ADDRESS RANGE PAGE FAIRFIELD ST 100 - 109 D4h FAIRWAY RD 1500 - 1815 D4p FAIRWAY RD 1700 - 1815 D4t FARMER RD 100 - 520 D4k FARR ST 600 - 735 D5e FERMER RD 800 - 935 D4o FERRARI DR 1500 - 1701 C5 FESMIRE ST 700 - 815 D5q FINCHLEY CT 1651 - 1670 E5n FINCHLEY CT 1613 - 1650 E5n FINCHLEY CT 1585 - 1612 E5n FIRST ST 1400 - 1505 D4p FIRST ST 1700 - 1769 D4t FLINT ST 1718 - 1740 E5m FLINT ST 1741 - 1799 E5m FLINT ST 1800 - 1837 E5m FOREST BROOK CIR 1 - 150 E4l FOREST BROOK CIR 1 - 150 E5i FOREST BROOK CIR 0 - 0 E5i FOREST PARK DR 2900 - 3177 F5q FOREST PARK DR 2900 - 2947 E5e FOREST PARK DR 2219 - 2399 E5e FOREST PARK DR 2778 - 2849 E5e FOREST PARK DR 2979 - 3177 F4d FOREST PARK DR 2400 - 2430 E5e FOSTER ST 100 - 234 D4t FOUST ST 200 - 345 D4h FOX RIDGE RD 2400 - 2656 C3d FRANCIS ST 100 - 122 E5m FRANKS ST 600 - 829 D5i FRANKTON CT 1500 - 1530 D4a FRAZIER ST 300 - 345 D4l FREEDOM DR 300 - 352 D4l FRIENDLY RD 200 - 215 D5i GALWAY PL 700 - 743 D5m GANT ST 2210 - 2227 E5j GANT ST 2200 - 2209 E5j GANT ST 2200 - 2209 E5k GARDINER RD 200 - 330 D5i GILES CHAPEL RD 1120 - 1301 E5n GINGER CT 240 - 252 F5q GLEN CIR 512 - 520 E5i GLENWOOD RD 300 - 631 D5i APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-8 of 63 ROAD NAME ADDRESS RANGE PAGE GLENWOOD RD 1000 - 1022 D4p GLENWOOD RD 600 - 1022 D5m GLOVINIA ST 300 - 559 D5i GLOVINIA ST 440 - 559 D5e GOLD HILL RD 1429 - 1532 E5n GOLD HILL RD 1816 - 1865 E5n GOLD HILL RD 2027 - 2049 E5j GOLD HILL RD 319 - 1057 D5f GOLD HILL RD 1300 - 1428 E5n GOLD HILL RD 1900 - 2026 E5j GOLD HILL RD 1900 - 2026 E5n GOLD HILL RD 1732 - 1815 E5n GOLDA AVE 2137 - 2155 E5i GOLDA AVE 100 - 216 E5i GREENFIELD ST 600 - 667 D5e GREENLAWN DR 310 - 327 E5i GREENLAWN DR 400 - 517 E5i GREENSBORO ST 320 - 446 D4l GREENSBORO ST 405 - 665 D4h GREENTREE CT 191 - 223 E4l GREENTREE CT 191 - 223 E5i GREENVALE RD 100 - 339 E4l GREENVALE RD 100 - 339 E5i GREENWOOD RD 1900 - 1945 E5m GREY RABBIT RUN 2576 - 2600 C3c GREYSTONE RD 800 - 881 D5i GREYSTONE RD 800 - 1047 D5m GUM ST 100 - 270 F4d GUM ST 100 - 270 F5q HALIFAX ST 600 - 685 D5q HALL DR 300 - 375 D4t HAMLIN ST 332 - 567 D4h HAMLIN ST 332 - 399 D4l HAMMER AVE 400 - 818 D4l HAMMER AVE 700 - 1039 D4p HAMPTON RD 100 - 250 D4h HARRISON ST 301 - 321 D5i HARVELL ST 1700 - 2105 D4s HARVELL ST EXT 246 - 300 D4s HASTY ST 1440 - 1460 E5q HAZELWOOD ST 600 - 649 D5m HEATHER CT 500 - 515 D4h HEATHWOOD RD 1140 - 1153 E5j APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-9 of 63 ROAD NAME ADDRESS RANGE PAGE HEATHWOOD RD 1116 - 1139 E5j HEATHWOOD RD 1100 - 1115 E5j HEMLOCK DR 600 - 641 D5m HENLEY CTRY RD 2143 - 2178 E5k HENLEY CTRY RD 2038 - 2142 E5k HENSON RD 1804 - 1828 E4p HERITAGE CT 2030 - 2059 E5j HICKORY CREEK TRL 500 - 546 D4s HICKORY FOREST DR 2377 - 2437 E5e HICKORY FOREST DR 2377 - 2437 E5i HICKORY FOREST DR 2302 - 2376 E5e HICKORY FOREST DR 2302 - 2376 E5i HIGH MEADOW DR 2527 - 2700 C3d HIGHLAND CT 422 - 535 D4l HIGHLAND ST 600 - 717 D4l HIGHLAND ST 700 - 907 D4p HIGHWOOD DR 900 - 971 D4g HILL ST 312 - 451 D4l HILLCREST CIR 800 - 843 D5m HILLVIEW ST 400 - 440 D4g HINSHAW ST 1600 - 1611 E5m HINSHAW ST 1613 - 1623 E5m HOLLAND ST 2001 - 2037 E5i HOLLY DR 800 - 859 D5q HOLLY ST 200 - 741 D4l HOLLY ST 600 - 741 D4k HOME AVE 500 - 693 D4l HOMEPLACE DR 200 - 258 F5q HOMEPLACE TRL 2500 - 2521 C3d HONEYSUCKLE RD 600 - 613 E5q HONEYSUCKLE RD 775 - 874 E5q HOOVER ST 300 - 843 D4l HOOVER ST 800 - 843 D4k HOPEWELL ST 2204 - 2231 E5j HORSE CARRIAGE LN 1868 - 1969 D5q HORSESHOE BEND RD 2800 - 2897 F5q HUB MORRIS RD 312 - 405 E5e HUB MORRIS RD 511 - 517 E5e HUB MORRIS RD 500 - 510 E5e HUB MORRIS RD 600 - 615 E5e HUB MORRIS RD 406 - 419 E5e HUB MORRIS RD 1106 - 1130 E5j HUB MORRIS RD 251 - 311 E5e APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-10 of 63 ROAD NAME ADDRESS RANGE PAGE HUB MORRIS RD 100 - 250 E5e HUGHES ST 200 - 274 E5m HUGHES ST 200 - 274 E5q HUMBLE HOLLOW DR 300 - 386 E5m HUMBLE HOLLOW DR 300 - 386 E5q HUMBLE ST 1557 - 1619 E5m HUMBLE ST 1557 - 1619 E5q HUMBLE ST 1555 - 1556 E5q HUMBLE ST 1507 - 1554 E5q IDEAL DR 500 - 515 E5q IDEAL DR 310 - 417 E5q IDLEWILD DR 100 - 245 E5e IDLEWILD DR 246 - 357 E5e IDLEWILD DR EXT 2600 - 2665 E5e IDLEWOOD DR 1200 - 1299 E4s IDLEWOOD DR 1200 - 1299 D4g INDEPENDENCE DR 300 - 380 D4l INDUSTRIAL PARK AVE 500 - 734 D4s INDUSTRIAL PARK AVE 100 - 734 D4t INTERSTATE HWY 73/74 2800 - 3099 D4o INTERSTATE HWY 73/74 2400 - 2699 D4k INTERSTATE HWY 73/74 3000 - 3499 D4s INTERSTATE HWY 73/74 3400 - 3499 C4g INTERSTATE HWY 73/74 2400 - 2499 D4g ITASCA CT 600 - 620 E5q IVY CREEK DR 708 - 757 E5e IVY CREEK DR 708 - 757 E5f JAECO CAUDILL DR 700 - 937 D4r JAMES ST 323 - 325 E4t JOHNNYS WAY 1600 - 1640 E5r JOHNNYS WAY 1641 - 1699 E5n JOHNNYS WAY 1641 - 1699 E5r JOHNS RIDGE DR 2458 - 2700 C3c JONES ST 1946 - 1965 E5i JONES ST 1946 - 1965 E5m JORDAN AVE 500 - 521 E4p JORDAN ST 400 - 415 E5m JOYCE ST 827 - 857 D4p JUNIPER CT 2288 - 2297 E5i KAMERIN ST 2800 - 3099 F5q KARLA DR 623 - 700 D5q KELLY CIR 503 - 522 E5i KEMP BLVD 1100 - 1141 D5i APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-11 of 63 ROAD NAME ADDRESS RANGE PAGE KENMORE ST 900 - 1043 D5m KENNELWOOD DR 302 - 324 E4t KENNELWOOD DR 326 - 333 E4t KERRY ST 1000 - 1055 D5i KILDARE RD 729 - 1019 D5m KING CT 2057 - 2107 E5i KING CT 2109 - 2114 E5i KING CT 2047 - 2055 E5i KINGSWAY RD 10 - 28 D4o LAKE DR 700 - 755 D4o LAKE DR 700 - 755 D4p LAKECREST RD 200 - 260 D5j LAKEVIEW RD 1934 - 2035 E5m LAKEVIEW RD 1934 - 2035 E5n LAMAR DR 2040 - 2132 E5i LAMBERT DR 100 - 203 D4o LAMBERT DR 119 - 364 D4s LANDIS CT 219 - 255 E5e LANIER AVE 100 - 430 D4l LANSDOWNE LAKES LN 1000 - 1071 E5r LANSDOWNE LAKES LN 1100 - 1117 E5r LARKWOOD AVE 800 - 823 D5m LAUREL DR 700 - 875 D5q LAWSON CT 2932 - 3044 F5q LEE ST 600 - 1036 D4p LEE ST 500 - 861 D4l LEO LN 2500 - 2553 E5e LEO LN 2600 - 2635 E5e LEO LN 2479 - 2499 E5e LEO LN 2636 - 2695 E5e LEVANCE ST 1900 - 1931 E5m LEVANCE ST 1900 - 1931 E5n LEVANCE ST 1818 - 1835 E5m LEVANCE ST 1818 - 1835 E5n LEWALLEN RD 100 - 541 D4o LEWIS ST 800 - 845 D4k LEWIS ST 800 - 845 D4l LEXINGTON COMMONS DR 1100 - 1200 D4k LEXINGTON PL 200 - 242 D4k LEXINGTON RD 304 - 751 D4g LEXINGTON RD 100 - 427 D4k LIBERTY ST 100 - 317 D4h LINCOLN AVE 500 - 772 D4g APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-12 of 63 ROAD NAME ADDRESS RANGE PAGE LINDLEY AVE 300 - 357 D4l LINDLEY AVE 300 - 357 D5i LINDSEY AVE 433 - 566 D4p LINDSEY AVE 517 - 566 D5m LINEBERRY ST 2002 - 2023 E5i LINEBERRY ST 2024 - 2037 E5i LITTLE GATE DR 1300 - 1542 D4h LITTLE LAKES TRL 1071 - 1312 D4a LOACH ST 300 - 557 D5i LOACH ST 446 - 588 D5e LONDELLE LN 100 - 300 D4s LORD RANDOLPH CIR 560 - 600 D4g LOTUS LN 1720 - 1733 C5 LUXURY LN 700 - 799 D4r MACARTHUR ST 100 - 175 D4l MACHALA DR 2142 - 2167 E5j MACK RD 100 - 267 D4o MACK RD 200 - 267 D4s MACKIE AVE 911 - 1120 D5m MACON ST 900 - 1037 D4p MANDOVER CT 800 - 903 D4a MANOR CIR 523 - 597 D5q MAPLE AVE 637 - 680 D5i MAPLE AVE 427 - 680 D5m MAPLE AVE 300 - 343 D4p MAPLE HILL CT 2562 - 2600 C3c MARK AVE 800 - 935 D5q MARKWOOD ST 921 - 935 D4o MARMADUKE CIR 300 - 345 D4l MARMADUKE CIR 300 - 345 D5i MARTIN LUTHER KING JR DR 423 - 1139 D5i MARTIN LUTHER KING JR DR 1500 - 1597 D5j MCALISTER ST 100 - 143 D5i MCLARKLING LN 450 - 492 D4s MCDOWELL RD 720 - 890 D4s MCDOWELL RD 720 - 758 C4g MCKNIGHT ST 501 - 509 E4h MCKNIGHT ST 100 - 433 E4h MCKNIGHT ST 100 - 433 E5e MCLAREN LN 1850 - 1887 C5 MCLAURIN DR 208 - 236 E4t MCMASTERS ST 100 - 114 D4h MCPHERSON ST 1948 - 2034 E5i APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-13 of 63 ROAD NAME ADDRESS RANGE PAGE MCPHERSON ST 1948 - 2034 E5m MEADOWBROOK RD 1323 - 1399 E5q MEADOWBROOK RD 500 - 820 D5e MEADOWBROOK RD 500 - 539 D5i MEADOWBROOK RD 1402 - 1410 E5q MEADOWBROOK RD EXT 1620 - 1646 E5q MEADOWBROOK RD EXT 1648 - 1656 E5q MEADOWGATE DR 685 - 686 E5i MEADOWGATE DR 680 - 681 E5i MEADOWGATE DR 682 - 683 E5i MEMORIAL ST 100 - 132 D4l MIDDLETON CIR 1300 - 1388 D4a MILBROOK DR 1400 - 1450 D4a MILLIKAN AVE 402 - 415 E5m MOODY ST 1322 - 1341 E4t MORGAN AVE 700 - 850 D4o MORGAN AVE 700 - 850 D4p MORGAN AVE 700 - 850 D4s MOUNTAIN RD 500 - 1255 D4g MOUNTAIN TOP DR 400 - 500 D5j MT CROSS ST 400 - 577 D4h N CHERRY ST 300 - 420 D4k N CHERRY ST 100 - 399 D4l N CHURCH ST 300 - 530 D4h N CHURCH ST 100 - 383 D4l N COX ST 100 - 350 D4l N ELM ST 100 - 433 D5i N ELM ST 260 - 667 D5e N FAYETTEVILLE ST 1230 - 1237 E4t N FAYETTEVILLE ST 1436 - 1444 E5q N FAYETTEVILLE ST 2035 - 2105 E5i N FAYETTEVILLE ST 100 - 472 D4l N FAYETTEVILLE ST 1526 - 1527 E5q N FAYETTEVILLE ST 1106 - 1229 E4t N FAYETTEVILLE ST 400 - 1229 D4h N FAYETTEVILLE ST 2106 - 2135 E5i N FAYETTEVILLE ST 2275 - 2283 E5i N FAYETTEVILLE ST 1800 - 1819 E5m N FAYETTEVILLE ST 1820 - 1839 E5m N FAYETTEVILLE ST 2136 - 2143 E5i N FAYETTEVILLE ST 1600 - 1623 E5m N FAYETTEVILLE ST 2000 - 2034 E5i N FAYETTEVILLE ST 1421 - 1431 E5q APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-14 of 63 ROAD NAME ADDRESS RANGE PAGE N FAYETTEVILLE ST 1900 - 1911 E5m N FAYETTEVILLE ST 1450 - 1499 E5q N FAYETTEVILLE ST 1500 - 1525 E5q N FAYETTEVILLE ST 1409 - 1419 E5q N FAYETTEVILLE ST 2284 - 2333 E5e N FAYETTEVILLE ST 2284 - 2333 E5i N FAYETTEVILLE ST 2426 - 2440 E5e N FAYETTEVILLE ST 4402 - 4509 E5e N FAYETTEVILLE ST 1433 - 1435 E5q N FAYETTEVILLE ST 1932 - 1965 E5i N FAYETTEVILLE ST 1932 - 1965 E5m N FAYETTEVILLE ST 1528 - 1561 E5m N FAYETTEVILLE ST 1528 - 1561 E5q N FAYETTEVILLE ST 2363 - 2409 E5e N FAYETTEVILLE ST 1913 - 1929 E5m N FAYETTEVILLE ST 1238 - 1249 E4t N FAYETTEVILLE ST 1238 - 1249 E5q N FAYETTEVILLE ST 2442 - 2520 E5e N FAYETTEVILLE ST 1320 - 1408 E5q N FAYETTEVILLE ST 1730 - 1747 E5m N FAYETTEVILLE ST 1700 - 1729 E5m N FAYETTEVILLE ST 2144 - 2274 E5i N FAYETTEVILLE ST 2334 - 2362 E5e N FAYETTEVILLE ST 1445 - 1448 E5q N FAYETTEVILLE ST 1625 - 1644 E5m N FAYETTEVILLE ST 1301 - 1319 E5q N FAYETTEVILLE ST 2410 - 2425 E5e N HIGH ST 100 - 139 D5i N MAIN ST 100 - 324 D4l N MCCRARY ST 300 - 771 D4g N MCCRARY ST 100 - 433 D4k N PARK DR 926 - 1024 D4g N PARK ST 329 - 400 D4h N PARK ST 100 - 400 D4l N RANDOLPH AVE 100 - 139 D5i N ROCKRIDGE RD 1041 - 1260 D4g N ROCKRIDGE RD 1167 - 1260 E4s N TREMONT DR 1526 - 1545 E4t N TREMONT DR 1547 - 1561 E4p N TREMONT DR 1547 - 1561 E4t NC HWY 42 N 300 - 633 D5i NC HWY 42 N 100 - 235 D5j NC HWY 42 S 100 - 185 D5j APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-15 of 63 ROAD NAME ADDRESS RANGE PAGE NC HWY 42 S 100 - 185 D5n NC HWY 49 S 600 - 621 D4r NC HWY 49 S 100 - 335 D4o NC HWY 49 S 200 - 335 D4s NEELY DR 1300 - 1342 E4s NEELY DR 1000 - 1243 D4g NEELY DR 1000 - 1053 E4s NEELY DR 1227 - 1243 E4s NEW CENTURY DR 700 - 960 C4g NEWBERN AVE 303 - 964 D5q NEWBERN AVE 160 - 500 D4t NEWELL ST 1732 - 1746 E5m NEWELL ST 1800 - 1835 E5m NICKI ST 400 - 500 D4s NORTH ASHEBORO SCHOOL RD 1995 - 2300 E4p NORTH ASHEBORO SCHOOL RD 1814 - 1900 E4p NORTH MEADOWS LOOP 2365 - 2379 E5e NORTH MEADOWS LOOP 2448 - 2465 E5e NORTH MEADOWS LOOP 2386 - 2443 E5e NORTH MEADOWS LOOP 2475 - 2557 E5e NORTH MEADOWS LOOP 2475 - 2557 E5f NORTH MEADOWS LOOP 2320 - 2353 E5f NORTH MEADOWS LOOP 2320 - 2353 E5i NORTH MEADOWS LOOP 2320 - 2353 E5j NORTH MEADOWS LOOP 2559 - 2584 E5f NORTH MEADOWS LOOP 2354 - 2362 E5e NORTH MEADOWS LOOP 2354 - 2362 E5i NORTHAMPTON DR 400 - 646 D4t NORTHAMPTON DR 400 - 610 D5q NORTHRIDGE DR 100 - 127 D4k NORTHSHORE DR 791 - 835 E5q NORTHSHORE DR 791 - 835 D5e NORTHSHORE DR 875 - 1000 E5q NORTHSHORE DR 836 - 874 E5q NORTHSIDE TER 1100 - 1236 E4t NORTHSIDE TER 1100 - 1236 D4h NORTHSIDE TER 1240 - 1321 E4t NORTHWOOD DR 100 - 520 E4h NORTHWOOD DR 100 - 520 E5e NOTTINGHAM ST 1590 - 1668 E4p OAK BEND DR 700 - 799 E5m OAK BEND DR 800 - 900 E5m OAK DR 1800 - 1941 D4s APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-16 of 63 ROAD NAME ADDRESS RANGE PAGE OAK LEAF RD 100 - 700 D4r OAK LEAF RD 324 - 673 D4s OAK LEAF RD 100 - 283 D4n OAKDALE ST 996 - 1138 D4p OAKHURST DR 100 - 123 D4k OAKLAND AVE 1100 - 1209 D4h OAKMONT DR 1000 - 1139 E4s OAKMONT DR 400 - 1139 D4g OAKMONT DR 1200 - 1303 E4s OAKMONT DR 1583 - 1700 E4s OCCONEECHEE AVE 800 - 918 D4k OLD CASTLE DR 649 - 695 E5f OLD CASTLE DR 749 - 828 E5f OLD CASTLE DR 500 - 635 F5q OLD CASTLE DR 601 - 635 F5r OLD CASTLE DR 601 - 635 E5f OLD CASTLE DR 701 - 741 E5f OLD CASTLE DR 636 - 648 E5f OLD CEDAR FALLS RD 1900 - 2892 D5f OLD CEDAR FALLS RD 1117 - 1141 D5i OLD COX RD 1300 - 1737 C5f OLD COX RD 1200 - 1286 C5e OLD FARMER RD 1100 - 1107 D4k OLD LIBERTY RD 800 - 823 E5m OLD LIBERTY RD 900 - 935 E5m OLD LIBERTY RD 900 - 935 E5n OLD LIBERTY RD 200 - 215 E5q OLD LIBERTY RD 310 - 329 E5m OLD LIBERTY RD 1100 - 1122 E5j OLD LIBERTY RD 420 - 429 E5m OLD LIBERTY RD 431 - 450 E5m OLD LIBERTY RD 718 - 733 E5m OLD LIBERTY RD 1123 - 1135 E5j OLD LIBERTY RD 1136 - 1206 E5j OLD LIBERTY RD 107 - 117 E5q OLD LIBERTY RD 511 - 522 E5m OLD LIBERTY RD 700 - 717 E5m OLD LIBERTY RD 1429 - 1461 E5k OLD LIBERTY RD 400 - 419 E5m OLD LIBERTY RD 523 - 616 E5m OLD LIBERTY RD 300 - 309 E5m OLD LIBERTY RD 1413 - 1427 E5j OLD LIBERTY RD 1413 - 1427 E5k APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-17 of 63 ROAD NAME ADDRESS RANGE PAGE OLD LIBERTY RD 936 - 1050 E5j OLD LIBERTY RD 936 - 1050 E5n OLD LIBERTY RD 1208 - 1355 E5j OLD LIBERTY RD 507 - 510 E5m OLD LIBERTY RD 100 - 106 E5q OLD LIBERTY RD 1409 - 1412 E5j OLD LIBERTY RD 500 - 505 E5m OLD LIBERTY RD 217 - 238 E5m OLD LIBERTY RD 217 - 238 E5q OLD LIBERTY RD 619 - 640 E5m OLD LIBERTY RD 1357 - 1408 E5j OLD NC HWY 49 900 - 1001 D4r OLDE MAIN TERRACE DR 100 - 142 D4l OLDE TOWNE PKWY 1100 - 1253 D4a ORIOLE DR 1480 - 1527 E5N PAMPASS PL 734 - 768 E5e PAMPASS PL 709 - 728 E5e PARK DR 1000 - 1327 D4g PARKSIDE DR 404 - 412 E4p PARKSIDE DR 414 - 421 E4p PARKVIEW ST 600 - 1048 D5i PATTON AVE 300 - 485 D5j PEACHTREE ST 238 - 861 D4h PEACHTREE ST 210 - 361 D4l PENNSYLVANIA AVE 1416 - 1427 E5j PENNSYLVANIA AVE 1416 - 1427 E5k PENNSYLVANIA AVE 1428 - 1444 E5k PENNSYLVANIA AVE 1320 - 1415 E5j PENNWOOD DR 600 - 629 D5e PEPPERIDGE RD 1400 - 1813 D5q PEPPERIDGE RD 1100 - 1667 D5m PEPPERTREE RDG 2524 - 2596 E5f PERRY ST 1000 - 1031 D4g PERSHING ST 200 - 323 D4l PIEDMONT ST 500 - 600 D4h PILOTS VIEW RD 2000 - 2228 C3b PINE GROVE DR 1723 - 1863 D5q PINE KNOLL CT 1700 - 1743 E5m PINE ST 1200 - 1249 D4g PINEVIEW RD 851 - 930 E4h PINEVIEW RD 736 - 850 E4h PINEVIEW ST 300 - 432 E4h PINEVIEW ST 475 - 515 E4h APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-18 of 63 ROAD NAME ADDRESS RANGE PAGE PINEVIEW ST 100 - 229 E4h PINEVIEW ST 100 - 229 E5e PLANTATION CIR 1300 - 1663 D5m PLANTATION CIR 1600 - 1719 D5q PLEASANT ST 1800 - 1817 E5m PLEASANT ST 1818 - 1837 E5m PLEASANT ST 1732 - 1747 E5m PLEASANT ST 1900 - 1909 E5m PLUMMER ST 100 - 115 D4h POLO CROWNE AVE 200 - 250 D5e POPLAR ST 300 - 415 E5m PORSCHE WAY 800 - 995 C5 PORTAGE PKWY 1819 - 1833 E5m PORTAGE PKWY 1806 - 1817 E5m POWHATAN AVE 800 - 1040 D4k QUAKER DR 300 - 430 E4h QUEENS MEADOW CT 1847 - 1876 D5q QUEENS RD 400 - 510 D4h RAGSDALE RD 200 - 428 D5j RAILROAD ST 320 - 451 D4g RAILROAD ST 200 - 451 D4k RAINBOW DR 100 - 309 E5q RAINTREE CT 750 - 832 E5f RANDALL ST 1736 - 1753 E4p RAVENWOOD DR 154 - 190 E4l RAVENWOOD DR 154 - 190 E5i RAYBURN ST 1828 - 1834 E5n RAYBURN ST 1816 - 1827 E5n RAYBURN ST 1800 - 1815 E5n REDDING RD 400 - 1045 D5i REGENCY DR 2431 - 2469 E5j REGENCY DR 2403 - 2423 E5j REGENCY DR 2162 - 2399 E5j REGENCY DR 2126 - 2154 E5j REGENCY DR 2112 - 2118 E5j REGINAS WAY 2901 - 2931 F5q RICH AVE 200 - 340 D4p RICHLAND PL 1 - 15 D5q RIDGE ST 100 - 515 D4t RIDGECREST RD 100 - 427 D5i RIDGEWOOD CIR 1300 - 1496 E5n RIDGEWOOD CIR 1300 - 1496 E5r ROBBINS ST 926 - 1055 D4o APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-19 of 63 ROAD NAME ADDRESS RANGE PAGE ROBINS NEST DR 1339 - 1700 E5n ROBINS NEST DR 1339 - 1399 E5r ROBINS NEST DR 1300 - 1338 E5r ROCK CRUSHER RD 200 - 492 D5j ROCK CRUSHER RD 500 - 606 D5f ROCK QUARRY RD 400 - 668 E4l ROCKCLIFF CT 775 - 800 D5q ROCKCLIFF TER 800 - 1018 D5q ROCKCLIFF TER 800 - 995 C5e ROCKRIDGE RD 1000 - 1132 D4g ROCKY LN 1700 - 1835 D5q ROLLING RD 1300 - 1505 D4k ROLLS LN 1740 - 1752 C5 ROSE LN 2138 - 2145 E4l ROSE LN 2146 - 2199 E4l ROSEBORO DR 200 - 329 E5m ROSS ST 200 - 385 D4l ROSS ST 400 - 543 D4h ROYCE LN 1760 - 1781 C5 S CHERRY ST 100 - 147 D4l S CHERRY ST 126 - 147 D4k S CHURCH ST 100 - 843 D4l S CHURCH ST 700 - 1141 D4p S COX ST 100 - 735 D4l S COX ST 600 - 1324 D4p S ELM ST 100 - 258 D5i S ELM ST 200 - 258 D4l S FAYETTEVILLE ST 628 - 1654 D4p S FAYETTEVILLE ST 1625 - 2650 D4t S FAYETTEVILLE ST 1 - 740 D4l S HIGH ST 100 - 323 D5i S MAIN ST 100 - 821 D4l S MAIN ST 700 - 821 D4p S MCCRARY ST 100 - 816 D4k S MCCRARY ST 600 - 816 D4o S PARK ST 700 - 1530 D4p S PARK ST 100 - 896 D4l S RANDOLPH AVE 100 - 342 D5i S TREMONT DR 1521 - 1523 E4t S TREMONT DR 1500 - 1507 E4t S TREMONT DR 1509 - 1520 E4t SADDLEWOOD CT 1814 - 1839 E4p SADDLEWOOD CT 1840 - 1859 E4p APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-20 of 63 ROAD NAME ADDRESS RANGE PAGE SALEM CT 800 - 806 D5q SANFORD ST 1000 - 1122 E5n SARINA DR 2140 - 2168 E5j SAUNDERS DR 310 - 507 E5q SAUNDERS DR 100 - 213 E5q SAUNDERS DR 300 - 308 E5q SCARBORO ST 100 - 179 D4l SCENIC DR 500 - 520 E5q SEQUOIA AVE 831 - 1029 D5m SEWELL DR 1846 - 1859 E4p SEWELL DR 1860 - 1907 E4p SEWELL DR 1832 - 1845 E4p SHADY DR 1530 - 1561 E4p SHADY DR 1530 - 1561 E4t SHAMROCK RD 600 - 1632 D5m SHAMROCK RD 100 - 841 D5i SHAMROCK RD 1615 - 1632 D5q SHANA LN 1101 - 1301 D4o SHANNON RD 100 - 625 D5i SHANNON RD 600 - 944 D5m SHARON AVE 401 - 414 E5m SHARON AVE 500 - 503 E5m SHARON AVE 326 - 328 E5m SHARON AVE 300 - 324 E5m SHARON AVE 200 - 213 E5m SHARON AVE 600 - 617 E5m SHARON AVE 505 - 516 E5m SHARON AVE 100 - 119 E5m SHEFFIELD ST 100 - 207 E5q SHEPHERDS WAY 1718 - 1769 D5q SHERWOOD AVE 508 - 1029 D4s SHERWOOD OAKS DR 300 - 390 D4s SHERWOOD RD 721 - 860 D4s SHERWOOD RD 700 - 740 D4t SILVER AVE 400 - 511 D5m SILVER AVE 200 - 429 D4l SILVER AVE 400 - 429 D4p SIMPSON AVE 100 - 117 E5m SKY DR 1600 - 1647 E4p SNOWDON CT 1024 - 1100 E5r SONNETT DR 2790 - 2900 F5q SOUTHERN DR 100 - 175 F4d SOUTHWAY RD 100 - 238 D4k APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-21 of 63 ROAD NAME ADDRESS RANGE PAGE SOUTHWAY RD 300 - 437 D4g SOUTHWAY RD 300 - 329 D4k SPENCER AVE 500 - 735 D4p SPENCER AVE 720 - 783 D4o SPINKS ST 1900 - 1925 E5m SPRING GARDEN ST 100 - 240 D4k SPRING ST 444 - 557 D5e SPRING ST 210 - 557 D5i SPRINGDALE LN 1101 - 1133 D4g SPRINGWOOD CT 2000 - 2120 D4s SPRINGWOOD RD 100 - 725 D4s SPRINGWOOD RD 100 - 725 D4t STABLE BROOK RD 2300 - 2534 C3a STABLE BROOK RD 2300 - 2379 C3b STABLE BROOK RD 2300 - 2379 C3c STABLE BROOK RD 2300 - 2379 C3d STARR CT 350 - 374 D4l STERLING ST 100 - 209 D4h STONE ARBOR DR 771 - 804 E5f STONE BRIDGE RD 2044 - 2240 C3b STONE BRIDGE RD 1900 - 2447 C3d STONEWALL CT 2584 - 2600 C3c STONEY CREEK DR 600 - 623 D5q STONEY CREEK DR 700 - 757 D5q STOWE AVE 200 - 542 D4p STOWE AVE 414 - 725 D5m STRAIGHT ST 900 - 997 D4p STRAWBERRY LN 2524 - 2558 E5f STRAWBERRY LN 2563 - 2593 E5f SUMMIT AVE 301 - 439 D4h SUMMIT AVE 200 - 359 D4l SUNNY LN 1700 - 2105 D4s SUNRISE AVE 100 - 116 E5i SUNRISE AVE 510 - 522 E5i SUNRISE AVE 500 - 509 E5i SUNRISE AVE 200 - 203 E5i SUNRISE AVE 210 - 221 E5i SUNRISE AVE 310 - 417 E5i SUNRISE AVE 204 - 209 E5i SUNRISE AVE 301 - 309 E5i SUNSET AVE 800 - 1505 D4k SUNSET AVE 100 - 845 D4l SUNSET DR 1200 - 1534 D4k APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-22 of 63 ROAD NAME ADDRESS RANGE PAGE SUNSET DR N 200 - 370 D4g SUNSET DR N 200 - 370 D4k SYKES FARM RD 504 - 615 D4t SYKES FARM RD 424 - 615 D5q SYLVAN DR 2428 - 2439 E4h SYLVAN DR 2442 - 2459 E4h TABOR CT 700 - 734 D5e TAMWORTH RD 900 - 998 D4h TAYLOR DR 2900 - 3022 F4d TAYLOR DR 2900 - 2991 E4h TEACHEY SCHOOL DR 0 - 0 D4t TELEPHONE AVE 100 - 408 D4p TERRY AVE 201 - 227 E4p THAYER DR 1200 - 1426 E4s THAYER DR 1200 - 1426 D4g THIRD ST 1300 - 1533 D4p THIRD ST 1700 - 1775 D4t THOMAS ST 700 - 751 D5i THORNSDALE DR 1526 - 1561 E4p THORNSDALE DR 1526 - 1561 E4t THORNSDALE DR 1600 - 1645 E4p TIMBAL CT 1100 - 1145 D4g TIMBERLANE 1100 - 1688 D5m TIMBERLANE 1400 - 1688 D5q TIPTON DR 600 - 675 D5e TORTOISE LN 301 - 324 F5q TOT HILL FARM RD 2900 - 3334 C3d TOT HILL FARM RD 3190 - 3463 C3c TOT HILL TRL 2700 - 2832 C3d TRACI ST 1628 - 1641 E5m TRADE ST 100 - 139 D4l TRANSFER STATION PL 600 - 630 D5e TREMONT DR 200 - 236 E4t TREMONT DR 300 - 315 E4t TREMONT DR 100 - 119 E4t TREMONT DR 100 - 119 E5q TREMONT DR 317 - 445 E4t TROGDON ST 1200 - 1232 D4g TROLLINGER RD 800 - 961 D5m TRYON ST 472 - 526 D4h TUCKER ST 600 - 735 D5e TUCKER ST 600 - 735 D5i TURNER ST 400 - 522 E5m APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-23 of 63 ROAD NAME ADDRESS RANGE PAGE TURTLE LAKE BND 2810 - 2865 F5q TWAIN DR 500 - 576 D5e UNDERWOOD ST 100 - 111 E5m UNDERWOOD ST 202 - 240 E5m UNDERWOOD ST 201 - 201 E5m US HWY 220 BUS N 4600 - 5058 F4d US HWY 220 BUS N 4600 - 4728 E4h US HWY 220 BUS N 4510 - 4550 E4h US HWY 220 BUS N 4510 - 4550 E5e US HWY 64 E 1775 - 1896 D5j US HWY 64 W 1000 - 1160 D4o UWHARRIE ST 200 - 870 D4k UWHARRIE ST 600 - 1328 D4o UWHARRIE ST 200 - 243 D4l VALLEY RD 100 - 501 E5q VANCE ST 560 - 680 D5e VERNON ST 100 - 111 E4t VERNON ST 100 - 111 E5q VESTAL CREEK CT 700 - 782 D5q VETERANS LOOP RD 541 - 631 C4g VINCENT DR 2018 - 2037 E5i VIPER LN 1200 - 1215 C5 VIRGINIA AVE 300 - 415 E5m VIRGINIA AVE 100 - 125 E5m VIRGINIA AVE 200 - 217 E5m VISION DR 100 - 550 E4t VISION DR 100 - 550 E5q VISTA PKWY 100 - 188 D5j VISTA PKWY 100 - 188 D5k W ACADEMY ST 100 - 252 D4l W ALLRED ST 124 - 129 E4t W ALLRED ST 100 - 123 E4t W ALLRED ST 100 - 123 E5q W ALLRED ST 235 - 240 E4t W BAILEY ST 114 - 217 E4p W BAILEY ST 600 - 619 E4p W BAILEY ST 100 - 112 E4p W BAILEY ST 100 - 112 E5m W BAILEY ST 500 - 534 E4p W BAILEY ST 218 - 425 E4p W BALFOUR AVE 500 - 525 E4p W BALFOUR AVE 418 - 421 E4p W BALFOUR AVE 100 - 209 E4p APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-24 of 63 ROAD NAME ADDRESS RANGE PAGE W BALFOUR AVE 100 - 209 E5m W BALFOUR AVE 300 - 417 E4p W BALFOUR AVE 210 - 219 E4p W BALFOUR AVE 527 - 607 E4p W BALFOUR AVE 220 - 231 E4p W BEASLEY ST 200 - 209 E4p W BEASLEY ST 100 - 113 E4p W BEASLEY ST 100 - 113 E5m W BEASLEY ST 300 - 312 E4p W BEASLEY ST 210 - 232 E4p W BEASLEY ST 114 - 120 E4p W BEASLEY ST 314 - 424 E4p W CENTRAL AVE 100 - 299 E4l W CENTRAL AVE 100 - 299 E5i W CENTRAL AVE 500 - 600 E4l W CENTRAL AVE 500 - 600 E4p W CENTRAL AVE 300 - 425 E4l W DIXIE DR 500 - 1199 D4o W DIXIE DR 100 - 900 D4p W KIVETT ST 100 - 745 D4l W KIVETT ST 600 - 745 D4k W MILLER ST 100 - 153 D4h W O W RD 1700 - 1748 E5j W O W RD 1749 - 1843 E5j W PRESNELL ST 100 - 800 D4h W PRITCHARD ST 100 - 151 D4h W SALISBURY ST 100 - 846 D4l W SALISBURY ST 800 - 1136 D4k W STRIDER ST 100 - 416 E5m W TAFT AVE 100 - 375 D4p W WAINMAN AVE 100 - 733 D4l W WAINMAN AVE 700 - 733 D4k W WALKER AVE 100 - 571 D4p W WARD ST 100 - 529 D4l WAKETA DR 100 - 420 F4d WALDEN RD 1000 - 1156 C5f WALNUT RIDGE RD 300 - 450 F5q WALNUT ST 2000 - 2025 E5i WALTON CT 900 - 942 D5m WARD VALLEY DR 800 - 951 E5j WASHINGTON AVE 212 - 325 D4p WATERFRONT CT 270 - 299 E5e WATERFRONT CT 245 - 269 E5e APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-25 of 63 ROAD NAME ADDRESS RANGE PAGE WATERSIDE DR 2455 - 2460 E5e WATERSIDE DR 2425 - 2454 E5e WATERSIDE DR 2400 - 2424 E5e WATERVIEW CT 500 - 533 E5e WATERVIEW CT 460 - 499 E5e WATKINS ST 300 - 455 D5i WATKINS ST 442 - 516 D5e WELLS CIR 1100 - 1125 D4p WESLEY CT 300 - 327 D4l WEST ST 100 - 300 D4k WESTBURY DR 500 - 540 D4r WESTMONT CIR 1400 - 1457 D4g WESTMONT CT 1400 - 1530 D4g WESTMONT DR 700 - 1590 D4g WESTOVER TER 1200 - 1245 E4s WESTOVER TER 1100 - 1169 E4s WESTOVER TER 1100 - 1169 D4g WESTVIEW AVE 1200 - 1328 D4g WESTWOOD DR 1200 - 1429 D4k WHIRLWIND LN 2400 - 2511 E5e WHITE OAK ST 339 - 631 D4h WHITE OAK ST 200 - 396 D4l WHITLEY ST 110 - 250 D4s WILLIAM AVE 700 - 799 D4o WILLIAM AVE 700 - 799 D4p WILLOW CREEK CT 700 - 707 D5e WILLOW RD 1900 - 1955 E5m WILLOWOOD DR 813 - 829 E5f WILLOWOOD DR 710 - 807 E5e WILLOWOOD DR 710 - 807 E5f WILLOWOOD DR 700 - 705 E5e WILLOWOOD DR 690 - 699 E5e WILLOWOOD DR 690 - 699 E5i WINDCREST RD 1750 - 1800 E5m WINDERMERE CT 800 - 861 D4p WINDOVER RD 1116 - 1135 E5j WINDOVER RD 1136 - 1152 E5j WINDOVER RD 1100 - 1115 E5j WINDOVER RD 1162 - 1178 E5j WINDSOR TRL 700 - 737 E5r WINDSOR TRL 738 - 790 E5r WINDSTONE CT 2500 - 2553 E5e WINNETKA CT 600 - 635 E5q APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-26 of 63 ROAD NAME ADDRESS RANGE PAGE WINNETKA CT 600 - 635 E5r WINSLOW AVE 1200 - 1464 D4k WINTER ST 2023 - 2039 E5i WINTER ST 2040 - 2053 E5i WOODBURY ST 100 - 129 E4t WOODBURY ST 100 - 129 E5q WOODCREST RD 100 - 131 E4t WOODCREST RD 200 - 346 E4t WOODLAND CIR 600 - 693 D5e WOODLAWN ST 400 - 441 D5i WORTH ST 100 - 344 D4l WORTH ST 300 - 1044 D5i WRENWOOD CT 260 - 275 E5e YANCEY AVE 2042 - 2101 E5i YORK ST 700 - 725 D4h YORKMONT CT 600 - 624 E5r YORKMONT CT 700 - 717 E5r YORKTOWN LN 1807 - 1824 E4p YZEX ST 102 - 215 E4l YZEX ST 102 - 215 E5i YZEX ST 216 - 305 E4l ZOO PKWY 1800 - 2504 D5q ZOO PKWY 2300 - 3207 C5e ZOO PKWY 2800 - 3010 C5e ZOO PKWY 1500 - 1822 D4t ZOO PKWY 1400 - 1647 D4p ZOO PKWY 1800 - 1822 D4t APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-27 of 63 ROAD NAME ADDRESS RANGE PAGE ARCHDALE (27263) ALDRIDGE LN 100 - 228 H3m ALDRIDGE LN 112 - 116 H2p ALDRIDGE RD 100 - 581 H2t ALISON LN 100 - 315 H3q ALLENDALE DR 6400 - 6908 H3m AMBER WAY 3700 - 3766 H3m ANNA CT 101 - 107 H3m APACHE RD 100 - 210 H2t APACHE RD 200 - 210 H3q APOLLO CIR 100 - 165 H2p ARCHDALE BLVD 500 - 538 H2m ARCHDALE BLVD 100 - 538 H2n ARCHDALE RD 3200 - 4325 H2o ARCHDALE RD 4800 - 11400 G2h ARCHDALE RD 4300 - 4630 H2s ARCHDALE RD 4602 - 4906 H2t ARCHDALE RD 3008 - 3204 H2k ARMSTRONG CT 100 - 205 H2p ASHLAND ST 100 - 640 H2p ASHWORTH CT 100 - 113 G2h ASHWORTH DR 100 - 120 G2h AUTUMN HILL CT 101 - 116 H3m AZTEC DR 400 - 505 H2t BAINBRIDGE ST 100 - 115 H2p BAKER RD 100 - 136 H2k BAKER RD 100 - 103 H2o BALFOUR DR 114 - 307 H2t BALFOUR DR 114 - 120 H2p BALFOUR DR 300 - 506 H2s BARRETT DR 4020 - 4128 H2o BARRETT DR 4097 - 4209 H2s BARWOOD TER 100 - 139 H2s BARWOOD TER 100 - 139 G2g BEARD AVE 200 - 230 H2s BEARD AVE 100 - 219 H2o BELGIAN DR 101 - 402 H3q BELGIAN DR 101 - 121 G3e BELVA CT 3100 - 3107 H2j BELVA CT 3100 - 3107 H2n BILLY AVE 101 - 114 G2h BIRCHWOOD CT 100 - 108 G2h APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-28 of 63 ROAD NAME ADDRESS RANGE PAGE BLAIR CT 100 - 228 G3e BLAIR DR 100 - 323 G2h BLAIR DR 100 - 107 G3e BLAIR DR 301 - 323 H2t BONNIE PL 100 - 199 H2o BOULDIN CT 100 - 125 H2s BOWEN DR 1206 - 1251 H1l BOWEN DR 1206 - 1251 H2i BRADFORD LN 1001 - 1405 H3m BRADFORD LN 1001 - 1035 H3q BRANDON LN 100 - 119 G2h BRANIFF PL 101 - 205 H2s BRIGHTLEAF CT 100 - 114 H3m BRITTANY WAY 100 - 1710 H2o BROOKBANK CT 100 - 125 H2s BROOKHOLLOW LN 100 - 124 H2p BROOKHOLLOW LN 100 - 212 H2t BROOKLEIGH CT 100 - 115 G2h BROOKWOOD CIR 100 - 2699 H2o BURGEMERE ST 4305 - 4411 H2t BURGEMERE ST 4305 - 4399 H2p BYRON LN 1101 - 1210 H3m BYRON LN 1001 - 1116 H3q CALLAHAN ST 1005 - 1017 H2j CALLAHAN ST 1005 - 1017 H2n CAMERON CT 4201 - 4208 G2h CARDINAL PL 100 - 116 H2m CAROLINA CT 100 - 103 H2t CARRINGTON LN 1001 - 1005 H2p CARROLL ST 3904 - 3910 H2o CEDAR XING 100 - 240 G3m CENTER POINTE CT 400 - 412 H3m CHANTERELLE DR 7203 - 7233 H3m CHELSEA SQ 1502 - 1608 H2o CHESAPEAKE LN 102 - 207 H2k CHESAPEAKE LN 102 - 1407 H2p CHEYENNE DR 3901 - 4310 H2t CIRCLE DR 200 - 332 H2m CIRCLE DR EXT 6000 - 6057 H2m CLOVERDALE CT 100 - 117 H2n CLOVERDALE DR 100 - 305 H2n CLYDESDALE DR 101 - 112 H3q COLONIAL ST 200 - 210 H2o APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-29 of 63 ROAD NAME ADDRESS RANGE PAGE COLUMBUS AVE 106 - 135 H2o COLUMBUS AVE 106 - 135 H2p COMANCHE RD 3700 - 3910 H2t CORINA CIR 3100 - 3210 H2n CORINA CIR 3100 - 3118 H2j CORPORATION DR 1204 - 1303 H2i CORPORATION DR 1200 - 1208 H2m COTTAGE CT 101 - 103 H3q COUNTRY CT 4901 - 4915 H3q COUNTRY LN 5000 - 5199 H3q COUNTRY LN 5100 - 5199 G3e COURTLAND LN 100 - 1009 H3q CRAIG DR 100 - 115 H2o CRAIG DR 100 - 115 H2s CREEKWOOD DR 5200 - 5226 G3e CRESCENT DR 300 - 417 H2p CRESCENT DR 403 - 417 H3m DALE ST 500 - 520 H2o DANIEL PAUL DR 100 - 518 H2m DAVID ST 3800 - 3914 H2o DAVIDSON ST 200 - 499 H2p DAVIDSON ST 400 - 510 H2o DEAN DR 400 - 522 H2j DEAN DR 400 - 410 H2n DEERFIELD PL 101 - 110 H3q DELLWOOD ST 200 - 309 H2p DELLWOOD ST 100 - 205 H2t DELTA CT 101 - 104 H2p DOGWOOD LN 1001 - 1218 H3m DON AVE 100 - 305 H2s DON AVE 100 - 110 H2t DORSETT ST 200 - 211 H2k DOVE MEADOWS DR 100 - 213 H3m DOVE MEADOWS DR 100 - 152 H3q DYLAN SCOTT DR 101 - 118 H2m E WHITE DR 108 - 139 H2o EASTWIND DR 101 - 199 H2p EDEN TER 306 - 1025 H2n EDEN TER 1000 - 1025 H2m EDEN TER 306 - 414 H2o EDGEWOOD CT 101 - 106 H3q ELAINE ST 105 - 216 H2s ELK HORN CT 101 - 107 H3q APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-30 of 63 ROAD NAME ADDRESS RANGE PAGE ELLIOTT ST 500 - 521 H2n EMERALD CT 100 - 112 G3m ENGLEWOOD DR 100 - 417 H2o ENGLEWOOD DR 400 - 506 H2p ENGLISH CT 100 - 1124 G2h ENGLISH FARM RD 100 - 199 H2n ERICA DR 100 - 124 H3c ESSEX SQ 1100 - 1312 H2o FORESTWOOD DR 401 - 511 H2p FOUNTAIN ST 3400 - 3412 H2o FOXBORO CT 4100 - 4199 G2h FRAZIER ST 114 - 220 H2o FREEMAN PL 100 - 299 H2o FRIENDS LN 101 - 107 H3q FRONTIER ST 600 - 699 H2s FRYE ST 5150 - 5300 G2h GAITHER CT 2202 - 2205 H2i GALLOP WAY 101 - 108 H3q GARRELL ST 3100 - 3512 H2n GARRELL ST 3100 - 3114 H2j GLENDALE DR 3500 - 3516 H2p GOODMAN ST 300 - 720 H2o GREENHAVEN DR 138 - 155 H2p GREENOAK DR 316 - 324 H2k GREENOAK DR 316 - 324 H2o GREGG ST 300 - 401 G3e GREGG ST 200 - 311 H3q HANNER CT 100 - 106 H3m HARDIN ST 5000 - 5004 G3e HARRIET ST 3700 - 3800 H2o HATTIE ST 300 - 309 H2o HAVENWOOD DR 100 - 405 H2n HAVENWOOD DR 100 - 106 H2o HAYWORTH ST 300 - 315 H2k HAYWORTH ST 300 - 315 H2o HAZEL AVE 300 - 323 H2o HAZEL AVE 300 - 323 H2p HILLCREST LN 133 - 200 H2o HILLSIDE CT 101 - 107 H3q HOPE CT 101 - 107 H3m HOPE VALLEY DR 100 - 128 H3m HUDSON ST 3700 - 3716 H2o HUFF RD 4600 - 4741 H3m APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-31 of 63 ROAD NAME ADDRESS RANGE PAGE HUFF RD 4100 - 4199 H2p INTERSTATE DR 102 - 406 H2t INTERSTATE HWY 85 1100 - 1299 H2p INTERSTATE HWY 85 1200 - 1399 H2s INTERSTATE HWY 85 1200 - 1299 H2t JACKIE AVE 100 - 108 H2t JACKIE AVE 100 - 108 G2h JACOB CT 100 - 105 H3m JEFFERSON CT 2001 - 2107 H2p JERNIGAN PL 100 - 120 H2n JULIAN AVE 100 - 405 H2o JULIAN AVE 400 - 525 H2p KAYE ST 400 - 514 H2n KAYE ST 400 - 411 H2j KERSEY DR 100 - 315 H2o KINGSFIELD CT 101 - 107 H2m KINGSFIELD FOREST DR 101 - 334 H2m KINVIEW DR 118 - 4304 H2t KIRKMAN CT 101 - 110 H2m KNOLLWOOD DR 4000 - 4509 H2p KNOLLWOOD DR 4500 - 4605 H2t KNOLLWOOD DR 4000 - 4034 H3m LAKE DR 101 - 803 H2n LAKESIDE DR 108 - 128 H2t LAKESIDE DR 108 - 128 H3q LANE DR 100 - 310 G3e LAURA AVE 230 - 241 H2o LAWRENCE DR 3200 - 3212 H2j LAWRENCE DR 3200 - 3212 H2n LEYLAND TER 1000 - 1410 G3m LIBERTY PL 102 - 516 H2o LIBERTY RD 431 - 504 H2k LIBERTY RD 100 - 475 H2o LINDA DR 100 - 262 G3e LINDA DR 100 - 260 H3q LINDSAY DR 100 - 120 H3c LINDSAY DR 100 - 120 H3q LOCKHART ST 106 - 118 H3q LONGVIEW DR 3409 - 4011 H2p LONITA ST 100 - 128 H2p LUCK DR 3600 - 3713 H2o LUNAR DR 801 - 1010 H2p LYNBROOK DR 410 - 417 H2o APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-32 of 63 ROAD NAME ADDRESS RANGE PAGE LYNBROOK DR 410 - 512 H2p LYNN DR 100 - 212 H2n MACON DR 4810 - 5009 H3q MAE MATILDA CT 101 - 106 H3c MAGNOLIA LN 101 - 308 H3q MAPLE GROVE CT 100 - 600 H2o MAPLEWOOD CT 200 - 214 G2h MARLBROOK CT 4900 - 5022 G3j MARQUISE CT 100 - 110 G3m MARSHALL ST 100 - 125 H2p MAYNARD DR 100 - 299 H2s MAYNARD DR 201 - 299 G2g MELISSA CT 5670 - 5700 H3q MEREDITH DR 100 - 318 H2n MISTY LN 100 - 103 H2o MITCHELL ST 100 - 110 H2o MOSE DR 5800 - 5932 H3q MURRAY CIR 2400 - 2425 H2m N MAIN ST 10400 - 11652 H2o N MAIN ST 10000 - 10476 H2p N MAIN ST 11600 - 11652 H2k NAOLA CT 100 - 208 H2m NAVAJO DR 301 - 408 H2t NC HWY 62 7600 - 7621 H2n NC HWY 62 7600 - 7621 H2r NORMAN AVE 100 - 215 G2g NORTHEAST DR 100 - 215 H2o NORTHVIEW PL 100 - 106 H2o OAK FOREST LN 100 - 227 G2h OAK FOREST LN 100 - 105 G2l OAK KNOLL DR 5734 - 5900 H2m OAK RIDGE DR 100 - 317 H3m OAK WAY 100 - 121 H3m OAKLEY CT 100 - 112 H3q OAKMONT CIR 101 - 809 H2p OAKSPRING LN 100 - 199 H2p OFFICE PKWY 1 - 99 H2n OLD ENGLISH FARM RD 100 - 999 H2n OLD ENGLISH FARM RD 100 - 999 H2o OLD ENGLISH FARM RD 100 - 999 H2s OLD MENDENHALL RD 5700 - 6333 H1l OLD MENDENHALL RD 5700 - 6267 H1p OLD SCHOOL RD 10 - 5542 H2s APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-33 of 63 ROAD NAME ADDRESS RANGE PAGE PARK DR 100 - 214 H3q PARKER ST 5843 - 5900 H2m PARKVIEW CT 101 - 116 H3q PAWNEE CT 100 - 105 H2t PETTY ST 100 - 116 H2o PINEBROOK DR 6100 - 6335 H3q PINECREST DR 113 - 145 H2p PLAYGROUND RD 300 - 605 H2j PLAYGROUND RD 300 - 319 H2k PLAYGROUND RD 600 - 704 H2n PLUMMER DR 100 - 215 H2o PLYMOUTH ST 3200 - 3206 H2n POWELL WAY 200 - 401 H3c POWELL WAY 400 - 620 H3q PRESTON CT 100 - 110 H3c PURVIS LN 203 - 303 H2o QUAKER LAKE DR 202 - 606 H2s QUAKERWOOD DR 100 - 116 H2n RADIANT PATH 100 - 120 G3m RAND BLVD 201 - 508 H2p RAND BLVD 100 - 232 H2t RAY AVE 100 - 108 H2s RENOLA DR 100 - 154 H2t RIDGE LNDG 100 - 217 H3m RIDGECREEK CIR 100 - 215 G3e RIVERMEADE DR 200 - 225 H2p RIVERMEADE DR 200 - 225 H2t ROBBINS CTRY RD 5800 - 6064 G2h ROBERT LN 1015 - 1020 G3e ROBIN CIR 202 - 238 H2t ROBIN CIR 202 - 238 G2h ROBIN CT 500 - 507 H2t ROBIN CT 500 - 507 G2h ROBIN LN 468 - 909 H2t ROBIN LN 468 - 1099 G2h ROBIN LN 1003 - 1099 G3e ROBY DR 4690 - 4817 H2t ROBY DR 4690 - 4817 H3q ROCKLANE DR 3502 - 3616 H2o ROCKLANE DR 3400 - 3507 H2p ROELEE ST 100 - 212 H2s ROELEE ST 100 - 125 H2t ROSEMARY ST 100 - 306 H2n APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-34 of 63 ROAD NAME ADDRESS RANGE PAGE S MAIN ST 10200 - 10608 H3q S MAIN ST 10100 - 10407 H2t S MAIN ST 10001 - 10004 H2p SAGEWOOD LN 1101 - 1410 H3q SAGEWOOD LN 1001 - 1022 H3m SALISBURY ST 3800 - 3907 H2o SCHOOL RD 100 - 403 H2s SCHOOL RD 300 - 403 H2r SEALY DR 216 - 320 H2m SEALY DR 98 - 240 H2n SEMINOLE DR 100 - 208 H2t SHADY OAK LN 2001 - 2112 H3m SHAMROCK CT 100 - 616 H2o SHEAN DR 104 - 117 H3q SHINING WAY 100 - 113 G3m SHORE ST 2400 - 2415 H2m SIMMONS CREEK CT 100 - 115 H2p SIMMONS CREEK CT 100 - 205 H3m SMITH LN 100 - 118 H2p SOLITAIRE DR 100 - 115 G3i SOLITAIRE DR 100 - 115 G3m SPRING ST 3718 - 3730 H2o SPRINGFIELD ST 100 - 113 H2o SPRINGWOOD LN 1001 - 1038 H2t SPRINGWOOD LN 1001 - 1038 G2h SPRUCEWOOD CT 102 - 108 H3q STERLING RIDGE DR 100 - 210 H2p STERLING RIDGE DR 200 - 413 H3m STRATFORD RD 200 - 337 H2k STRATFORD RD 300 - 337 H2o SUITS RD 6600 - 6772 H3c SUNNY LN 500 - 519 H2o SURRETT DR 2310 - 6026 H2m SYLVIA ST 3400 - 3410 H2o TARHEEL DR 300 - 406 H3m TARHEEL DR 100 - 325 H2t TARHEEL DR 300 - 325 H3q TERRACE TRACE CT 102 - 320 H2n TREETOP CT 100 - 117 G2h TREY LN 101 - 307 H3c TREY LN 300 - 307 H3q TRINDALE RD 100 - 406 H2o TRINDALE RD 400 - 716 H2n APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-35 of 63 ROAD NAME ADDRESS RANGE PAGE TRINDALE SCHOOL DR 0 - 0 H2s TRINITY RD 11700 - 11974 G2h TRINITY RD 12800 - 13121 H2r TRUMAN AVE 3500 - 3511 H2o UWHARRIE RD 2714 - 2720 H2i UWHARRIE RD 2718 - 5903 H2m VERTA AVE 704 - 722 H2n VILLAGE LN 5101 - 5127 H3q VILLAGE LN 5101 - 5127 G3e W WHITE DR 100 - 140 H2o WALL ST 700 - 915 H2p WALNUT GROVE RD 100 - 425 H2n WATERS EDGE DR 101 - 210 H3q WEANT RD 6320 - 7036 H3m WEANT RD 5832 - 6282 H3c WEDGEWOOD ST 132 - 229 H2o WEST BROOK CT 100 - 818 H2n WEST BROOK CT 800 - 1218 H2o WESTHAVEN LN 4300 - 6014 G2h WESTHAVEN LN 6000 - 6014 G2l WESTON WOODS CIR 100 - 303 H2s WHISPER OAK DR 4715 - 5025 G2h WILLOW TER 100 - 408 H3m WINCHESTER CT 100 - 199 G2h WOOD AVE 3700 - 4137 H3q WOOD AVE 4089 - 4137 H2t WYNNEWOOD DR 320 - 342 H2n WYNNEWOOD DR 320 - 342 H2o ZACHARY KENT DR 102 - 106 H2m APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-36 of 63 ROAD NAME ADDRESS RANGE PAGE FRANKLINVILLE (27248) ACADEMY ST 100 - 812 E6o ACADEMY ST 670 - 812 E6p ALLRED ST 100 - 295 E6o ANDREW HUNTER RD 1100 - 1477 E6o ARROW ST 4500 - 4559 E6t BAY DOE ST 4000 - 4134 E6t BUIE LN 100 - 135 E6o BUIE LN EXT 100 - 175 E6o CHURCH ST 100 - 187 E6o CHURCH ST 100 - 322 E6p CLARK AVE 100 - 3135 E6o CLARK ST 100 - 269 E6p CLARK ST 100 - 187 E6o CRAVEN ST 100 - 137 E6p DAWSON ST 3800 - 3855 E6t DEPOT ST 100 - 498 E6o DEPOT ST EXT 600 - 657 E6o DOVE VIEW ST 3600 - 3811 E6t E MAIN ST 100 - 617 E6p E MAIN ST 100 - 249 E6o EAST BEND ST 100 - 139 E6o EAST BEND ST 100 - 419 E6p FAITH ROCK RD 575 - 1154 E6o FAITH ROCK RD 575 - 611 E6s FAITH ROCK RD 575 - 611 E6t GEMSTONE CT 100 - 142 E6t GEMSTONE CT 100 - 142 D6b HOLLY ST 100 - 273 E6p HUCK ST 3900 - 3960 E6t INFINITE WAY 3800 - 3852 E6t INFINITE WAY EXT 300 - 317 E6t JULIAN RD 600 - 733 E6o LAMBE LN 200 - 222 E6p LINDLEY ST 300 - 332 E6o MATTHEWS ST 400 - 609 E6p NC HWY 22 N 1951 - 2120 E6o NORRIS ST 100 - 163 E6o OAK ST 100 - 148 E6p OGLES CREEK ST 4600 - 4682 E6t PARKS ST 300 - 442 E6p PINE ST 100 - 225 E6o APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-37 of 63 ROAD NAME ADDRESS RANGE PAGE POND CIR 200 - 276 E6o POND CIR 200 - 276 E6p QUARTZ ST 3500 - 3563 D6b QUARTZ ST 3531 - 3563 D6b RED ROCK RD 100 - 158 E6t RED ROCK RD 100 - 158 D6b RICE ST 200 - 235 E6o RICE ST 200 - 235 E6p RISING SUN WAY 355 - 555 E6p RISING SUN WAY 281 - 555 E6t ROCKIE RIVER ST 4200 - 4499 E6t ROSE ST 100 - 201 E6o SCHOOL RD 0 - 0 E6o SMITH ST 100 - 161 E6o SUMNER PL 100 - 117 E6o SUNRISE AVE 100 - 511 E6p US HWY 64 E 5500 - 5610 E6t US HWY 64 E 5611 - 6057 E7q W MAIN ST 100 - 342 E6o WALLACE ST 100 - 226 E6p WEATHERLY DR 100 - 335 E6o WEST ST 100 - 135 E6p YORK LN 300 - 398 E6p APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-38 of 63 ROAD NAME ADDRESS RANGE PAGE LIBERTY (27298) ASH AVE 407 - 605 G8n BARBER DR 305 - 327 G8k BEAVER DAM CT 300 - 547 G8o CANDLEWOOD DR 400 - 533 G8o CENTER ST 122 - 147 G8o COWARD PICKARD LN 6800 - 7001 G8k CURTIS INDUSTRIAL DR 4897 - 5000 G8a DEATON CIR 300 - 767 G8s DOGWOOD DR 400 - 531 G8o E BROOKWOOD AVE 100 - 446 G8o E BROWER AVE 110 - 226 G8o E BROWER AVE 353 - 385 G8s E BUTLER AVE 100 - 1044 G8k E DAMERON AVE 121 - 616 G8s E FRAZIER AVE 100 - 438 G8s E GRAHAM AVE 600 - 638 G8o E GRANDVIEW AVE 400 - 536 G8s E HIGH AVE 100 - 120 G8s E HIGHFILL AVE 100 - 575 G8o E LOWE AVE 100 - 353 G8s E LUTHER AVE 100 - 418 G8o E MOFFITT AVE 100 - 126 G8o E NEWBERRY AVE 100 - 143 G8o E PATTERSON AVE 500 - 630 G8s E RALEIGH AVE 100 - 621 G8o E RALEIGH AVE 600 - 621 G8s E RIDGE AVE 400 - 574 G8s E STARMOUNT AVE 300 - 460 G8o E SWANNANOA AVE 100 - 647 G8o E TEAGUE AVE 237 - 731 G8s EDGEWOOD DR 408 - 543 G8k FOREST DR 501 - 614 G8o FRANCES DR 400 - 600 G8j FRANCES DR 400 - 600 G8n GLENN SMITH DR 7000 - 7100 F8b HAMILTON DR 600 - 800 G8k HAMILTON DR 600 - 800 G8o HARDIN CT 500 - 514 G8o HIGHFILL ST 7080 - 7206 G8o HINSHAW CTRY RD 3510 - 3676 G8s KEETER CT 100 - 150 G8n APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-39 of 63 ROAD NAME ADDRESS RANGE PAGE LIBERTY PARK AVE 7230 - 7300 F8b LIBERTY PLZ 204 - 417 G8n LOGAN LN 607 - 730 G8k MAPLEWOOD CIR 500 - 566 G8s MARKET AVE 116 - 142 G8o N ASHEBORO ST 700 - 845 G8k N ASHEBORO ST 100 - 845 G8o N DEPOT ST 100 - 161 G8o N FAUST ST 100 - 230 G8o N FAYETTEVILLE ST 100 - 818 G8o N FAYETTEVILLE ST 700 - 818 G8k N FOSTER ST 100 - 652 G8n N GREENBRIAR ST 700 - 820 G8k N GREENBRIAR ST 500 - 820 G8o N GREENSBORO ST 100 - 844 G8o N GREENSBORO ST 700 - 922 G8k N KIRKMAN ST 300 - 337 G8n N MYRTLE ST 400 - 499 G8o N RANDOLPH ST 100 - 229 G8o N REECE ST 100 - 240 G8n N SMITH ST 200 - 647 G8n N STALEY ST 600 - 638 G8n N STALEY ST 500 - 544 G8n N TIMBERLEA ST 500 - 616 G8o NC HWY 49 N 5824 - 5865 G8s NC HWY 49 N 4700 - 5052 F8a OAKDALE AVE 600 - 606 G8k OLD 421 RD 3900 - 4040 G8s OLD 421 RD 5431 - 5574 G8k OLD LIBERTY RD 10000 - 10286 G8n PICKETT CIR 224 - 326 G8n PINE VALLEY CT 201 - 226 G8s PINEKNOLL ST 900 - 1026 G8k REITZEL ST 100 - 199 G8o S ALLISON ST 400 - 411 G8r S ASHEBORO ST 100 - 255 G8o S ASHEBORO ST 200 - 545 G8s S CAROLINA ST 200 - 401 G8n S CAROLINA ST 200 - 401 G8r S CARTER ST 100 - 212 G8n S CARTER ST 100 - 325 G8r S COOK ST 197 - 239 G8s S COOK ST 114 - 199 G8o APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-40 of 63 ROAD NAME ADDRESS RANGE PAGE S FAIRVIEW ST 200 - 338 G8n S FAIRVIEW ST 200 - 338 G8r S FAYETTEVILLE ST 186 - 911 G8s S FAYETTEVILLE ST 100 - 199 G8o S FOSTER ST 100 - 216 G8n S FOSTER ST 200 - 423 G8r S GARDEN ST 800 - 908 G8s S GREENSBORO ST 100 - 262 G8o S GREENSBORO ST 210 - 778 G8s S GREGG ST 150 - 190 G8o S KIRKMAN ST 100 - 1008 G8r S KIRKMAN ST 100 - 122 G8n S MARTIN ST 242 - 422 G8s S MARTIN ST 150 - 199 G8o S MURPHY ST 100 - 215 G8n S MURPHY ST 100 - 3234 G8r S NEW ST 100 - 325 G8r S NEW ST 100 - 213 G8n S SMITH ST 100 - 154 G8n S VALLEY ST 100 - 241 G8o S VALLEY ST 200 - 688 G8s SILK HOPE RD 7169 - 7197 G8s SIZEMORE AVE EXT 235 - 464 G8r W BOWMAN AVE 100 - 227 G8o W BOWMAN AVE 200 - 608 G8n W BROOKWOOD AVE 200 - 332 G8n W BROOKWOOD AVE 100 - 229 G8o W BROWER AVE 100 - 227 G8o W BROWER AVE 200 - 529 G8n W BROWER AVE 100 - 150 G8s W BROWER AVE 400 - 529 G8r W BUTLER AVE 100 - 264 G8k W BUTLER AVE 200 - 264 G8j W DAMERON AVE 400 - 812 G8r W DAMERON AVE 100 - 154 G8s W FRAZIER AVE 100 - 156 G8s W HIGHFILL AVE 100 - 199 G8o W KIME AVE 400 - 516 G8r W KIME AVE 100 - 157 G8s W LEWIS AVE 100 - 158 G8s W LUTHER AVE 200 - 334 G8n W LUTHER AVE 100 - 231 G8o W MOFFITT AVE 100 - 229 G8o APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-41 of 63 ROAD NAME ADDRESS RANGE PAGE W MOFFITT AVE 200 - 617 G8n W NEWBERRY AVE 100 - 113 G8o W PATTERSON AVE 234 - 244 G8r W PATTERSON AVE 100 - 156 G8s W RALEIGH AVE 100 - 270 G8o W RALEIGH AVE 200 - 270 G8n W SIZEMORE AVE 200 - 232 G8r W SIZEMORE AVE 200 - 232 G8s W STARMOUNT AVE 300 - 558 G8n W STARMOUNT AVE 100 - 255 G8o W SWANNANOA AVE 206 - 910 G8n W SWANNANOA AVE 134 - 267 G8o W VANCE AVE 200 - 254 G8o W VANCE AVE 200 - 254 G8n APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-42 of 63 ROAD NAME ADDRESS RANGE PAGE RAMSEUR (27316) ADMIRAL DR 300 - 305 E7q ALLREDVIEW AVE 200 - 284 E7n ARDEN CT 5045 - 5100 E7o BRADY ST EXT 158 - 202 E7r BROAD ST 366 - 377 E7n BROAD ST 366 - 377 E7r BROOKLYN AVE 2000 - 2060 E7q BROOKLYN AVE 2059 - 2078 D7e BROOKLYN AVE 1900 - 2025 E7r BROOKVIEW CIR 413 - 420 E7r BUSH ST 350 - 365 E7r CAPEL ST 2200 - 2200 E7r CARTER ST 800 - 812 E7r CHISHOLM RD 1000 - 1008 E7r CHISHOLM RD 1009 - 1020 D7a CHURCH ST 1300 - 1399 E7r COLERIDGE RD 100 - 784 E7r COLERIDGE RD 700 - 784 D7a COLUMBIA AVE 500 - 545 E7r COX ST 555 - 563 E7r CRAVEN ST 2000 - 2021 E7q CRAVEN ST 2000 - 2007 E7r CURTIS ST 370 - 393 E7r DEPOT ST 800 - 810 E7r DIXON ST 2195 - 2220 D7e DIXON ST 2203 - 2226 E7q E JONES ST 2200 - 2203 E7q E JONES ST 2200 - 2203 D7e E RIDGE ST 338 - 351 E7r ELAM AVE 300 - 337 E7r ELAM AVE 300 - 316 E7n ELIZABETH ST 142 - 200 E7q FOUSHEE RD 1250 - 5135 E7r GRACEWOOD RD 5116 - 5135 D7a GREENHILL RD 100 - 199 E7q HOLLY HILL ST 200 - 233 E7o HOLLY HILL ST 200 - 233 E7d HOLLY HILL ST 200 - 233 E7r HUNTINGWOOD RD 4581 - 4800 E7n JONES ST EXT 4411 - 4458 D7e JORDAN RD 7000 - 7281 E7n APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-43 of 63 ROAD NAME ADDRESS RANGE PAGE JORDAN RD 6513 - 7051 E7r JORDAN RD 6271 - 6526 E7q JORDAN RD 7229 - 7368 E7o KIMREY ST 400 - 435 E7r KIMREY ST 400 - 407 E7n KING RD 127 - 373 E7n KING RD 127 - 178 E7r LAMBERT TRL 4700 - 4760 E7n LEONARD PARK ST 2026 - 2038 E7q LEONARD ST 1602 - 1603 E7q LIBERTY ST 700 - 742 E7r LINEBERRY ST 1200 - 1206 E7r LINEBERRY ST 1207 - 1211 E7r MAIN ST 1501 - 1544 E7r MEADOWOOD DR 1001 - 1008 E7r MEGAN DR 2500 - 2512 D7e MISSION HTS 100 - 209 E7q MOFFITT ST 800 - 811 E7r N BRADY ST 100 - 157 E7r NC HWY 22 N 100 - 486 E7q NC HWY 22 S 785 - 878 D7a NC HWY 49 N 100 - 257 E7n NC HWY 49 N 100 - 257 E7r NEWELL ST 2106 - 2115 D7e NEWELL ST EXT 4400 - 4455 D7e OAK ST 460 - 477 E7r OLIVER ST 600 - 637 E7r PARK ST 1708 - 1715 E7q PARKSFIELD TRL 400 - 471 E7d PINEWOOD CIR 445 - 453 E7r RAMTEX DR 5168 - 5200 E7d REED CREEK CT 5024 - 5100 E7d REED CREEK CT 5024 - 5100 E7r REED CREEK RD 500 - 643 E7d RICHARDSON ST 1120 - 1134 E7r RICHARDSON ST 1120 - 1134 D7a ROUNDLEAF RD 2079 - 4575 D7e ROUNDLEAF RD 4735 - 4792 D7a S BRADY ST 100 - 120 E7r SALISBURY ST 1350 - 1374 E7r SHADY DR 539 - 556 E7r SPICEWOOD LN 100 - 196 E7n STEELE ST 1362 - 1369 E7r APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-44 of 63 ROAD NAME ADDRESS RANGE PAGE STOUT ST 1280 - 1283 E7r STUART ST 480 - 494 E7r TATE ST 570 - 577 E7r TAYLOR CT 2400 - 2406 D7e US HWY 64 E 5611 - 6270 E7q W JONES ST 2100 - 2104 D7e W RIDGE ST 1300 - 1341 E7r WALLACE ST 100 - 226 E6p WALLACE ST EXT 226 - 309 E6p WATKINS ST 1700 - 1707 E7q WEATHERLY SQ 100 - 108 E7r WEATHERLY ST 440 - 465 E7r WELBORN CIR 2047 - 2051 E7q WILLIAMS ST 1100 - 1115 E7r WILLIAMS ST 1100 - 1108 D7a WOODELL AVE 2300 - 2309 E7q WOODELL AVE 2300 - 2309 E7r WOODELL AVE 2300 - 2309 D7a WRIGHT ST 100 - 222 E7q YORK ST 489 - 504 E7r APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-45 of 63 ROAD NAME ADDRESS RANGE PAGE RANDLEMAN (27317) ACCESS RD 0 - 0 F5i AZALEA DR 1 - 110 F5f BACK ST 100 - 216 F5i BARKER ST 100 - 215 F5i BELL AVE 100 - 111 F5i BENTLEY DR 4022 - 4137 F4l BOOKER T WOMBLE RD 500 - 613 F4l BOWMAN AVE 4465 - 4620 F4l BRADSHER CT 1 - 10 F5e BRADSHER CT 1 - 10 F5f BRITTANY LN 100 - 107 F5i BROOKSHIRE RD 400 - 524 F4l BURGESS ST 100 - 109 F4h CAGLE ST 400 - 416 F4l CARLISLE AVE 100 - 116 F5e CARLISLE AVE EXT 200 - 221 F5e CENTRAL PIEDMONT CT 100 - 113 F4l CENTRAL PIEDMONT CT 100 - 113 F4p CHARTER OAKS DR 500 - 1083 F5f CHURCH ST 100 - 231 F5i CLAUDE HOLDEN DR 100 - 163 F4p COLONY CT 100 - 104 F4d COMMERCE SQ 100 - 128 F5i COMMONWEALTH RD 800 - 1580 F4g COMMONWEALTH ST 10 - 109 F5i COMMONWEALTH ST 100 - 219 F5e CRANFORD ST 100 - 111 F5i DANIELS ST 100 - 251 F5e DAVIS ST 100 - 221 F4l DEPOT ST 411 - 721 F4l DEPOT ST 100 - 435 F5i DRAKE CT 4900 - 4920 G5n E ACADEMY ST 100 - 415 F5i E BROWN ST 100 - 620 F5i E BROWN ST 500 - 620 F5j E NAOMI ST 100 - 930 F5i E NAOMI ST 850 - 1016 F5f E NAOMI ST 850 - 930 F5j E RIVER DR 100 - 139 F5e EAST ST 100 - 111 F5i EDITH RUSSELL RD 100 - 153 F4h APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-46 of 63 ROAD NAME ADDRESS RANGE PAGE EVANS TRL 100 - 115 F4l EVANS TRL 100 - 115 F4p FERGUSON ST 300 - 320 F5i FERREE ST 100 - 130 F5i FOGLEMAN LN 100 - 115 F5j FOX ST 100 - 325 F5e FOX ST 300 - 4323 F5f FOX ST 100 - 135 F5i FOXWOOD CT 200 - 209 F5f FREEMAN ST 100 - 120 F5i GALLIMORE DR 862 - 900 F5n GLENNS WAY 100 - 156 F5f GLENNS WAY 100 - 156 F5j HAMMOND ST 101 - 211 F5e HAMMOND ST 200 - 211 F5f HANCOCK ST 100 - 119 F5e HANCOCK ST 100 - 119 F5i HAZEL HULL LN 100 - 108 F4d HERITAGE DR 100 - 316 F4d HERITAGE DR 300 - 411 F5q HIGH POINT ST 404 - 1099 F4h HIGH POINT ST 950 - 1099 F4l HIGH POINT ST 100 - 435 F5e HILLCREST DR 400 - 516 F5i HILLIARY ST 100 - 111 F5i HINSHAW ST 400 - 521 F5i HOLDER ST 200 - 250 F4h HOLDER ST 100 - 220 F4l HOMEPLACE DR 100 - 199 F4d HOMEPLACE DR 100 - 233 F5q HONEYCUTT ST 100 - 121 F5i HWY 311 EXT 100 - 231 F4p INTERSTATE HWY 73 1200 - 1599 F4h INTERSTATE HWY 73 1500 - 1599 F4l ISLAND FORD RD 4557 - 4868 F4g ISLAND FORD RD 4557 - 4793 F4k JESS FERREE CT 100 - 108 F4l LAMPLIGHT DR 3400 - 3529 F5i LAMPLIGHT DR 3400 - 3529 F5m LAURA CT 100 - 105 F5e LEE ST 400 - 407 F4l LEE ST 400 - 407 F5i LOU MYERS LN 3833 - 3900 F5f APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-47 of 63 ROAD NAME ADDRESS RANGE PAGE MAGNOLIA DR 100 - 111 F5e MAGNOLIA DR 100 - 111 F5f MAJESTIC OAK DR 4153 - 4297 F5f MALLARD DR 400 - 737 G5n MANDARIN CT 4900 - 4946 G5n MANESS DR 100 - 113 F5f MARTHA CT 100 - 111 F5i MCCOLLUM ST 100 - 467 F5m MCCOLLUM ST 300 - 467 F4p MILL ST 100 - 208 F5i MIMOSA CT 2900 - 2975 F5q MOORE AVE 100 - 115 F5f MOORE AVE 100 - 199 F5j MORGAN ST 100 - 121 F5i MORNINGSIDE RD 111 - 230 F4d MOUNTAIN AVE 100 - 247 F4h N COBLE ST 100 - 131 F5e N MAIN ST 400 - 1129 F5e N MAIN ST 100 - 338 F5i N STOUT ST 217 - 302 F5e N STOUT ST 100 - 234 F4l N STOUT ST 217 - 234 F5i NEAL ST 100 - 125 F5i NORTH PIN OAK DR 4200 - 4282 F5f NORTHWOODS CT 600 - 606 G5r OAK LEAF PL 4200 - 4231 F5f OAK LN 100 - 212 F5e OLD HIGH POINT ST 4561 - 4701 F4k OLIVER ST 100 - 169 F5i PARK ST 401 - 421 F5i PARRISH DR 1 - 4 F4h PARRISH DR 1 - 4 F4l PENNY ST 100 - 116 F5i PINNACLE DR 400 - 414 G5c PINNACLE DR 400 - 420 F5e PINNACLE DR 415 - 420 F5f PINTAIL CT 4887 - 4900 G5n POINTE SOUTH DR 101 - 599 F4p POINTE SOUTH DR 300 - 599 F4l POPLAR ST 100 - 255 F5i POPLAR ST 214 - 255 F5e PRESNELL ST 101 - 305 F5i PRESNELL ST 300 - 305 F5i APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-48 of 63 ROAD NAME ADDRESS RANGE PAGE RAILROAD AVE 200 - 699 F5i RAILROAD AVE 600 - 699 F5m RANDLEMAN LAKE RD 4400 - 4876 F5e RANDOLPH ST 100 - 250 F5i RANDOLPH ST 230 - 250 F5e RED OAK CT 4179 - 4200 F5f RED OAK DR 4200 - 4264 F5f REDBUD LN 100 - 111 F5e REDBUD LN 100 - 111 F5f REECE AVE 100 - 308 F4l REECE CT 100 - 120 F4l REYNOLDS RD 100 - 210 F4h RICHARDSON RD 100 - 183 F5e RIVER PARK RD 100 - 112 F5n RIVER PARK RD EXT 200 - 213 F5n RIVER WALK DR 1 - 146 F5i RIVER POINTE DR 1 - 6 F4h RIVERS BEND DR 100 - 114 F5j ROCK ST 325 - 416 F4l RUSSELL WALKER AVE 100 - 218 F5n S COBLE ST 100 - 130 F5i S MAIN ST 100 - 707 F5i S MAIN ST 1200 - 1485 F4d S MAIN ST 1100 - 1299 F4p S MAIN ST 700 - 725 F5m S STOUT ST 100 - 424 F4l SALEM CT 100 - 107 F4d SHARON LN 201 - 213 F5i SHAW ST 100 - 414 F5e SIBBETT ST 100 - 125 F5i SILVER FOX LN 100 - 106 F5f SMITH AVE 100 - 113 F5i SOUTH PIN OAK DR 4153 - 4200 F5f SPENCER ST 100 - 221 F5i SPRING VALLEY DR 100 - 125 F5i STEVENSON ST 100 - 221 F4l STOUT RD 500 - 618 F4l STOUT RD 670 - 1015 F4p SUNRISE CIR 100 - 125 F5e SUNSET DR 100 - 429 F5i SUNSET DR 400 - 615 F4l SWAIM ST 100 - 421 F5i TABERNACLE ST 100 - 150 F5i APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-49 of 63 ROAD NAME ADDRESS RANGE PAGE TEAL CT 4872 - 4900 G5n THIRD ST 100 - 120 F5i TIGERS DEN RD 4300 - 4524 F4h TIMKEN PL 3500 - 3605 F4p TROLLINGER ST 100 - 215 F5e TROLLINGER ST 316 - 329 G5r TROLLINGER ST 200 - 329 F5f UPTON ST 200 - 240 F5i VARNER ST 100 - 121 F5i VICTORIAN CT 100 - 114 F5q VILLAGE AVE 100 - 211 F5n W ACADEMY ST 100 - 320 F5i W ACADEMY ST 604 - 900 F4h W ACADEMY ST 300 - 694 F4l W BROWN ST 100 - 126 F5i W NAOMI ST 200 - 225 F5i W NAOMI ST 100 - 110 F5i W O W RD 2939 - 3240 F5n W RIVER DR 100 - 153 F5e WATER OAK CT 4200 - 4220 F5f WEAVER ST 100 - 205 F5e WESLEYAN RD 3200 - 3490 F4d WESLEYAN RD 3200 - 3490 F4p WHITE OAK DR 4200 - 4288 F5f WHITE ST 100 - 125 F5i WINDSOR PLACE CIR 100 - 343 F5m WOODS DR 500 - 519 G5r WOODS DR 511 - 519 F5f WORTH ST 400 - 519 F5i WORTHVILLE RD 1200 - 1544 F5n WORTHVILLE ST 100 - 799 F5i WORTHVILLE ST 700 - 799 F5m APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-50 of 63 ROAD NAME ADDRESS RANGE PAGE SEAGROVE (27341) AUMAN ST 100 - 250 A5j BOONE ST 100 - 218 A5k BOROUGH AVE 100 - 162 A5f BOYD DR 100 - 280 A5k E KING AVE 101 - 287 A5j E MAIN ST 100 - 435 A5j E MAIN ST 400 - 828 A5k EAST AVE 100 - 280 A5j FERNANDEZ LOOP 300 - 379 A5k GARNER ST 100 - 222 A5f GLENN ST 100 - 127 A5k GREEN ST 100 - 235 A5j HILL ST 100 - 197 A5j HILL ST 100 - 197 A5k HOYT DR 300 - 518 A5j HOYT DR 300 - 518 A5k LUCK DR 400 - 456 A5k N BROAD ST 400 - 671 A5f N BROAD ST 100 - 491 A5j NORTH ST 100 - 143 A5j OLD PLANK RD 500 - 731 A5f OLD PLANK RD 100 - 671 A5j OLD PLANK RD 100 - 136 A5k PARK ST 100 - 198 A5j RIDGE RD 200 - 5918 A5k RIDGE RD 100 - 238 A5j S BROAD ST 100 - 384 A5j SEAGROVE PARK VIEW DR 200 - 329 A5f SOUTH ST 100 - 433 A5j US HWY 220 S 8685 - 8780 A5j W E HUNT RD 5900 - 6120 A5 W KING AVE 100 - 151 A5j W MAIN ST 100 - 419 A5j WALKER ST 400 - 540 A5f WALKER ST 400 - 540 A5j WAYMON ST 100 - 346 A5j WESTWOOD DR 200 - 219 A5j WRIGHT ST 100 - 342 A5j YOW DR 100 - 392 A5j APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-51 of 63 ROAD NAME ADDRESS RANGE PAGE STALEY (27355) ASHEBORO ST 200 - 306 F8t CHURCH ST 200 - 254 F8t COLUMBIA ST 200 - 510 F8t COOPER ST 500 - 601 F8t DOE RUN TRL 7500 - 7867 F8p E FRANKLINVILLE ST 100 - 489 F8p EDWARDS ST 100 - 209 F8t ENTERPRISE ST 200 - 326 F8t FOUSHEE ST 100 - 334 F8p FOUSHEE ST 300 - 681 F8t GRAHAM ST 100 - 183 F8p GRAY FOX LN 2400 - 2537 F8p HILLSBORO ST 200 - 245 F8p KIVETT ST 300 - 434 F8t LITTLE RD 6100 - 6152 F8o LITTLE RD 6100 - 6152 F8p N MAIN ST 226 - 536 F8o N MAIN ST 100 - 426 F8p N MAIN ST 100 - 225 F8t N STALEY ST 100 - 510 F8p OLD 421 RD 2400 - 2729 F8p OLD STALEY RD 7400 - 7778 F8t OXFORD DR 2100 - 2232 F8p PARK ST 200 - 365 F8t PITTSBORO ST 98 - 400 F8t PITTSBORO ST 300 - 400 F8p S MAIN ST 100 - 768 F8t S STALEY ST 100 - 669 F8t S STALEY ST 100 - 150 F8p SCHOOL ST 400 - 548 F8t SHAW ST 100 - 159 F8p SHAW ST 100 - 159 F8t STALEY COVE DR 2300 - 2438 F8o STALEY COVE TRL 7300 - 7366 F8o THRU ROAD 0 - 0 F8t W FRANKLINVILLE ST 300 - 390 F8o W FRANKLINVILLE ST 100 - 390 F8p W FRANKLINVILLE ST 300 - 390 F8s W FRANKLINVILLE ST 100 - 296 F8t W RAILROAD ST 200 - 651 F8t WARD RD 2 - 1100 F8t APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-52 of 63 ROAD NAME ADDRESS RANGE PAGE WARREN ST 100 - 207 F8p WARREN ST 100 - 207 F8t APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-53 of 63 ROAD NAME ADDRESS RANGE PAGE HIGH POINT (27260/27263) BELMAR ST 1700 - 1820 H1l BERKLEY ST 410 - 414 H1k BETHEL DR 2000 - 2020 H1o BETHEL DR 1700 - 1770 H1l BOLES AVE 3600 - 3687 H1k CORPORATION DR 1100 - 1203 H2m EDEN TER 1000 - 1025 H2m GABLE ST 1569 - 1599 H1l OLD THOMASVILLE RD 1076 - 1127 H1k PROSPECT ST 1585 - 1749 H1l SHORE ST 2219 - 2231 H2i SHORE ST 2219 - 2415 H2m SOUTH RD 201 - 239 H1k SOUTHWEST ST 690 - 699 H1k SURRETT DR 2221 - 2227 H2i SURRETT DR 2221 - 2321 H2m TOWER AVE 1701 - 1805 H1k TOWER AVE 1701 - 1805 H1l UWHARRIE RD 2714 - 2717 H2i APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-54 of 63 ROAD NAME ADDRESS RANGE PAGE THOMASVILLE (27360) BRECKENRIDGE DR 1 - 110 G1f BRECKENRIDGE DR 100 - 120 G1g CHARTER PL 5 - 11 G1f E SUNRISE AVE 1300 - 1378 G1f E SUNRISE AVE 1410 - 1482 G1g E SUNRISE AVE 1379 - 1482 G1k E SUNRISE AVE 1351 - 1409 G1j FLORIDA DR 100 - 220 G1f FLORIDA DR 200 - 220 G1g FREEMONT CT 1 - 16 G1g FREEMONT DR 192 - 209 G1f FREEMONT DR 200 - 425 G1g KENTUCKY LN 1 - 4 G1f MARYLAND DR 101 - 205 G1f MARYLAND DR 113 - 205 G1g MARYLAND DR 101 - 112 G1j MONTANA DR 4300 - 4350 G1k NEW YORK DR 100 - 217 G1f SIGNET CT 1 - 99 G1f TURNPIKE RD 8123 - 8234 G1f UNITY ST 6543 - 6698 G1f UNITY ST 6531 - 6590 G1g WEXFORD CIR 1 - 19 G1f WEXFORD CIR 20 - 40 G1g APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-55 of 63 ROAD NAME ADDRESS RANGE PAGE TRINITY (27370) ALBERTSON FARM RD 5204 - 5500 G2j ALBERTSON VIEW ST 5400 - 5437 G2f ALFORD ST 4687 - 4800 G2g ALPINE DR 4752 - 4800 G2f ALPINE DR 4657 - 4800 G2j ANNE ST 6100 - 6160 H2q ARDEN RD 6900 - 7054 G1k ASCOT DR 3464 - 3600 G1o AZALEA LN 3800 - 3873 G1p BARBARA LN 3400 - 3469 G1t BARKLEY ST 4569 - 4600 G2k BELLAWOOD DR 6424 - 6918 G1k BELLAWOOD DR 6516 - 6715 G1l BELMONT DR 7100 - 7284 G1o BELMONT DR 7200 - 7358 G1n BELMONT DR 7200 - 7284 G1o BILLY LEE RD 4606 - 4700 G2j BILLY LEE RD 4606 - 4700 G2k BLAIR FARM RD 5187 - 5300 H1s BLUEBERRY CT 5500 - 5541 H2r BORDEAUX DR 4200 - 4279 G1l BORDEAUX DR 4223 - 4279 G1k BRAXTON CRAVEN RD 5300 - 5646 H2r BRIANNA PL 5100 - 5136 H2r BRIARCLIFF RD 4200 - 4379 G1k BRIDLEWOOD DR 6900 - 7247 G1o BROKAW DR 5354 - 5500 G2c BROOK CIR 5000 - 5188 G1h BROOK CIR 5100 - 5253 H1t BROOK CIR 5200 - 5253 H2q BROOK CIR EXT 6090 - 6200 G1h BROOK CIR EXT 6090 - 6200 G2e BROOK ST 6200 - 6283 H1t BROOKDALE DR 4911 - 5100 G2f BROWN ST 4933 - 5000 G2f CAIN CT 5100 - 5140 G2f CALVERT ST 4484 - 4563 G2k CAMERON CT 3766 - 3800 G1o CANTER DR 3500 - 3956 G1n CARRIAGE HOUSE CIR 3900 - 4058 G1p CARRIAGE PL 3566 - 3600 G1o APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-56 of 63 ROAD NAME ADDRESS RANGE PAGE CARRINGTON CT 5400 - 5513 H2r CEDAR HILL CT 6200 - 6210 G1h CEDAR POST ST 5600 - 5796 H1p CEDARBERRY RD 6500 - 6646 G1h CEDARBERRY RD 6500 - 6550 G1l CEDARDALE ST 4900 - 4970 G2g CHAPSWORTH DR 6965 - 7367 G1o CHATEAU DR 4200 - 4220 G1k CIRCLE CT 3400 - 3671 G1p CIRCLE CT 3400 - 3507 G1t CIRCLE DR 200 - 334 H2m CIRCLE DR EXT 6000 - 6057 H2m CITATION DR 7300 - 7358 G1n COLD BROOK CT 4400 - 4454 G2i COLD BROOK CT 4400 - 4454 G2j COLLETT FARM RD 4500 - 4708 G1h COLLETT FARM RD 4500 - 4614 G1l COLLETTE ST 5300 - 5355 H2r COLLINS ST 4887 - 5020 G2f COLONIAL CIR 4545 - 4911 G1h COLONIAL CIR 4500 - 4959 G1l COLONIAL CLUB DR 6700 - 7514 G1g COLONIAL CLUB DR 6600 - 6879 G1h COLONIAL CLUB DR 6600 - 6625 G1l COLONIAL MANOR DR 4494 - 4600 G1g COLORADO BLVD 4033 - 7099 G1j COLORADO BLVD 7069 - 7168 G1k COLTRANE ST 4500 - 4993 G2j COLTRANE ST 4600 - 4993 G2e COLTRANE ST 4600 - 4993 G2i COTTON RD 5330 - 5400 H2s COTTON RD 5330 - 5400 G2g COUNTRY DREAM LN 5500 - 5585 H2q COUNTRY MEADOWS LN 6797 - 6900 G1o COUNTY LINE RD 4100 - 4330 G1j COURTNEY LN 7100 - 7204 G1j COURTNEY LN 7100 - 7204 G1k CRESENT AVE 3800 - 4087 G1p CRESENT AVE 4000 - 4087 G1l CROTTS DR 5029 - 5100 H1s CUMBY RD 5141 - 5300 G2g DANIELS CIR 5800 - 5848 H2q DARR RD 4978 - 5300 G2g APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-57 of 63 ROAD NAME ADDRESS RANGE PAGE DARR RD 5258 - 5400 H2s DARR RD EXT 4715 - 4900 G2g DAWN ACRES DR 6800 - 6854 G1o DAWNWOOD DR 4100 - 4311 G1l DEATON RD 4647 - 4963 G2l DEATON RD 4600 - 4865 G2k DEERWOOD LN 4569 - 4800 G2l DERBY WAY 6341 - 6500 G1o DOGWOOD HEIGHTS LN 4884 - 5000 G2f DUSTY ROCK DR 3300 - 3333 G1s DWIGHT ST 5900 - 5958 G2e E SUNRISE AVE 1410 - 1482 G1g EDGEWOOD DR 6200 - 6244 G1l ELLEN AVE 5000 - 5284 H1t ELLEN AVE 5000 - 5081 G1h ELMWOOD ST 4800 - 5198 G2f ENGLISH PRIDE DR 7000 - 7234 G1n ENGLISH PRIDE DR 7000 - 7174 G1o ERIK DR 6600 - 6947 G1p EVELYN DR 3709 - 4000 G2c EVELYN VIEW DR 5600 - 5671 H2m EVELYN VIEW DR 5600 - 5671 H2q EVERGREEN DR 3725 - 4127 G1p EVERGREEN DR 3500 - 4127 G1t EWINGS ST 5383 - 5500 H2r FAIRVIEW CHURCH RD 5752 - 6722 G2k FAIRVIEW CHURCH RD 6500 - 6934 G2g FAIRVIEW CHURCH RD 5400 - 5910 G2d FAIRVIEW CT 4900 - 5016 G2k FAIRVIEW DR 4600 - 4773 G2k FAIRVIEW DR EXT 4900 - 5015 G2k FAIRVIEW LN 4500 - 4724 G2k FAIRWOOD DR 4100 - 4302 G1l FALCON WAY 7109 - 7200 G1o FARLOW ST 5100 - 5241 H1t FINCH FARM RD 5400 - 5940 G1k FINCH FARM RD 4580 - 5546 G1o FINCH FARM RD 4580 - 5016 G1p FINCH FARM RD 4500 - 5016 G1t FIRST HEIGHTS DR 6600 - 6641 H1s FOREST MANOR DR 4100 - 4367 G1l FOX CHASE DR 7300 - 7516 G1n FOX CHASE DR 7300 - 7454 G1o APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-58 of 63 ROAD NAME ADDRESS RANGE PAGE FOX MEADOW RD 3800 - 3886 G1p GADDY DR 3400 - 3543 G1t GLENNVILLE DR 5492 - 5600 G2j GRA LAN DR 6900 - 7046 G1k GREEN ACRES DR 5721 - 5800 H2m GREEN VALLEY DR 4400 - 4484 G1h GREENWAY DR 3800 - 3888 G1p GREY OAKS RD 5300 - 5399 H2s GROVE ST 5156 - 5276 G2g HAYWOOD RD 5409 - 5500 H2r HEATHWOOD DR 6300 - 6549 G1l HEATHWOOD DR 6200 - 6337 G2i HILLTOP AVE 5100 - 5200 G2f HOPEWELL CHURCH RD 4000 - 4859 G2c HOPEWELL CHURCH RD 4500 - 5522 G2i HOPEWELL CHURCH RD 5400 - 5774 G2e HOWARD CIR 5800 - 6004 H2q HUNTERS CLUB DR 7014 - 7200 G1o HUNTS KNOLL LN 5327 - 5400 H1t INTERSTATE HWY 85 1400 - 1499 H2r INTERSTATE HWY 85 1350 - 1499 H2s INTERSTATE HWY 85 1400 - 1599 G2f INTERSTATE HWY 85 1500 - 1799 G2e INTERSTATE HWY 85 1800 - 1899 G1j INTERSTATE HWY 85 1600 - 1899 G1k INTERSTATE HWY 85 1800 - 1899 G1n INTERSTATE HWY 85 1600 - 1799 G1l INTERSTATE HWY 85 1600 - 1799 G2i IRWIN ST 4511 - 4600 G1h IRWIN ST 4511 - 4600 G1l JAMES AVE 5228 - 5345 G2f JAY MAC CT 4861 - 4900 G1g JENNIFER CT 5100 - 5516 H1s JENNIFER CT 5200 - 5516 H1t JERRY ST 4310 - 4600 G1l JERRY ST 4480 - 4600 G1h JESSICA DR 5100 - 5324 H1s JOAN DR 5700 - 5861 H2m JOE HOFFMAN DR 6105 - 6200 G1h JOHN DR 5238 - 5300 G2f JORDAN ST 4400 - 4573 G1l KELLO RD 6005 - 6100 H2q KENNEDY CT 4000 - 4113 G2c APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-59 of 63 ROAD NAME ADDRESS RANGE PAGE KENNEDY RD 6000 - 6158 G2c KIMBERLY LN 5242 - 5589 H2r KIMBERLY LN 5100 - 5589 G2f KINGSTON CT 4300 - 4444 G1k KINGSTON RD 6900 - 7281 G1k KINGSTON RD 7200 - 7346 G1j LAKE DARR RD 4878 - 5100 G2g LAKEVIEW CT 4500 - 4548 G1g LAKEWOOD CIR 3900 - 4361 G1p LAKEWOOD CIR 4300 - 4361 G1l LAKEWOOD CT 6600 - 6650 G1p LAKEWOOD CT EXT 4000 - 4126 G1p LAKEWOOD CT EXT 4100 - 4126 G1l LAND DALE DR 5800 - 5848 H2m LANSDOWNE PL 7300 - 7419 G1j LANSDOWNE PL 7100 - 7365 G1k LANVALE AVE 4900 - 5183 G2k LAWSON DR 3842 - 3900 G2c LEACH ST 5400 - 5435 H2r LEESVILLE ST 5500 - 5581 G2c LIBBY RD 5000 - 5141 H2s LIBERTY CHURCH DR 5513 - 5600 G2c LINK CT 4763 - 4800 G2j LINK RD 5152 - 5300 G2j LINK RD 5152 - 5200 G2k LOIS LN 6005 - 6100 H2q LONGVIEW AVE 6400 - 6466 G1p LOWERYWOOD CIR 6070 - 6300 G1l LOWERYWOOD CIR 6070 - 6200 G2i MAPLE OAK DR 4749 - 4796 G1h MCWAY CT 4844 - 4900 G1g MEADOW CT 3537 - 3600 G1p MEADOW CT 3537 - 3600 G1t MEADOW DR 6500 - 6654 G1p MEADOWBROOK DR 5000 - 6215 G2f MEADOWBROOK DR 3400 - 4585 G2c MEADOWBROOK DR 4360 - 5101 G2j MEADOWBROOK DR 6100 - 6215 H2r MEADOWBROOK VIEW RD 4200 - 4431 G1k MEADOWOOD CT 4400 - 4423 G2j MENDENHALL RD 6574 - 7163 H1p MENDENHALL RD 5700 - 6268 H2q MENDENHALL RD 6100 - 6734 H1t APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-60 of 63 ROAD NAME ADDRESS RANGE PAGE MENDENHALL RD EXT 5500 - 5985 H2r MENDENHALL RD EXT 5800 - 5985 H2q MERLE DR 5500 - 5686 G2f MEYERS ST 5000 - 5133 H1t MEYERS ST 5000 - 5054 G1h MIDDLE POINT RD 6500 - 6685 H1o MIDDLE POINT RD 6500 - 6685 H1p MONTANA DR 4200 - 4235 G1j MONTANA DR 4200 - 4350 G1k MORGAN ST 5500 - 5689 G2f MORRIS RD 3600 - 4021 G2c NC HWY 62 5500 - 6007 G1h NC HWY 62 5700 - 6709 G2e NC HWY 62 4951 - 5620 G1l NC HWY 62 4106 - 5040 G1k NC HWY 62 7600 - 7621 H2n NC HWY 62 6600 - 7621 H2r NC HWY 62 4100 - 4214 G1j NC HWY 62 6600 - 6709 G2f NOLA ST 5300 - 5345 G2j NOLA ST EXT 4700 - 4766 G2j NUGGETT CT 4853 - 4900 G1g OAK CT 6575 - 6600 G1l OAK HAVEN CT 4200 - 4215 G1l OAK HAVEN DR 4100 - 4326 G1l OAK KNOLL CT 6600 - 6720 G1g OAK KNOLL CT 6600 - 6640 G1h OAKWOOD DR 4687 - 4800 G2f OAKWOOD DR 4472 - 4800 G2j OLD HOPEWELL CHURCH RD 4600 - 4751 G2e OLD HOPEWELL CHURCH RD 4600 - 4698 G2i OLD MEADOWBROOK RD 5229 - 5300 H2r OLD MENDENHALL RD 5600 - 6267 H1p OLD SCHOOL RD 5400 - 5578 H2s OLD TURNPIKE RD 4800 - 4999 G2e ONEAL FARM RD 5000 - 5238 G2k OSBORN ST 5146 - 5300 G2f PARKER ST 5774 - 5900 H2m PAYNE ST 5136 - 5200 G2e PEACOCK LN 4486 - 4700 G2k PEACOCK LN 4486 - 4700 G2l PIKE ST 4771 - 4900 G1h PIKE ST EXT 4644 - 4700 G1h APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-61 of 63 ROAD NAME ADDRESS RANGE PAGE PIKE VIEW DR 6673 - 7100 G1g PROSPECT CHURCH RD 6900 - 6988 H1s PROSPECT CT 5400 - 5962 H1o PROSPECT ST 5000 - 5615 H1s QUARTER HORSE DR 6800 - 7047 G1o QUAIL WAY 4058 - 4100 G1k RAMPEY ST 5300 - 5368 H2r REAVIS ST 5100 - 5202 G2f REAVIS ST 5100 - 5202 G2g RED FOX RD 3660 - 4100 G1p RED FOX RD 3893 - 4100 G1l REDDICK ST 5000 - 5076 H1t REDDICK ST 5000 - 5076 G1h REDDICK VIEW ST 5276 - 5300 G2f REGALWOOD CT 6900 - 7067 G1k REGALWOOD DR 4100 - 4143 G1k REGINA ST 4449 - 4500 G1h REGINA ST 4449 - 4500 G1l RIDGE DR 5200 - 5373 H2r RIDGE DR 5200 - 5252 G2f ROBIN WAY 5400 - 5511 H2r ROCK DAM CT 3800 - 3879 G1p ROCKFORD DR 5500 - 5877 H2n ROCKFORD DR 5500 - 5877 H2r ROCKFORD DR EXT 5400 - 5453 H2n ROCKLEDGE LN 4300 - 4372 G1k ROLLING RD 4661 - 4704 G2g ROLLING RD 4661 - 4800 G2k RONNIEDALE RD 4900 - 5331 G2g RONNIEDALE RD 5300 - 5767 G2f RONNIEDALE RD 4900 - 5058 G2k ROSEDALE ST 5200 - 5289 H2r ROSELEE DR 4759 - 4900 G2g ROSELEE DR 4512 - 4900 G2k ROSEWOOD DR 6700 - 6759 G1l ROYAL PINES DR 100 - 105 G1m SABINE ST 5700 - 5775 G2e SADDLE BROOK DR 3497 - 3840 G1o SADDLE CLUB DR 6900 - 6970 G1o SCHOOL RD 300 - 403 H2r SEALY DR 98 - 215 H2n SECOND HEIGHTS DR 6600 - 6645 H1s SHADYDALE ACRES LN 3900 - 4038 G1o APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-62 of 63 ROAD NAME ADDRESS RANGE PAGE SHADYDALE ACRES LN 3944 - 4038 G1k SHANNON DR 3962 - 4100 G2c SHERRIE DR 5318 - 5400 H1t SHERWOOD FOREST DR 3900 - 4145 G1o SHERWOOD FOREST DR 4000 - 4145 G1k SHERWOOD FOREST DR EXT 6876 - 6900 G1o SHIRLEY JEAN DR 5000 - 5194 G2d SILER ST 5500 - 5647 H2r SINK FARM RD 6739 - 7100 G1g SISTERS LN 5192 - 5400 H2q SPIVEY LN 4800 - 4941 G2g STEEPLEGATE DR 3600 - 4040 G1o STIRRUP CT 7500 - 7550 G1n STONE GABLES DR 6794 - 7049 G1k STONE RIDGE DR 4324 - 4500 G2j STONE RIDGE DR 4324 - 4400 G2i SUMMER SHADE DR 4438 - 4500 G1l SUMMERVILLE DR 5000 - 5192 G2k SUMMERVILLE DR EXT 5204 - 5498 G2k SUNSET VIEW DR 6000 - 6151 H1p SUNSET VIEW DR 6000 - 6151 H2m SUNSET VIEW DR EXT 6200 - 6270 H1p SURRETT DR 5800 - 6026 H2m SURRETT DR 5400 - 5956 H2q SURRETT DR 4800 - 5336 G2e TANNER CT 7200 - 7276 G1o TEXAS BLVD 6954 - 7145 G1j TEXAS BLVD 7100 - 7145 G1k TONY DR 4800 - 5025 G2f TRAVELER DR 3746 - 3800 G1k TRAVELER DR 3746 - 3800 G1o TRINDALE RD 607 - 716 H2n TRINITY BLVD 4873 - 5400 G2f TRINITY COLLEGE RD 5500 - 5540 H2r TRINITY CT 5000 - 5038 G1h TRINITY HIGH SCHOOL DR 5500 - 5863 H2q TRINITY HIGH SCHOOL DR 5500 - 5863 H2r TRINITY RD 12042 - 12779 H2s TRINITY RD 12700 - 13121 H2r TRINITY RD 11766 - 12041 G2g TRINITY RD 11766 - 11974 G2h TROTTERS RUN 7200 - 7369 G1o TROTTERS RUN 7300 - 7459 G1n APPENDIX B: CITY STREET INDEX Revised: 5/25/2022 Appendix B-63 of 63 ROAD NAME ADDRESS RANGE PAGE TURNPIKE CT 4622 - 4900 G1g TURNPIKE CT 4863 - 4900 H1s TURNPIKE RD 7300 - 8234 H1s TURNPIKE RD 7021 - 7406 H1t TURNPIKE RD 6306 - 7299 G1h TURNPIKE RD 6306 - 6568 G2e TURNPIKE RD 8123 - 8234 G1f TURNPIKE RD 8123 - 8234 G1g TWINWOOD CT 6300 - 6341 G1l TWINWOOD DR 4300 - 4428 G1l UNITY ST 6213 - 6542 G1g UNITY ST 6000 - 6368 G1k UWHARRIE RD 5400 - 5734 H2q UWHARRIE RD 5545 - 5903 H2m VALLEY CIR 4200 - 4242 G1k VALLEY VIEW RD 4200 - 4424 G1k VALLEY VIEW RD 4300 - 4424 G1j WAGONER RD 5500 - 5719 G2e WAGONER RD 5500 - 5719 G2f WAGONER VIEW DR 5332 - 5500 G2j WALKING STICK DR 5524 - 5600 G2c WANDA DR 4600 - 4727 G1h WARREN LN 5010 - 5100 G2g WATERFORD DR 7000 - 7142 G1o WEDGEWOOD TER 4100 - 4292 G2i WELBORN RD 6700 - 6420 G2i WELBORN RD 6100 - 6298 G2c WELBORN RD 6299 - 7306 G1l WELBORN RD 7200 - 7649 G1k WELBORN RD 5700 - 6010 G2j WHEATMORE CT 6807 - 6900 G1o WHITE HORSE DR 3766 - 3800 G1k WHITE HORSE DR 3766 - 3800 G1o WILDWOOD TRL 6677 - 7100 G1g WILLOW BEND RD 4700 - 4855 G2f WILSON VIEW DR 5027 - 5100 H1s WINDRIDGE CT 4366 - 4400 G2j WINNERS CIR 6872 - 7000 G1o WOODCREST ST 3900 - 4146 G1l WOODCREST ST 3900 - 4022 G1p WYOMING CT 4300 - 4341 G1j YOUNTS ST 5200 - 5324 H2r YOUNTS VIEW DR 5300 - 5345 H2r APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-1 of 17 COMPLELX NAME ADDRESS 1909 HISTORIC COURTHOUSE 145 WORTH ST A 1 STORAGE 7463 US HWY 64 E A AND D FURNITURE 5282 OLD MEADOWBROOK RD ACADEMY 1 APARTMENTS 304 REECE AVE ACADEMY 1 APARTMENTS 308 REECE AVE ACADEMY 1 APARTMENTS 302 REECE AVE ACADEMY 1 APARTMENTS 306 REECE AVE ACADEMY 2 APARTMENTS 111 REECE CT ACADEMY 2 APARTMENTS 113 REECE CT ACADEMY 2 APARTMENTS 115 REECE CT ACADEMY 3 APARTMENTS 117 REECE CT ACADEMY 4 APARTMENTS 118 REECE CT ACADEMY TRACE APARTMENTS 119 REECE CT ACADEMY TRACE APARTMENTS 120 REECE CT ACTS TEMPLE CHURCH MOBILE HOME PARK 159 ACTS TEMPLE DR AIKENS MOBILE HOME PARK 6229 NC HWY 62 ALLEN STORAGE BUILDINGS 5961 US HWY 64 E ALLENS TRAILER PARK 145 ADAMS RD ALLMONS MOBILE HOME PARK 401 PINEVIEW ST ALLRIDGE MOBILE HOME PARK 506 SAUNDERS DR AMANDAY EXPRESS 5625 US HWY 220 S APPLEGATE APARTMENTS 328 W STARMOUNT AVE ARBOR ON E CENTRAL 731 OLD LIBERTY RD ARBOR ON E CENTRAL 723 OLD LIBERTY RD ARBOR ON E CENTRAL 611 E CENTRAL AVE ARBOR ON E CENTRAL 605 E CENTRAL AVE ARBOR ON E CENTRAL 1946 LAKEVIEW RD ARBOR ON E CENTRAL 1950 LAKEVIEW RD ARBOR ON E CENTRAL 1955 LAKEVIEW RD ARCHDALE COMMONS 11651 N MAIN ST ARCHDALE EXECUTIVE PARK 313 TRINDALE RD ARCHDALE MANOR 304 TRINDALE RD ARCHDALE PROFESSIONAL VILLAGE 11635 N MAIN ST ARCHDALE VILLAGE 10547 N MAIN ST ARLINGTON SQUARE APARTMENTS 200 E STRIDER ST ARLINGTON SQUARE WEST 1901 N FAYETTEVILLE ST ASHEBORO MILL LOFTS 161 S CHURCH ST ASHEBORO MILL LOFTS 221 S CHURCH ST ASHEBORO MOBILE HOME PARK 2001 LAKEVIEW RD ASHEBORO SUMMIT 156 E ACADEMY ST ASHLEY PARK MOBILE HOME PARK 2971 OLD MOUNTAIN RD AUSTINS MOBILE HOME PARK 428 ENGLEWOOD DR AUTUMN OAKS APARTMENTS 1012 CHISHOLM RD APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-2 of 17 COMPLELX NAME ADDRESS AUTUMN PLACE 716 DIXON AVE AUTUMN PLACE 711 SUNSET AVE B AND R MOBILE HOME PARK 5679 MOBILE DR BAXTERS MOBILE HOME PARK 5841 CEDAR SQUARE RD BEASLEY BUSINESS COMPLEX 1981 BETHEL DR BERTS MOBILE HOME PARK 4327 PLAINFIELD RD BEVERLY HILLS MOBILE HOME PARK 1217 CECIL ST BIBLE TABERNACLE COMMUNITY CHURCH 5113 OLD GREENSBORO RD BIG OAK MOBILE HOME PARK 6216 LEDBETTER RD BIG OAK TRAILER PARK 1191 FULLER MILL RD N BILLS MOBILE HOME PARK 3613 EASTWARD AVE BONKEMEYER TRAILER PARK 516 BONKEMEYER DR BRASWELL APARTMENTS 1352 BRILES DR BRAXTON CULLER FURNITURE 7310 US HWY 311 BREEZE HILL APARTMENTS 1034 BREEZE HILL RD BRENNAN PLACE NUMBER 1 8441 US HWY 220 BUS N BRENNAN PLACE NUMBER 2 8475 US HWY 220 BUS N BRITANNY HOUSE APARTMENTS 1009 S CHURCH ST BROOKWOOD GARDEN APARTMENTS 1035 S CHURCH ST BROWN ST APARTMENTS NUMBER 1 602 E BROWN ST BROWN ST APARTMENTS NUMBER 2 604 E BROWN ST BROWN STREET APARTMENTS 506 E BROWN ST BROWNS MOBILE HOME PARK 5715 ZELMA BLVD BROWNS MOBILE HOME PARK 4502 MEADOWBROOK DR BULLA APARTMENTS 8909 HILLSVILLE RD BUSINESS CENTER 8747 US HWY 311 BUSINESS COMPLEX 6329 UNITY ST BUSINESS COMPLEX 208 W SALISBURY ST SHOPPES AT BONNIE PLACE 101 BONNIE PL BUSINESS COMPLEX 240 E MAIN ST BUSY B MOBILE HOME PARK 5203 FRED LINEBERRY RD CAMBPELL'S MOBILE HOME PARK 1176 RISING VIEW WAY CAMBRIDGE APARTMENTS 212 BOSSONG DR CAMPBELLS MOBILE HOME PARK NUMBER 1 9637 US HWY 220 BUS N CAMPBELLS MOBILE HOME PARK NUMBER 2 9641 US HWY 220 BUS N CANTERBURY COURT 500 N CHURCH ST CARAWAY MOBILE HOME PARK 248 CAMERON PL CARRIAGE SQUARE 372 W WARD ST CARROLLS MOBILE HOME PARK 5830 ZELMA BLVD CASPN HOMES 945 S CHURCH ST CEDAR FALLS MOBILE HOME PARK 1497 WHITES MEMORIAL RD CEDAR LANE MOBILE HOME ESTATES 4697 ROUNDLEAF RD CEDAR LANE MOBILE HOME PARK 6839 CANAAN CHURCH RD APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-3 of 17 COMPLELX NAME ADDRESS CEDAR RIDGE MOBILE HOME PARK 1931 WICKER LOVELL RD CEDAR SQUARE APARTMENTS 6332 DAVIS CTRY RD CEDAR SQUARE CREATIVE CENTER 7408 DAVIS CTRY RD CEDAR WOODS APARTMENTS 519 ROSS ST CENTER POINTE PLAZA 1220 E DIXIE DR CENTER POINTE PLAZA 1222 E DIXIE DR CENTER POINTE PLAZA 1224 E DIXIE DR CENTER ST APARTMENTS 908 CENTER ST CHATEAU APARTMENTS 332 W WARD ST CHAUDHRY PLAZA 122 REED CREEK RD CHERRY TREE APARTMENTS 445 CITY VIEW ST CHIL OAK TON MOBILE HOME PARK 8374 HARLOW RD CHILTON MOBILE HOME PARK 8348 HARLOW RD CHILTONS MOBILE HOME PARK NUMBER 1 3766 BUFFALO FORD RD CHILTONS MOBILE HOME PARK NUMBER 2 3486 BUFFALO FORD RD CIRCLE DRIVE MOBILE HOME PARK 302 CIRCLE DR CLAUDE MORRIS MOBILE HOME PARK 667 REVELLE TRL CLICKS BUSINESS CENTER 3313 US HWY 64 E CLIMAX MOBILE HOME PARK 2594 CROATAN TRAIL RD CLOTHES WAREHOUSE 1640 US HWY 64 E COLONIAL COURT 427 S MAIN ST COLONIAL MANOR 2220 N FAYETTEVILLE ST COLONY HEIGHTS MOBILE HOME PARK 522 TURNER ST COLTRANES MOBILE HOME PARK NUMBER 2 7108 PROSPECT CHURCH RD CONNORS MOBILE HOME VILLAGE 5675 OLD THOMASVILLE RD CORNWELL OFFICE COMPLEX 2019 S FAYETTEVILLE ST COUNTRY HOLLOW 1888 OLD COX RD COUNTRY LIVING MOBILE HOME PARK 6496 THOMPSON RD EXT COUNTRY SQUIRE APARTMENTS 4546 MILLERS MILL RD COUNTRYSIDE MOBILE HOME PARK 3571 ROY FARLOW RD COUNTRYSIDE MOBILE HOME PARK 6614 DAVIS CTRY RD COX MOBILE HOME PARK 156 ROCKY KNOLL RD COX MOBILE HOME PARK 446 OLD LIBERTY RD COXBOROUGH PROFESSIONAL PREMISES 350 N COX ST CRANFORDS MOBILE HOME PARK NUMBER 1 473 FAITH ROCK RD CRANFORDS MOBILE HOME PARK NUMBER 2 608 FAITH ROCK RD CRISTY ACRES MOBILE HOME PARK 2011 NAOMI RD CROSS RD RET CTR MAIN AND ALZHEIMER UNIT 1302 OLD COX RD CROSS RD RET CTR VILLAGE APARTMENTS N 1306 OLD COX RD CROSS RD RET CTR VILLAGE APARTMENTS S 1308 OLD COX RD CROSSROADS SELF STORAGE 1977 BETHEL DR CROSSROADS SHOPPING CENTER 1337 E DIXIE DR CRYSTAL PINE MOBILE HOME PARK 1725 GREENDALE RD APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-4 of 17 COMPLELX NAME ADDRESS D J MOBILE HOME PARK 5248 RUSH MTN RD EXT D R WOODS MOBILE HOME PARK 1935 GROOM RD DALE QUEEN MOBILE HOME PARK LOT NUMBER 9 7161 SUITS RD DANIELS MOBILE HOME PARK 1145 LOFLIN HILL RD DARNELL BUSINESS COMPLEX 1920 BETHEL DR DARRELL ALLREDS MOBILE HOME PARK 505 E ALLRED ST DAVIS MOBILE HOME PARK 215 HOLDER INMAN RD DAWKINS TRAILER PARK 2072 W O W RD DEEP RIVER CUSTOM FRAMES 1128 ANDREW HUNTER RD DEEP RIVER DYE 225 POPLAR ST DELK ARMY NAVY SURPLUS 4705 US HWY 64 W DEMPSEY KINDLEY MOBILE HOME PARK 6705 OLD US HWY 64 DISCO APARTMENTS 1344 OLD CEDAR FALLS RD DOGWOOD APARTMENTS 7009 PROSPECT CHURCH RD DONALD PRITCHARD 1832 N FAYETTEVILLE ST DONS MOBILE HOME PARK 7112 PROSPECT CHURCH RD DOWNING APARTMENTS 1588 MOUNTAIN VIEW DR DRAYCOTT PARK 4054 BENTLEY DR DRAYCOTT PARK 4060 BENTLEY DR DRAYCOTT PARK 4068 BENTLEY DR DRAYCOTT PARK 4074 BENTLEY DR DUBLIN APARTMENTS NUMBER 1 154 DUBLIN SQUARE RD DUBLIN APARTMENTS NUMBER 2 158 DUBLIN SQUARE RD DUPLEX 323 CLIFF RD DWAIN BRILES APARTMENTS 963 REDWOOD DR E L JOHNSON APARTMENTS 4383 US HWY 311 EAST 64 INDUSTRIAL PARK 4675 US HWY 64 E EAST COURT APARTMENTS 835 S COX ST EAST RANDOLPH TR. PK.7363 FERGUSON RD EASTWOOD APARTMENTS 940 RAMBLING RD EASTWOOD APARTMENTS 937 RAMBLING RD EASTWOOD MOBILE HOME PARK 3568 OLD CEDAR FALLS RD EDEN TERRACE APARTMENTS 717 EDEN TER EDEN TERRACE APARTMENTS 719 EDEN TER EDEN TERRACE APARTMENTS 715 EDEN TER EDEN TERRACE APARTMENTS 711 EDEN TER EDEN TERRACE APARTMENTS 713 EDEN TER EDGAR MOBILE HOME PARK 4888 EDGAR RD EDGAR ROAD MOBILE HOME PARK 5524 EDGAR RD EDS MOBILE HOME PARK 5539 LIBERTY GROVE RD ELKES TRAILER PARK 6237 OLD MENDENHALL RD ELMWOOD APARTMENTS 5047 ELMWOOD ST FAITH CHRISTIAN APARTMENTS 5425 BROOKHAVEN RD APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-5 of 17 COMPLELX NAME ADDRESS FARMER TRACE APARTMENTS 179 FARMER RD FLETCHERS MOBILE HOME PARK 5622 ALBERTSON RD FLINCHUM FLOOR COVERING COMPLEX 4720 US HWY 220 BUS N FOUST MOBILE HOME PARK 443 FOUST DR FRAZIERS MOBILE HOME PARK 1588 ACADEMY RD EXT GARRETTS MOBILE HOME PARK 7357 NC HWY 49 N GEORGE LAMBS MOBILE HOME PARK 428 QUAKER DR GIBS MOBILE HOME PARK 6074 GILBERT DAVIS DR GIBSONS MOBILE HOME PARK 661 PROVIDENCE CHURCH RD GOLDSTON APARTMENTS 933 NC HWY 49 N GOLDSTONS MOBILE HOME PARK 5316 GOLDSTON RD GRANTVILLE HILLS MOBILE HOME PARK 2738 PILOT MOUNTAIN RD GREEN ACRES MOBILE HOME PARK 5761 GREEN ACRES DR GREENS MOBILE HOME PARK 2788 BUFFALO FORD RD GRUBBS MOBILE HOME PARK 5735 ZELMA BLVD GSL MOBILE HOME PARK 6063 DAVIS CTRY RD H AND H MOBILE HOME PARK 2302 RACE TRACK RD H AND J VILLAGE MOBILE HOME PARK 985 RANDOLPH TABERNACLE RD H L DELK APARTMENTS 5401 HENRY DELK RD HAMLIN SQUARE 519 HAMLIN ST HAMLIN ST APARTMENTS 510 HAMLIN ST HANOVER COURT 731 W KIVETT ST HARDIN COMPLEX 5835 NC HWY 49 N HARDIN, LLC 329 W BOWMAN AVE HAWKSVIEW MOBILE HOME PARK 1781 HAWKSVIEW RD HEPLERS MOBILE HOME PARK 7808 TURNPIKE RD HERBERT SMITHS MOBILE HOME PARK 204 SHARON AVE HERITAGE HOUSE APARTMENTS 4900 ARCHDALE RD HICKORY HILLS MOBILE HOME PARK 1535 MILES MOFFITT RD HICKORY LANE MOBILE HOME PARK 2266 DANNY BELL RD HIDDEN FOREST MOBILE HOME PARK 6602 HOLDER INMAN RD EXT HIDDEN VALLEY MOBILE HOME PARK 112 CARRIAGE WAY RD HIGHS MOBILE HOME PARK 6147 SUNSET VIEW DR HIGHT MOBILE HOME PARK 997 FOXFIRE RD HILL AND DALE MOBILE HOME PARK 558 CHASE RD HILLSIDE MOBILE HOME PARK 129 LEE LAYNE RD HILLSIDE TRAILER PARK 6509 SUITS RD HILLSVILLE BUSINESS PARK 5141 HOOVER HILL RD HILLTOP MOBILE HOME PARK 2419 WICKER LOVELL RD HINSHAW MOBILE HOME PARK 1713 BURMIL RD HINSHAW MOBILE HOME PARK 1717 BURMIL RD HIS LABORING FEW MINISTERIES 1351 WISCHUM WAY HODGES MOBILE HOME PARK 4414 ISOM RD APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-6 of 17 COMPLELX NAME ADDRESS HOLIDAY TOURS BUSINESS COMPLEX 10367 RANDLEMAN RD HOLLINGSWORTH ACRES MOBILE HOME PARK 5033 OLD MARLBORO RD HONEYCUTTS MOBILE HOME PARK 5496 UWHARRIE RD HOOVER MOBILE HOME PARK 179 KINDLEY RD HUFFMAN MOBILE HOME PARK 5094 JORDAN VALLEY RD HUNTERS WEIGH 605 SUNSET AVE HUNTS APARTMENTS 2015 CRAVEN ST ICARUS COWORKING 181 E WARD ST J AND R MOBILE HOME PARK 1109 ROSS WOOD RD J AND R MOBILE HOME PARK 964 LOFLIN HILL RD JACUMIN LODGE AREA 4752 CARAWAY MTN RD JIM FIELDS TRAILER PARK 7181 SHILOH RD JOE COXS MOBILE HOME PARK 1819 HENSON RD K AND J MOBILE HOME PARK 1268 NC HWY 49 N KELLY LEE APARTMENTS 1234 OLD FARMER RD KEN RUE MOBILE HOME PARK 1404 N FAYETTEVILLE ST KIMBERLY PARK APARTMENTS 231 E SALISBURY ST KING HILL APARTMENTS 4724 HUNTINGWOOD RD KINGS CORNER STUDIO APARTMENTS 1000 N FAYETTEVILLE ST KINGS MOBILE HOME PARK 1175 MACK RD KINGSBURY MOBILE HOME PARK 3483 NEW HOPE CHURCH RD KINGSGLEN APARTMENTS 1129 S COX ST KINGSWAY APARTMENTS 10 KINGSWAY RD KINGSWAY APARTMENTS 12 KINGSWAY RD KINGSWAY APARTMENTS 14 KINGSWAY RD KINGSWAY APARTMENTS 18 KINGSWAY RD KINGSWAY APARTMENTS 16 KINGSWAY RD KINGSWAY APARTMENTS 20 KINGSWAY RD KINGSWAY APARTMENTS 22 KINGSWAY RD KINGSWAY APARTMENTS 24 KINGSWAY RD KINGSWAY APARTMENTS 26 KINGSWAY RD KIVETTS MOBILE HOME PARK 3691 NC HWY 42 S KLAUSSNER FURNITURE CO 405 LEWALLEN RD L AND L MOBILE HOME PARK 7554 US HWY 220 S LABRADOR DEV BLDG 1 10583 RANDLEMAN RD LABRADOR DEV BLDG 2 129 LABRADOR DR LAKE DR APARTMENTS 506 LAKE DR LAMBETH HEIGHTS MOBILE HOME PARK 2432 N FAYETTEVILLE ST LAMBETH MOBILE HOME PARK 876 HOOVER HILL RD LEONARDS APARTMENTS 449 BRADY ST EXT LEROYS MOBILE HOME PARK 1108 OLD STATE HWY LEVEL CROSS INDUSTRIAL PARK 10553 RANDLEMAN RD LIBERTY MANOR APARTMENTS 259 W BUTLER AVE APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-7 of 17 COMPLELX NAME ADDRESS LIBERTY RD BAPTIST CHURCH 2179 W O W RD LIBERTY SQUARE APARTMENTS 235 E DAMERON AVE LIBERTY VILLAGE APARTMENTS 234 W BROWER AVE LOUISE MT VIEW MOBILE HOME PARK 185 MOORE AVE LOWES PLAZA 10106 S MAIN ST LUCK COMER LAIL CENTER 365 FERNANDEZ LOOP LUCKENBACK APARTMENTS 134 SUNSET AVE M AND B MOBILE HOME PARK 5620 OLD POOLE RD MACS MOBILE HOME PARK 3646 EASTWARD AVE MADISON HEIGHTS 2280 N FAYETTEVILLE ST MADISON HEIGHTS MOBILE HOME PARK 2475 WOODVIEW DR MAPLE SPRINGS MOBILE HOME PARK 6006 W E HUNT RD MASHBURNS MOBILE HOME PARK 5416 MEADOWBROOK DR MATLAB INC 1112 NC HWY 49 S MATTHEW GRANDE APARTMENTS 2230 N FAYETTEVILLE ST MCCASKILL MOBILE HOME PARK 524 WOODOAK TRL MCGEE MOBILE HOME PARK 5692 MUDDY CREEK RD MCKENZIE BUILDING 516 S FAYETTEVILLE ST MEADOWVIEW APARTMENTS 529 WORTHVILLE ST MEADOWVIEW MOBILE HOME PARK 5077 MEADOWBROOK DR MID TOWNE CENTER 1009 N FAYETTEVILLE ST MIDWAY MOBILE HOME PARK 711 CRESTVIEW CHURCH RD MILLBORO TRAILER PARK 2569 MILLBORO RD MILLS MOBILE HOME PARK 122 E BALFOUR AVE MINI STORAGE BLDGS 9090 US HWY 220 BUS N MOORE APARTMENTS 6238 OLD 421 RD MOORE AVE MOBILE HOME PARK 181 MOORE AVE MOORES MOBILE HOME PARK 6110 MUDDY CREEK RD MOORES MOBILE HOME PARK 5000 BUTLER RD MORAN MOBILE HOME PARK 200 BOBBY MORAN DR MORTON APARTMENTS 1815 BROOK DR MOSERS MOBILE HOME PARK 4918 US HWY 220 BUS N MOSLEYS MOBILE HOME PARK NUMBER 1 5622 MOBILE DR MOSLEYS NUMBER 2A MOBILE HOME PARK 5648 MOBILE DR MOSLEYS NUMBER 2B MOBILE HOME PARK 5694 MOBILE DR MOSLEYS NUMBER 3 MOBILE HOME PARK 5693 MUDDY CREEK RD MOUNTAIN VIEW MOBILE HOME PARK 5118 JORDAN VALLEY RD MRS LEONARDS APARTMENTS 258 COLERIDGE RD MT SHEPHERD MOBILE HOME PARK 615 MT SHEPHERD RD EXT MT SHEPHERD MOBILE HOME PARK NUMBER 2 632 MT SHEPHERD RD EXT MULLINS APARTMENTS 4462 FRIENDSHIP LN MUNICIPAL AIRPORT 2222 PILOTS VIEW RD NELSONS MOBILE HOME PARK 4570 NELSON PARK RD APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-8 of 17 COMPLELX NAME ADDRESS NO NAME 805 HIGH POINT ST NO NAME 222 SUNSET AVE NO NAME 227 TRINDALE RD NO NAME 225 TRINDALE RD NO NAME 916 OCCONEECHEE AVE NO NAME 1127 S FAYETTEVILLE ST NO NAME 700 S MAIN ST NO NAME 627 S COX ST NO NAME 4305 ARCHDALE RD NO NAME 628 DIXON AVE NO NAME 640 DIXON AVE NO NAME 610 N FAYETTEVILLE ST NO NAME 624 S FAYETTEVILLE ST NO NAME 4913 ARCHDALE RD NO NAME 130 S CHURCH ST NO NAME 929 SUNSET AVE NO NAME 242 S MAIN ST NO NAME 315 W BROOKWOOD AVE NO NAME 342 E KIME AVE NO NAME 407 E KIME AVE NO NAME 539 S VALLEY ST NO NAME 329 W BROOKWOOD AVE NO NAME 634 N FOSTER ST NO NAME 605 N SMITH ST NO NAME 326 W STARMOUNT AVE NO NAME 304 S CARTER ST NO NAME 240 W PATTERSON AVE NO NAME 315 KERSEY DR NO NAME 228 LIBERTY RD NO NAME 230 LIBERTY RD NO NAME 10935 N MAIN ST NO NAME 234 LIBERTY RD NO NAME 10923 N MAIN ST NO NAME 11407 N MAIN ST NO NAME 3407 ARCHDALE RD NO NAME 11509 N MAIN ST NO NAME 319 LAKE DR NO NAME 703 LAKE DR NO NAME 3501 GLENDALE DR NO NAME 10409 S MAIN ST NO NAME 10411 S MAIN ST NO NAME 10413 S MAIN ST NO NAME 517 SUNNY LN APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-9 of 17 COMPLELX NAME ADDRESS NO NAME 208 JULIAN AVE NO NAME 119 E KIVETT ST NO NAME 507 S MAIN ST NO NAME 518 S MAIN ST NO NAME 522 S MAIN ST NO NAME 360 S COX ST NO NAME 202 S MAIN ST NO NAME 200 WORTH ST NO NAME 133 E ACADEMY ST NO NAME 310 E SALISBURY ST NO NAME 261 N FAYETTEVILLE ST NO NAME 308 W KIVETT ST NO NAME 233 W KIVETT ST NO NAME 622 W WAINMAN AVE NO NAME 628 W WAINMAN AVE NO NAME 517 HOME AVE NO NAME 624 SUNSET AVE NO NAME 241 SUNSET AVE NO NAME 326 W SALISBURY ST NO NAME 151 N FAYETTEVILLE ST NO NAME 355 S FAYETTEVILLE ST NO NAME 272 ROSS ST NO NAME 858 BREEZE HILL RD NO NAME 1012 POWHATAN AVE NO NAME 730 UWHARRIE ST NO NAME 505 UWHARRIE ST NO NAME 803 LEWIS ST NO NAME 830 SUNSET AVE NO NAME 905 SUNSET AVE NO NAME 214 RICH AVE NO NAME 919 S COX ST NO NAME 1213 S COX ST NO NAME 740 HAMMER AVE NO NAME 732 HAMMER AVE NO NAME 1019 S CHURCH ST NO NAME 1552 N FAYETTEVILLE ST NO NAME 307 BRITTAIN ST NO NAME 401 BRITTAIN ST NO NAME 1334 N FAYETTEVILLE ST NO NAME 1757 FIRST ST NO NAME 2222 S FAYETTEVILLE ST NO NAME 119 NORTHWOOD DR NO NAME 115 NORTHWOOD DR APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-10 of 17 COMPLELX NAME ADDRESS NO NAME 101 N CHERRY ST NO NAME 1041 CEDAR FALLS RD NO NAME 801 MARTIN LUTHER KING JR DR NO NAME 734 MARTIN LUTHER KING JR DR NO NAME 1323 OLD LIBERTY RD NO NAME 1319 OLD LIBERTY RD NO NAME 1240 OLD LIBERTY RD NO NAME 1440 PENNSYLVANIA AVE NO NAME 1822 N FAYETTEVILLE ST NO NAME 221 UNDERWOOD ST NO NAME 616 BENNETT ST NO NAME 1959 LAKEVIEW RD NO NAME 1963 LAKEVIEW RD NO NAME 1967 LAKEVIEW RD NO NAME 1971 LAKEVIEW RD NO NAME 1977 LAKEVIEW RD NO NAME 1954 LAKEVIEW RD NO NAME 1962 LAKEVIEW RD NO NAME 1958 LAKEVIEW RD NO NAME 1966 LAKEVIEW RD NO NAME 1970 LAKEVIEW RD NO NAME 1974 LAKEVIEW RD NO NAME 1942 CEDAR RD NO NAME 1943 CEDAR RD NO NAME 2330 N FAYETTEVILLE ST NO NAME 114 S RANDOLPH AVE NO NAME 121 N RANDOLPH AVE NO NAME 446 MT CROSS ST NO NAME 449 MT CROSS ST NO NAME 416 CITY VIEW ST NO NAME 410 CITY VIEW ST NO NAME 208 FOUST ST NO NAME 200 FOUST ST NO NAME 126 W PRESNELL ST NO NAME 120 W PRESNELL ST NO NAME 535 N FAYETTEVILLE ST NO NAME 1113 N FAYETTEVILLE ST NO NAME 1129 N FAYETTEVILLE ST NO NAME 1137 N FAYETTEVILLE ST NO NAME 402 N FAYETTEVILLE ST NO NAME 318 HOOVER ST NO NAME 312 SUNSET AVE NO NAME 154 S FAYETTEVILLE ST APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-11 of 17 COMPLELX NAME ADDRESS NO NAME 137 S FAYETTEVILLE ST NO NAME 521 ELLIOTT ST NO NAME 747 LAKE DR NO NAME 2118 OLD FARMER RD NO NAME 639 CASCADE AVE NO NAME 201 COLONIAL ST NO NAME 2808 UWHARRIE RD NO NAME 7608 NC HWY 62 NO NAME 620 UWHARRIE ST NO NAME 618 UWHARRIE ST NO NAME 118 N MCCRARY ST NO NAME 513 HILL TOP HOME RD NO NAME 502 FARMER RD NO NAME 749 LAKE DR NO NAME 2419 N FAYETTEVILLE ST NO NAME 230 NORTHWOOD DR NO NAME 132 W MILLER ST NO NAME 118 ART BRYAN DR NO NAME 207 BALFOUR DR NO NAME 2968 LOWE CTRY RD NO NAME 175 NC HWY 49 S NO NAME 1220 E DIXIE DR NO NAME 1130 S CHURCH ST NO NAME 323 NC HWY 49 S NO NAME 940 CENTER ST NO NAME 929 CENTER ST NO NAME 1406 N FAYETTEVILLE ST NO NAME 1801 FAIRWAY RD NO NAME 1245 OLD LIBERTY RD NO NAME 238 S MAIN ST NO NAME 2234 ENTERPRISE ST NO NAME 405 CITY VIEW ST NO NAME 914 ASHDOL ST NO NAME 401 SPRING ST NO NAME 801 S MAIN ST NO NAME 10418 N MAIN ST NO NAME 350 S COX ST NO NAME 115 S FAYETTEVILLE ST NO NAME 515 W SALISBURY ST NO NAME 350 STOWE AVE NO NAME 911 S FAYETTEVILLE ST NO NAME 239 UWHARRIE ST NO NAME 502 E PRESNELL ST APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-12 of 17 COMPLELX NAME ADDRESS NO NAME 633 COLERIDGE RD NO NAME 628 COLERIDGE RD NO NAME 237 N FAYETTEVILLE ST NO NAME 1214 E DIXIE DR NO NAME 275 ROCK CRUSHER RD NO NAME 1207 S COX ST NO NAME 423 HAMLIN ST NO NAME 7491 ADAMS FARM RD NO NAME 560 W WALKER AVE NO NAME 654 N FAYETTEVILLE ST NO NAME 801 HOOVER ST NO NAME 807 HOOVER ST NO NAME 1410 N FAYETTEVILLE ST NO NAME 1019 S COX ST NO NAME APARTMENTS 1249 OLD LIBERTY RD NO NAME APARTMENTS 2995 LOWE CTRY RD NO NAME APARTMENTS 560 MEADOWBROOK RD NO NAME APARTMENTS 915 OCCONEECHEE AVE NO NAME APARTMENTS 1258 WINSLOW AVE NO NAME APARTMENTS 917 OCCONEECHEE AVE NO NAME APARTMENTS 369 HAMLIN ST NO NAME APARTMENTS 390 HAMLIN ST NO NAME APARTMENTS 647 W PRESNELL ST NO NAME BUSINESS 1530 E DIXIE DR NO NAME BUSINESS 809 MOFFITT ST NO NAME COMPLEX 9826 US HWY 311 NO NAME COMPLEX 9814 US HWY 311 NO NAME PLAZA 1528 ZOO PKWY NO NAME PLAZA 1512 ZOO PKWY NO NAME TRIPLEX APARTMENTS 415 SOUTHWAY RD NO NAME WAREHOUSE 9868 US HWY 311 NOBLE APARTMENTS 629 S COX ST OAK FOREST APARTMENTS 3268 US HWY 220 BUS S OAK MEADOWS MOBILE HOME PARK 2075 CEDAR RD OAK WOOD FURNITURE 3800 COMANCHE RD OAKLAND PARK 2000 MCPHERSON ST OLD LIBERTY TOWN HOUSES 1230 OLD LIBERTY RD OLD LIBERTY TOWN HOUSES 1232 OLD LIBERTY RD OLD WALKER SHOE BUILDING 414 E DIXIE DR OLDE TOWNE APARTMENTS 252 S ELM ST PAGE PLACE APARTMENTS 1253 OLD LIBERTY RD PARK PLACE 705 S CHURCH ST PARK PLACE 711 S CHURCH ST APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-13 of 17 COMPLELX NAME ADDRESS PARK PLACE 721 S CHURCH ST PARK PLACE 2 813 S CHURCH ST PARK PLACE 2 741 S CHURCH ST PARK PLACE 2 735 S CHURCH ST PARK PLACE 2 727 S CHURCH ST PARK PLACE 3 821 S CHURCH ST PARK PLACE 3 809 S CHURCH ST PARK PLACE ANNEX 2 818 HAMMER AVE PARK PLACE ANNEX 2 806 HAMMER AVE PAT LEONARD MOBILE HOME PARK 433 BRADY ST EXT PEACE APARTMENTS 5142 ROBBINS CTRY RD PEACE APARTMENTS 4258 ALEXANDRIA DR PEARL CREST MOBILE HOME PARK 1218 BACK CREEK RD PELLS APARTMENTS 1510 MAIN ST PIERCE MEADOW MOBILE HOME PARK 3087 PIERCE MEADOW RD PINEBROOK APARTMENTS 6979 PROSPECT CHURCH RD PINECREST MOBILE HOME PARK 5577 US HWY 64 E PINEWOOD ACRES MOBILE HOME PARK 1066 WORTHVILLE RD PLASTIC COLOR CHIP 1134 NC HWY 49 S PONDEROSA MOBILE HOME PARK 3575 OLD LIBERTY RD POPLAR HOLLOW MOBILE HOME PARK 6670 WRIGHT RD POPLAR RIDGE MOBILE HOME PARK 2587 WAYNE WHITE RD PRESTIGE FABRICATORS 216 RUSSELL WALKER AVE PROFESSIONAL VILLAGE 220 FOUST ST PROFESSIONAL VILLAGE 218 FOUST ST PROSPECT MOBILE HOME PARK 5166 PROSPECT ST QUAIL HOLLOW APARTMENTS 6961 PROSPECT CHURCH RD RAMA WOODS 200 REECE AVE RAMA WOODS 202 REECE AVE RAMA WOODS 204 REECE AVE RAMA WOODS 201 REECE AVE RAMA WOODS 203 REECE AVE RAMA WOODS 205 REECE AVE RAMA WOODS 207 REECE AVE RAMSEUR MOBILE HOME PARK 860 EDWARDS FARM RD RANDLEMAN BUSINESS CENTER 807 HIGH POINT ST RANDOLPH COMMUNITY COLLEGE 629 INDUSTRIAL PARK AVE RANDOLPH HEALTH PEDIATRICS 713 S FAYETTEVILLE ST RANDOLPH HILL APARTMENTS 151 KING RD RANDOLPH MOBILE HOME PARK 150 HWY 311 EXT RANDOLPH SENIOR ADULTS 347 W SALISBURY ST RAY POOLE MOBILE HOME PARK 6044 POOLE RD RAYLE GAS AND OIL 11020 RANDLEMAN RD APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-14 of 17 COMPLELX NAME ADDRESS RAYOLA ACRES MOBILE HOME PARK 6821 DAVIS CTRY RD RED CROSS MOBILE HOME PARK 7930 NC HWY 22 N RETAIL SHOPS 405 E DIXIE DR RHODES MOBILE HOME PARK 5609 MOBILE DR RICHARDSONS MOBILE HOME PARK 5732 PLEASANT HILL RD RICHIES MOTEL 11021 RANDLEMAN RD RIMMERS MOBILE HOME PARK 2994 STANLEY RD RIVER POINTE 701 HIGH POINT ST RIVER VIEW MOBILE HOME PARK 2975 OLD MOUNTAIN RD RIVERSIDE APARTMENTS 6928 US HWY 64 W RLC MOBILE HOME PARK 7177 POWER LINE RD ROCK CREEK TRL PK 1954 JONES ST ROCKDALE MOBILE HOME PARK 6216 OLD MENDENHALL RD ROCKWOOD MOBILE HOME PARK 421 SPRINGDALE DR ROCKY WOODS TRAILER PARK 1946 WHITT HUNT RD ROLLING HILLS MOBILE HOME PARK 686 PLEASANT RIDGE CHURCH RD ROSE BUILDING 224 N MAIN ST ROSS ST APARTMENTS 348 ROSS ST RUMBLEY BROS PARK 417 E CENTRAL AVE RUSHS SHADY OAK MOBILE HOME PARK 10631 RANDLEMAN RD RUSSET KNOLL 342 W WARD ST SALEMGATE APARTMENTS 819 CENTER ST SALEMGATE APARTMENTS 823 CENTER ST SALEMGATE APARTMENTS 817 CENTER ST SALEMGATE APARTMENTS 821 CENTER ST SALEMGATE APARTMENTS 835 CENTER ST SANDHILLS CENTER FOR MENTAL HEALTH 110 W WALKER AVE SATTERFIELD MOBILE HOME PARK 192 WESTSIDE CIR SCENIC OAKS MOBILE HOME PARK 1802 GRANTVILLE LN SHADOWBROOK MOBILE HOME PARK 891 NEWMAN TRL SHADY GROVE MOBILE HOME PARK 212 CHANEY RD SHADY OAKS MOBILE HOME PARK 3742 PINEVIEW AVE SHAW FURNITURE 130 W ACADEMY ST SHELTON APARTMENTS 11027 RANDLEMAN RD SHERWOOD PLACE 1000 SHERWOOD AVE SHOPPING CENTER 109 W LUTHER AVE SHOPPING CENTER NO NAME 421 NC HWY 49 S SK KINDLEY MOBILE HOME PARK 3586 KINDLEY FARM RD EXT SMITHS ON MAIN 11628 N MAIN ST SMYRNA GROVE MOBILE HOME PARK 2391 SMYRNA GROVE DR SOUTHERN CENTER ASSOCIATES 11234 N MAIN ST SOUTHWEST MOBILE HOME PARK 1198 THOROUGHBRED RD SPECIALITY SHOPS 161 NC HWY 42 N APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-15 of 17 COMPLELX NAME ADDRESS SPECIALITY SHOPS 177 NC HWY 42 N SPECIALITY SHOPS 191 NC HWY 42 N SPECIALITY SHOPS 197 NC HWY 42 N SPENCERS MOBILE HOME PARK 5463 ROBBINS CTRY RD SPRINGSIDE MOBILE HOME PARK 2823 SPRINGSIDE RD SPRINGWOOD MOBILE HOME PARK 3210 STALEYS FARM RD STRATFORD OAKS APARTMENTS 224 STRATFORD RD SUGGS MOBILE HOME PARK 10109 US HWY 220 BUS N SUGGS MOBILE HOME PARK NUMBER 2 10131 US HWY 220 BUS N SUMMERS RUN 2207 N FAYETTEVILLE ST SUMMERS RUN APARTMENTS 2159 N FAYETTEVILLE ST SUNNY HILL MOBILE HOME PARK 5664 MUDDY CREEK RD SUNSET LAW CENTER 100 SUNSET AVE SUNSET PLACE APARTMENTS 722 SUNSET AVE SUNSET PLACE APARTMENTS 720 SUNSET AVE T & L WAREHOUSE 154 LABRADOR DR T AND M MOBILE HOME LOTS 989 LOFLIN HILL RD TAR HEEL PLAZA 10102 S MAIN ST TATE ST APARTMENTS 576 TATE ST THE RESERVE AT ASHELYN GLENN 1819 N FAYETTEVILLE ST THE WOODS MOBILE HOME PARK 2114 W O W RD TOWN AND COUNTRY BUSINESS CENTER 9878 US HWY 311 TOWN AND COUNTRY MOBILE HOME PARK 338 PLEASANT RIDGE RD TOWNE CENTER 239 WHITE OAK ST TOWNE MANOR 233 WORTH ST TRIAD EYE CARE 10564 N MAIN ST TRIANGLE PARK 157 DUBLIN SQUARE RD TRINDALE BLDG 302 TRINDALE RD TRINDALE CROSSING 7374 NC HWY 62 TUNEY MOBILE HOME PARK 3626 KINDLEY FARM RD EXT TWIN OAK APARTMENTS 405 FARMER RD TWO TWENTY MOBILE HOME PARK 11044 RANDLEMAN RD UPCHURCH MINI STORAGE 517 N BROAD ST UWHARRIE MEADOWS MOBILE HOME PARK 4671 WAYNICK MEADOW RD UWHARRIE SQUARE 818 POWHATAN AVE UWHARRIE SQUARE 508 UWHARRIE ST UWHARRIE VILLAGE MOBILE HOME PARK 4418 MEADOWBROOK DR VESTAL MOBILE HOME PARK 1338 ALLEN VESTAL RD VICTORIAN ARMS 4902 ARCHDALE RD VICTORIAN ARMS 4904 ARCHDALE RD VICTORY JUNCTION GANG CAMP 4500 ADAMS WAY VILLAGE AT STONE CREEK 518 MARTIN LUTHER KING JR DR VILLAGE AT STONE CREEK 512 MARTIN LUTHER KING JR DR APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-16 of 17 COMPLELX NAME ADDRESS VILLAGE AT STONE CREEK 514 MARTIN LUTHER KING JR DR VILLAGE AT STONE CREEK 516 MARTIN LUTHER KING JR DR VILLAGE AT STONE CREEK 510 MARTIN LUTHER KING JR DR VILLAGE AT STONE CREEK 508 MARTIN LUTHER KING JR DR VILLAGE AT STONE CREEK 506 MARTIN LUTHER KING JR DR VILLAGE INN COMPLEX 1095 W DIXIE DR VILLAGE MARKETPLACE 1520 E DIXIE DR VILLAGE MARKETPLACE 1510 E DIXIE DR VILLAGE SQUARE 10948 N MAIN ST WAINMAN PLACE 600 W WAINMAN AVE WALT'S MOBILE HOME PARK 5501 OLD THOMASVILLE RD WARDS MOBILE HOME PARK 5734 ZELMA BLVD WATTS MOBILE HOME PARK 301 CIRCLE DR WAYNE WRIGHT APARTMENTS 2033 SHADY GROVE CHURCH RD WEANT MOBILE HOME PARK 6548 WEANT RD WELBORN MOBILE HOME PARK 6181 WELBORN RD WEST 49 MOBILE HOME PARK 3855 MECHANIC RD WEST POINTE LUXURY APARTMENTS 765 LUXURY LN WEST POINTE LUXURY APARTMENTS 303 EASTON EXT WEST POINTE LUXURY APARTMENTS 311 EASTON EXT WEST POINTE LUXURY APARTMENTS 719 LUXURY LN WEST POINTE LUXURY APARTMENTS 785 LUXURY LN WEST POINTE LUXURY APARTMENTS 737 LUXURY LN WEST POINTE LUXURY APARTMENTS 310 EASTON EXT WEST POINTE LUXURY APARTMENTS 535 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 555 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 567 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 748 LUXURY LN WEST POINTE LUXURY APARTMENTS 760 LUXURY LN WEST POINTE LUXURY APARTMENTS 675 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 755 LUXURY LN WEST POINTE LUXURY APARTMENTS 770 LUXURY LN WEST POINTE LUXURY APARTMENTS 505 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 581 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 612 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 634 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 653 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 635 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 691 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 485 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 461 OAK LEAF RD WEST POINTE LUXURY APARTMENTS 777 LUXURY LN WEST POINTE LUXURY APARTMENTS 790 LUXURY LN APPENDIX C: COMPLEX NAME INDEX Revised: 5/25/2022 Appendix C-17 of 17 COMPLELX NAME ADDRESS WESTWOOD MOBILE HOME PARK 874 NC HWY 49 S WHITTS MOBILE HOME PARK 1562 WHITT HUNT RD WILLIAMS APARTMENTS 8798 US HWY 311 WILLIAMS MOBILE HOME PARK 6733 SUITS RD WILLIAMS STORAGE BLDGS 8774 US HWY 311 WILLIAMSONS APARTMENTS 177 SOHOMEY DR WINDSOR PLACE AT RANDLEMAN 149 WINDSOR PLACE CIR WINDSOR PLACE AT RANDLEMAN 326 WINDSOR PLACE CIR WINDSOR PLACE AT RANDLEMAN 310 WINDSOR PLACE CIR WINDSOR PLACE AT RANDLEMAN 320 WINDSOR PLACE CIR WINDSOR PLACE AT RANDLEMAN 220 WINDSOR PLACE CIR WINDSOR PLACE AT RANDLEMAN 222 WINDSOR PLACE CIR WINDSOR PLACE AT RANDLEMAN 232 WINDSOR PLACE CIR WINDSOR PLACE AT RANDLEMAN 332 WINDSOR PLACE CIR WINDY MEADOWS 2 6867 WRIGHT RD WRIGHT PLACE MOBILE HOME PARK 1327 OAKMONT VIEW RD WRIGHTS MOBILE HOME PARK 191 SMALL RD WRIGHTS MOBILE HOME PARK 6711 WRIGHT RD YOWS FAMILY PARK 1587 MILES MOFFITT RD YOW'S MOBILE HOME PARK NUMBER 1 7135 SUITS RD YOWS MOBILE HOME PARK NUMBER 2 7136 SUITS RD ZOO CITY SPORTSPLEX 2981 ZOO PKWY APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-1 of 38 ROAD #ROAD NAME S3245 ABIGAIL DR S1112 ABNER RD S2500 ACADEMY RD EXT S2495 ACADEMY ST S1936 ADAMS FARM RD S3158 AKINS ST S1898 ALAMO CT S1897 ALAMO DR S1713 ALBEMARLE RD S1665 ALBERTSON RD S3212 ALBERTSON VIEW ST S1912 ALDRIDGE RD S2988 ALEXANDER CT S1654 ALFORD ST S2028 ALLEN DR S3272 ALLRED HEIGHTS DR S2290 ALLRED WAY S1770 ALLWOOD DR S1823 ALPINE DR S2917 ANCHOR DR S2235 ANDREW HUNTER RD S2949 ANTHONY CT S2887 ANTIOCH CHURCH RD S1223 APPALOOSA TRL S1120 APPLE TREE RD S3136 APPLEGATE LN S2133 APPLEWOOD RD S2934 APRIL LN S1222 ARABIAN DR S1727 ARBOR DR S2284 ARCADIA RD S1004 ARCHDALE RD S2836 ARCHIE NEWSOM RD S1785 ARDEN RD S2702 ARLINGTON DR S2702 ARLINGTON DR EXT S1230 ARMADILLO DR S1810 ARNETTE DR S2486 ARROW HEAD RD S1386 ARROWSTONE DR S1626 ARTISAN AVE S1995 ASHBROOK CIR S3193 ASHETON DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-2 of 38 ROAD #ROAD NAME S1161 ASHWORTH RD S1330 ASTEROID RD S2387 ATLAS DR S1663 AUCTION RD S2913 AUMAN AVE S2844 AUMAN CLAY RD S2990 AUTUMN LN S1821 AZALEA LN S2849 BACHELOR CREEK RD S1327 BACK CREEK CHURCH RD S1873 BACK CREEK CT S1420 BACK CREEK RD S1374 BACK CREEK TER S1140 BAILEY RD S2124 BALDWIN DR S2705 BALSAM ST S1931 BANNER WHITEHEAD RD S2102 BANTAM RD S2359 BARKER DR S2219 BARKWOOD RD S1117 BEANE CTRY RD S2707 BEANE ST S1778 BEAUMONT DR S2121 BEAVERCREEK RD S1524 BECKERDITE RD S1863 BEECH CIR S2031 BEECH TREE CT S2357 BEECH TREE PL S1387 BEECHWOOD CT S2047 BEESON CT S1525 BEESON FARM RD S1146 BELL SIMMONS RD S1100 BELLS GROVE RD S1319 BEN LAMBETH RD S2848 BENNETT FARM RD S1002 BENNETT RD S2445 BENNY LINEBERRY RD S2540 BENT OAK AVE S2889 BENT RIDGE RD S3144 BENTON RD S1876 BERKLEY LN S3190 BERKLEY PL S2230 BERRY LN APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-3 of 38 ROAD #ROAD NAME S1311 BESCHER CHAPEL RD S1167 BESSIE BELL RD S2132 BETHANY CHURCH RD S2112 BETHEL CHURCH RD S1621 BETHEL DR S2056 BETHEL DR EXT S2660 BETHEL FRIENDS RD S1118 BETHEL LUCAS RD S3244 BETSY LN S1270 BETTY MCGEE DR S2879 BEULAH CHURCH RD S1160 BILLY WALKER RD S1168 BINGHAM LOFLIN RD S2007 BIRCH DR S2321 BLUE RIDGE RD S1643 BLUEBERRY CT S3226 BLUEBIRD LN S2223 BOB KIVETT RD S1624 BOLIVAR AVE S1178 BOMBAY SCHOOL RD S1139 BONDURANT RD S1227 BONITA LN S1242 BONITA ST S2187 BOOKER T WASHINGTON AVE S1124 BOROUGH AVE S2125 BOWERS LN S1954 BOWMAN AVE S2413 BOWMAN DAIRY RD S2811 BOYD AVE S2855 BOYD DR S3105 BRAD RD S2489 BRADY ST EXT S1370 BRANCHVIEW WAY S1359 BRANCHWATER RD S1944 BRANSON DAVIS RD S2101 BRANSON MILL RD S2985 BRANTLEY DR S1303 BRANTLEY GORDON RD S2816 BRAY BLVD S3012 BRAY BLVD S2377 BRECKENWOOD CT S3171 BREVARD DR S3174 BRIAR PATCH LN APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-4 of 38 ROAD #ROAD NAME S2600 BRIARCLIFF DR S1789 BRIARCLIFF RD S2368 BRIAROAK DR S2046 BRIDGE POINT DR S1214 BRILES DR S1357 BRILES MEADOW RD S2549 BRINTON PL S2276 BRISTOL LN S2273 BRITTANY TRL S1888 BROKAW DR S1760 BROKEN OAK RD S1829 BROOK CIR S2810 BROOK DR S1828 BROOK ST S1606 BROOKDALE DR S2384 BROOKDALE RD S2615 BROOKLYN AVE EXT S2460 BROOKSDALE RD S3281 BROOKSHIRE CT S1389 BROOKSIDE CT S1450 BROOKWAY RD S2072 BROOKWOOD ACRES DR S2246 BROOKWOOD DR S2440 BROWER MEADOW RD S2866 BROWER MILL RD S2635 BROWERDALE RD S2826 BROWERS CHAPEL RD S1953 BROWN LOOP S2118 BROWN OAKS RD S2941 BROWNMIRE DR S2469 BROWNS CROSSROADS RD S2408 BROWNS MEADOW RD S2724 BROWNSTONE HILLS DR S2132 BRUCE PUGH RD S2643 BRUSH CREEK RD S2070 BUCK LN S2607 BUFFALO FORD RD S2412 BULB RD S2111 BULL RUN CREEK RD S2437 BUMPAS RD S1698 BUNDY DR S1433 BUNTING RD S2411 BUNTON SWAIM RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-5 of 38 ROAD #ROAD NAME S2723 BURGESS FARM DR S2629 BURGESS KIVETT RD S1105 BURNEY MILL RD S1127 BURNEY RD S1176 BURRELL ALLEN RD S2517 BURROW RD S2419 BUTLER RD S2499 BUTLERS CHAPEL RD S3243 BYRD LN S2553 C C SQUARE RD S1320 CABLE CREEK RD S2861 CAGLE LOOP RD S1880 CAIN CT S2523 CALHOUN DR S2193 CALLICUT ST S1141 CALLICUTT HENLEY RD S2059 CALVARY WAY S1847 CALVERT ST S2367 CAMDEN CT S2289 CAMELOT DR S1843 CAMERON CIR S3135 CAMERON DR S2120 CAMP NAWAKA RD S1307 CANAAN CHURCH RD S2832 CANE MILL RD S1206 CANNON HEIGHTS DR S2625 CANOY FARM RD S1983 CANTER LN S2696 CANTERBURY TRL S3143 CARAWAY DR S1004 CARAWAY MTN RD S1730 CARAWAY TRL S1221 CARDINAL ST S2143 CARL ALLRED RD S2885 CARL BRADY RD S2882 CARL COX RD S1838 CARLTON DR S1834 CAROLE DR S1269 CAROWOOD DR S2366 CARRIAGE CROSSING DR S2697 CARRIAGE LN S1634 CARRIAGE WAY RD S1736 CARSON RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-6 of 38 ROAD #ROAD NAME S1636 CASHATT RD S3145 CASSADY RD S2300 CASTLEROCK RD S2123 CAUDLE RD S2878 CAVINESS RD S3120 CEDAR CREEK DR S3124 CEDAR DR S2226 CEDAR FALLS RD S2538 CEDAR FOREST RD S2930 CEDAR GROVE DR S2926 CEDAR GROVE RD S2005 CEDAR LN S2373 CEDAR MEADOWS CT S1617 CEDAR POST ST S2385 CEDAR RUN DR S2135 CEDAR SPRINGS RD S1928 CEDAR SQUARE RD S3153 CEDAR TRL S1732 CEDARBERRY RD S1385 CEDARWOOD CT S1115 CENTER CROSS CHURCH RD S2002 CHADWICK DR S2610 CHANEY RD S2001 CHANTERELLE DR S1101 CHAPEL HILL CHURCH RD S1343 CHAPELWOOD RD S2812 CHARLES AVE S1102 CHARLES MTN RD S1637 CHARLIE HARRIS RD S1421 CHARLOTTE CHURCH RD S2082 CHARTIER CT S1392 CHASE RD S2271 CHAUCER TRL S2369 CHEDDINGTON DR S2510 CHEEK RD S2380 CHEROKEE TRL S2286 CHERRYWOOD RD S1749 CHET DR S1749 CHET DR EXT S3147 CHEYENNE CIR S2693 CHILTON RD S2452 CLARENCE YORK RD S2498 CLARK AVE APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-7 of 38 ROAD #ROAD NAME S2124 CLAUDE HOLDEN DR S1664 CLAYTON ST S3283 CLEAR RIDGE DR S2950 CLEARVIEW DR S2714 CLEON ST S2676 CLIFFWOOD DR S1758 CLIFTON DR S2892 CLINT CAVINESS RD S2648 CLIPWOOD RD S1729 CLOVER DR S2843 CLYDE KING RD S1240 COLE MTN RD S1562 COLLETT FARM RD S1640 COLLETTE ST S3122 COLLINS ST S1731 COLONIAL CIR S1840 COLONIAL CLUB DR S1986 COLONIAL LN S1985 COLONIAL LOOP S3151 COLONIAL MANOR DR S2719 COLONIAL RD S2407 COLONIAL TRADING PATH S1803 COLONY LN S2633 COLTRANE MEADOW RD S1921 COLTRANE MILL RD S1563 COLTRANE ST S3102 COMMERCE PL S2652 CONCORD CHURCH RD S1182 CONELSON RD S2542 COOK COLLIER RD S2069 COOPER FARM RD S1131 COPPLES RD S2998 CORDIE DR S1226 CORTEZ RD S1802 COTTAGE LN S2647 COUNTRY FARM RD S2884 COUNTRY LOOP RD S3201 COUNTRY MEADOWS LN S2325 COUNTRY PLACE RD S2516 COUNTRY RIDGE RD S1361 COUNTRY TRL S2267 COUNTY LAND RD S3253 COURTLAND DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-8 of 38 ROAD #ROAD NAME S1857 COURTNEY LN S2296 COVENTRY PL S1406 COVERED BRIDGE RD S2612 COX BROTHERS RD S2554 COX LN S2473 COX MEADOW RD S1115 COX MILL RD S2704 CRAIG ST S1355 CRANBROOK CIR S1354 CRANBROOK WAY S2640 CRAVEN BRANCH RD S2248 CRAVEN DR S1544 CRAVEN PINES RD S3126 CREEK DR S1376 CREEK HILLS DR S2134 CREEKRIDGE CTRY RD S1378 CREEKRIDGE DR S2060 CREEKS CROSSING RD S2340 CREEKSIDE DR S1806 CREEKVIEW DR S2678 CREEKWOOD RD S1820 CRESENT AVE S2213 CRESENT DR S2820 CRESTVIEW CHURCH RD S2484 CRESTWICK RD S1769 CRESTWOOD CTRY CT S1811 CRESTWOOD DR S2708 CRESTWOOD LN S2695 CRISTY CIR S2315 CROATAN TRAIL RD S2381 CROOKED CREEK RD S2817 CROOMCREST RD S1560 CROTTS DR S1196 CROW CREEK RD S2670 CRYSTAL WOOD RD S2539 CURTIS INDUSTRIAL DR S2518 CURTIS LN S2876 CURTIS POWERS RD S2188 DAISY RD S2675 DANIEL RD S1434 DANWOOD ST S1607 DARR RD S2341 DASHWOOD DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-9 of 38 ROAD #ROAD NAME S1517 DAVIDSON RD S1926 DAVIS CTRY RD S1777 DAWN DR S1762 DAWNWOOD DR S1138 DAWSON MILLER RD S2043 DEAN VIEW DR S1568 DEATON RD S2712 DEEP RIVER CHURCH RD S2953 DEER RUN LN S2731 DEERBERRY CT S2100 DEERFIELD CTRY RD S1379 DEERHORN CT S2358 DEERRUN DR S1699 DELWOOD DR S1781 DENISE DR S3251 DESTIN DR S2520 DEVINEY RD S2256 DEWEY RD S1219 DINAH RD S1632 DIXIE PL S2653 DOC HAYWORTH RD S3157 DOGWOOD CIR S2268 DOGWOOD DR S3117 DOGWOOD TRL S2996 DONNA RD S1199 DOUL MTN RD S3008 DRAGONFLY LN S1738 DRIFTWOOD DR S1247 DRUM ST S1171 DUNBAR BRIDGE RD S2316 DUNBAR ST S1448 DUNDEE ST S1884 DWIGHT ST S2045 DYNASTY DR S2182 E ALLRED ST S2345 E PRESNELL ST S1890 E RIVER RUN S2237 E SALISBURY ST S1265 EAGLE CHASE RD S3249 EAGLE LANDING DR S3270 EAGLE NEST CT S2955 EAGLE PASS RD S3269 EAGLE POINT DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-10 of 38 ROAD #ROAD NAME S2659 EARL BROWN RD S1943 EARL JOHNSON RD S1539 EARNHARDT RD S2920 EAST DR S2481 EASTERN RANDOLPH RD S1668 EASTWARD AVE S2940 EASTWOOD DR S1998 EBB SHORE DR S1925 EBENEZER CHURCH RD S1526 EDGAR RD S1209 EDNA ST S2624 EDWARDS FARM RD S2313 EFFIE ST S2919 ELDORADO RD S1106 ELEAZER CHURCH RD S2301 ELK RD S1932 ELMER BEESON RD S1757 ELMONT ST S1656 ELMWOOD ST S2557 EMERALD DR S1325 EMERALD ROCK RD S1129 EMMANUEL CHURCH RD S1756 ENFIELD DR S1489 ENGLEWOOD DR S1003 ERECT RD S1741 ERIK DR S2227 ERNEST RD S1271 ERVIN LN S2274 ESSEX TRL S2258 ETON AVE S2029 ETTA CT S1896 EUGENE ST S3192 EVANS DR S3107 EVERGREEN DR S1566 FAIRVIEW CHURCH RD S1754 FAIRVIEW CT S1751 FAIRVIEW DR S1752 FAIRVIEW DR EXT S2832 FAIRVIEW FARM RD S1753 FAIRVIEW LN S1763 FAIRWOOD DR S1205 FAIRWOOD TRL S3002 FAITH MEADOWS LN APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-11 of 38 ROAD #ROAD NAME S2207 FAITH ROCK RD S2322 FALCON DR S1166 FALLING OAK RD S2280 FARLEY DR S2857 FARLOW CORNER RD S2971 FARLOW LAKE CT S1541 FARLOW MEADOW RD S3194 FARLOW ST S1865 FARMBROOK PL S3304 FARMWOOD LN S1369 FARMER CT S1001 FARMER DENTON RD S2898 FARMSTEAD RD S2051 FEATHERSTONE CT S2651 FELLOWSHIP RD S2479 FERGUSON RD S2250 FERN DR S1808 FERNWOOD DR S2716 FIELDCREST CT S2608 FILLER RD S1547 FINCH FARM RD S1194 FIRE FIGHTER RD S1398 FIRESIDE CT S2886 FLAT CREEK RD S2827 FLETA BROWN RD S1004 FLINT HILL RD S2644 FLIPPIN RD S2425 FLYNT RD S2405 FOLGER RD S3010 FOOTHILLS DR S2244 FOREST DR S2283 FOREST HAVEN DR S1248 FOREST HILLS DR S3116 FOREST LAKE DR S1383 FOREST LN S1899 FOREST MANOR DR S1250 FOREST OAKS DR S2150 FOREST PARK DR S3178 FOREST TRL S2701 FOREST VALLEY DR S1002 FORK CREEK MILL RD S2932 FOSTER ST S2621 FOUSHEE RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-12 of 38 ROAD #ROAD NAME S2961 FOUST DR S2439 FOUST RD S2535 FOX GROVE RD S3175 FOX HUNT CT S1743 FOX MEADOW RD S2117 FOX ST S1239 FOXBURROW RD S1519 FOXFIELD RD S2611 FOXFIRE RD S2222 FOXWORTH RD S2531 FRANK LN S1224 FRANK RD S1225 FRANKIE TRL S2393 FRANKLIN HILLS CT S1923 FRAZIER MARSH RD S2631 FRAZIER RD S2049 FRAZIER VIEW RD S2392 FRED EAST LN S2113 FRED LINEBERRY RD S2994 FREEDOM TRL S1159 FRIENDLY ACRES RD S1213 FRIENDLY CIR S2537 FRIENDLY LN S1404 FULLER MILL RD N S1404 FULLER MILL RD S S3108 GADDY DR S1312 GALLIMORE DAIRY RD S1390 GALLIMORE TOWN RD S1792 GARDENGATE RD S1349 GARNER FARM RD S1302 GARNER LN S1332 GARREN TOWN RD S3140 GATE DR S1708 GEARREN ST S2132 GEORGE YORK RD S2281 GEORGIA DR S2906 GERTRUDE LOOP RD S3132 GIANT OAKS CT S3131 GIANT OAKS DR S2048 GILEAD DR S2218 GILES CHAPEL RD S2522 GILMORE DR S1396 GLADE RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-13 of 38 ROAD #ROAD NAME S2603 GLENN CTRY RD S2688 GLENN DR S2552 GLENN SMITH DR S1697 GLENVIEW DR S2317 GLOVINIA ST S2183 GOLD HILL RD S1317 GOLDEN MEADOW RD S2545 GOLDFIELD RD S2482 GOLDSTON RD S1366 GOPHER WOODS RD S3189 GRA LAN DR S2722 GRACELAND DR S2622 GRACEWOOD RD S1263 GRAHAM DAVIS RD S1172 GRANGE HALL RD S2614 GRANTVILLE LN S1183 GRAVEL HILL RD S2854 GRAVES CTRY RD S2534 GRAVES THOMAS RD S2067 GRAY FARM RD S1403 GRAY ROCK RD N S1403 GRAY ROCK RD S S2447 GRAYS CHAPEL SCHOOL RD S1415 GREEN FARM RD S3183 GREEN GLADE RD S1864 GREEN TREE RD S2601 GREEN VALLEY RD S3240 GREENBROOK RD S2711 GREENBRUSH RD S1363 GREENCASTLE RD S2003 GREENDALE RD S1348 GREENE OAK RD S2310 GREENFOREST RD S2617 GREENHILL RD S1258 GREENLEAF ACRES DR S1871 GREENMONT DR S2963 GREENVIEW DR S1742 GREENWAY DR S2402 GREESON CTRY RD S2105 GREGSON RD S1836 GREY DR S1860 GREY OAKS RD S2556 GRIFFIN DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-14 of 38 ROAD #ROAD NAME S1654 GROVE ST S2382 GUILFORD WAY S1874 GUM TREE RD S1555 GUMWOOD RD S2935 HALIFAX ST S2823 HALL DR S2141 HALL RD S1345 HALTOM RD S1439 HAMILTON ST S1688 HAMMOND RD S2699 HAMPTON CT S1968 HANNER RD S2843 HAPPY HOLLOW RD S2455 HARDIN ELLISON RD S1535 HARDINS FARM RD S1926 HARLOW RD S1492 HARMONY TRL S2404 HAROLD MEADOW RD S1872 HARPER RD S1407 HARRIS RD S1187 HARVELL RD S1266 HARVELL ST S1241 HARVELL ST EXT S2272 HARVEST CIR S1867 HARVEST DR S2137 HAWKSVIEW RD S2819 HAWTHORNE DR S2952 HAYES DR S2726 HAYFIELD DR S2018 HAZELWOOD LN S1511 HEATH DAIRY RD S2033 HEATHER DR S1765 HEATHWOOD DR S1935 HEDGECOCK RD S2215 HENLEY CTRY RD S2700 HENLEY DR S1423 HENRY PARRISH RD S1427 HENRY RD S2011 HERITAGE LN S2050 HERITAGE VIEW LN S2441 HERMAN HUSBAND RD S2894 HERRINGTON CTRY RD S2962 HICKORY DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-15 of 38 ROAD #ROAD NAME S2006 HICKORY WOOD LN S2474 HICKS FARM RD S2061 HIDDEN CT S2302 HIDDEN LN S1358 HIDDEN SPRINGS RD S1143 HIGH PINE CHURCH RD S2422 HIGHFILL ST S1435 HIGHRIDGE ST S2229 HILL TOP HOME RD S2984 HILLARY CT S1779 HILLCREST CT S3111 HILLCREST LN S1844 HILLSDALE PARK DR S1004 HILLSVILLE RD S1606 HILLTOP AVE S2026 HILLTOP DR S1851 HILLVIEW CT S2426 HINSHAW CTRY RD S2656 HINSHAW TOWN RD S2104 HOCKETT CTRY LN S1938 HOCKETT DAIRY RD S2131 HODGE RD S3221 HOFFMAN ST S1529 HOG SLIDE RD S2034 HOHN DAVIS RD S1988 HOLDER INMAN RD S1988 HOLDER INMAN RD EXT S1267 HOLLINGS RD S1646 HOLLINGSWORTH RD S2406 HOLLOW HILL RD S2942 HOLLY DR S2036 HOLLY GROVE CT S2035 HOLLY GROVE DR S2709 HOLLY LEAF RD S1003 HOLLY SPRING RD S2658 HOLLY SPRINGS CHURCH RD S1772 HOLLYRIDGE DR S2293 HONEYSUCKLE RD S1315 HOOVER GROVE RD S3204 HOOVER HILL CT S1408 HOOVER HILL RD S3252 HOPEWELL CHURCH RD S1142 HOPEWELL FRIENDS RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-16 of 38 ROAD #ROAD NAME S1508 HOPEWOOD RD S2979 HORSE MOUNTAIN DR S1135 HOWARD AUMAN RD S2818 HOWARD AVE S1611 HOWARD CIR S2877 HOWARD MILL RD S3257 HUCKLEBERRY LN S1915 HUFF RD S2066 HUGHES FARM RD S1400 HUGHES GROVE RD S1342 HULIN MCDOWELL RD S1351 HUNT DELK RD S1394 HUNT MASTER TRL S1177 HUNT RD S3259 HUNT RIDGE CT S1395 HUNTER CT S3228 HUNTERS RUN S3266 HUNTERS WOODS DR S2109 HUNTING LODGE RD S3258 HUNTINGTON DR S2270 HWY 311 EXT S1261 IDLEBROOK TRL S3264 IDLEWILD DR S3264 IDLEWILD DR EXT S2995 INDEPENDENCE AVE S2672 INDIAN SPRINGS RD S3227 INDIAN TRL S1191 INDUSTRIAL PARK AVE S2292 INGRAM DR S2825 INWOOD RD S2605 IRON MOUNTAIN RD S2609 IRON MOUNTAIN VIEW RD S1951 ISLAND FORD RD S1773 IVEY LN S3009 IVEYDALE DR S2475 J C TEAGUE RD S2475 J C TEAGUE RD EXT S2936 JABO HUSSEY RD S1314 JACKSON CREEK RD S1329 JACKSON RD S2075 JACKSON WAY S1272 JAECO CAUDILL DR S3104 JAMES AVE APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-17 of 38 ROAD #ROAD NAME S1644 JARRELL DR S1411 JARVIS MILLER RD S1160 JASON HOOVER RD S2027 JASPER DR S3149 JENNIFER CT S2305 JENNIFER DR S3248 JENNIFER LYNN DR S2721 JENNIFER VIEW DR S2220 JENNINGS RD S1412 JERICO RD S1885 JERRY ST S2446 JESS HACKETT RD S1540 JESS SMITH RD S1961 JESSE SMALL RD S3238 JILL DR S1338 JIM PIERCE RD S2881 JIMMY COX RD S1737 JOAN DR S2646 JOE BRANSON RD S2891 JOEL JESSUP RD S2463 JOHN MARSH RD S1262 JOHNSON FARM RD S1530 JOHNSON ST S2355 JOHNSTON CT S1735 JONES RD S2616 JONES ST EXT S1539 JORDAN VALLEY RD S3254 JOSH CT S2867 JUGTOWN RD S2502 JULIAN AIRPORT RD S2528 JULIAN ST S1869 KATRINA DR S1783 KAY DR S1800 KAY LYNN DR S2352 KELLY COLTRANE DR S2911 KEMP MILL RD S2986 KEN LEE CT S1868 KENNEDY CT S2671 KENNEDY CTRY DR S1401 KENNEDY FARM RD N S1401 KENNEDY FARM RD S S3106 KENNEDY RD S1414 KERMIT HUNT RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-18 of 38 ROAD #ROAD NAME S2350 KERR DR S2247 KEYSTONE DR S2453 KIDDS MILL RD S1104 KIDDS MTN RD S2630 KILDEE CHURCH RD S2951 KIMBERLY DR S2665 KINDLEY FARM RD S1807 KINDLEY RD S1108 KING MTN RD S2488 KING RD S1123 KING VIEW RD S2277 KINGS RIDGE RD S2449 KINGS WAY RD S1788 KINGSTON CT S1787 KINGSTON RD S2030 KINLEY TRL S2427 KINRO RD S2429 KIRKMAN ST EXT S2872 KISER RD S2503 KIVETT COUNCIL RD S2032 KNOLL DR S1835 KNOLLVIEW DR S3206 KOONCE CT S3161 KOONCE DR S1809 KREAMER DR S1805 KYNWOOD DR S2507 LACKEY RD S3209 LAKE CT S3159 LAKE CTRY DR S1653 LAKE DARR RD S2414 LAKE JUNO RD S1518 LAKE LUCAS RD S1409 LAKE PARK RD S2196 LAKECREST RD S1832 LAKESIDE DR S2208 LAKESIDE PARK RD S1841 LAKEVIEW CT S1313 LAKEWAY RD S1740 LAKEWOOD CIR S1744 LAKEWOOD CT S1745 LAKEWOOD CT EXT S1516 LAMB CTRY RD S1157 LAMBERT DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-19 of 38 ROAD #ROAD NAME S2641 LAMBETH MILL RD S2502 LAMINA LN S2363 LAMPLIGHT DR S1776 LANCER DR S3242 LAND DALE DR S1005 LANES MILL RD S2547 LANGLEY LOOP S2471 LANGLEY RD S1180 LANIER HILL RD S1112 LANIER RD S2370 LANSDOWNE LAKES LN S1856 LANSDOWNE PL S2294 LANSDOWNE RD S2684 LANTERN DR S1846 LANVALE AVE S1375 LARK DR S3003 LASSITER LN S1107 LASSITER MILL RD S2233 LAUGHLIN RD S3202 LAURA CT S2328 LAUREL LN S3231 LAUREN TAYLOR DR S2992 LAWRENCE DR S2351 LAWRENCE FARM LN S2680 LAWRENCE HEIGHTS AVE S3004 LAZELL AVE S3137 LAZY PINE RD S2905 LEACH MEADOW RD S3246 LEAH JUSTINE DR S2858 LEATHER RD S2401 LEDBETTER RD S2937 LEDWELL RD S2626 LEE LAYNE RD S3110 LEESVILLE ST S2814 LEGEND DR S2841 LEO CRANFORD RD S2383 LEONAE DR S2541 LEONARD MEADOW RD S1543 LEVEL PLAINS RD S1446 LEWALLEN RD S2645 LEWIS BROWN RD S1933 LEWIS DAVIS RD S2954 LEWIS THOMAS RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-20 of 38 ROAD #ROAD NAME S1859 LIBBY RD S2417 LIBERTY GROVE RD S3214 LIBERTYS RUN DR S2330 LIBRA PL S1747 LILLY FLOWER RD S1458 LINCOLN AVE S3118 LINDA LN S2948 LINDALE DR S2727 LINNIE CT S2837 LIONS REST RD S1217 LISBON RD S2900 LITTLE BEANE STORE RD S2868 LITTLE BROOK RD S1958 LITTLE FOX RD S1479 LITTLE GATE DR S2145 LITTLE POINT RD S1402 LITTLE UWHARRIE RD S1793 LLOYD ST S1816 LOBLOLLY DR S2690 LOE FALL AVE S1946 LOFLIN DAIRY RD S3279 LOFLIN FARLOW LN S1341 LOFLIN HILL RD S2221 LOFLIN POND RD S2893 LOG CABIN RD S3114 LOIS LN S3179 LONGVIEW AVE S1797 LORD RANDOLPH CIR S2525 LORENE AVE S1179 LOU CRANFORD RD S2481 LOW BRIDGE RD S2916 LOWDERMILK RD S1419 LOWE CTRY RD S2282 LOWE DR S1767 LOWERYWOOD CIR S2604 LUCK RD S2071 LULA RAY RD S3188 LYNN OAKS DR S1784 LYNN VIEW DR S2409 MACEDONIA LOOP RD S2138 MACK LINEBERRY RD S2654 MACON FARM RD S2063 MADDY LN APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-21 of 38 ROAD #ROAD NAME S2725 MADISON CIR S2009 MAGNOLIA LN S2136 MAMIE MAY RD S2871 MANESS RD S1755 MANOR RIDGE DR S2636 MANOR ROCK RD S2977 MANORVIEW RD S2326 MAPLE RIDGE RD S1125 MAPLE SPRINGS RD S2735 MARATHON DR S3168 MARCAL CIR S2288 MARCLIF RD S2462 MARGARET CHAPEL RD S2025 MARKET DR S1527 MARLBORO CHURCH RD S1774 MARLBROOK CT S2536 MARLEY CIR S1993 MARSH CTRY LN S1523 MARSH MTN RD S1257 MARTIN HILL AVE S2189 MARTIN LUTHER KING JR DR S2342 MASON CIR S2013 MAULDIN DR S2337 MAYFLOWER DR S2110 MCCLINTOCK RD S1956 MCCOLLUM ST S2821 MCCRANFORD RD S1373 MCDANIEL DR S1164 MCDANIEL RD S2815 MCDERMOTT ST S1489 MCMASTERS ST S1488 MCNEAL ST S1976 MCNEILL RD S2511 MCQUEEN RD S1750 MEADE DR S3177 MEADOW ACRES LN S3199 MEADOW CT S3198 MEADOW DR S1818 MEADOW LARK LN S2685 MEADOW RD S2869 MEADOWBRANCH RD S1564 MEADOWBROOK DR S1786 MEADOWBROOK VIEW RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-22 of 38 ROAD #ROAD NAME S1768 MEADOWDALE LN S2353 MEADOWLARK CT S3205 MEADOWOOD CT S1170 MECHANIC RD S2703 MEDFIELD CIR S1615 MENDENHALL PL S1610 MENDENHALL RD S1136 MEREDITH CTRY RD S1661 MERLE DR S1827 MEYERS ST S1618 MIDDLE POINT RD S2939 MIDWAY ACRES RD S2828 MILES MOFFITT RD S2657 MILL CREEK RD S3166 MILL POND DR S3165 MILL RACE CT S2122 MILLBORO RD S1545 MILLERS MILL RD S1522 MILLIKAN RD S2279 MILLIKAN WAY S1364 MISTY DR S2895 MOFFITT MILL RD S1321 MOFFITT RD S1208 MONROE AVE S1216 MONTCLAIR CT S1256 MONTEREY RD S1253 MONTLEY VIEW DR S1318 MOORE RD S2265 MORGAN CTRY RD S2312 MORNING GLORY RD S1557 MORRIS RD S2816 MORTON AVE S3200 MOUNTAIN BROOK RD S2083 MOUNTAIN LAKE RD S2730 MOUNTAIN LN S2738 MOUNTAIN OAK VIEW DR S3282 MOUNTAIN VALLEY DR S3119 MOUNTAIN VIEW DR S1866 MOUNTAIN VIEW WAY S1759 MOUNTAINVIEW ST S1542 MT GILEAD CHURCH RD S1111 MT LEBANON RD S1536 MT OLIVE CHURCH RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-23 of 38 ROAD #ROAD NAME S2480 MT OLIVET CHURCH RD S1410 MT SHEPHERD RD S1686 MT SHEPHERD RD EXT S2661 MT TABOR CHURCH RD S1413 MT VIEW CHURCH RD S1922 MUDDY CREEK RD S2495 MULBERRY ACADEMY ST S1249 MURIEL LN S2489 N BRADY ST S1009 N MAIN ST S1455 N MCCRARY ST S1476 N PARK DR S2530 NANCE CTRY DR S2225 NANCE RD S2119 NAOMI RD S2842 NASSAU TRL S2064 NEE NEE LN S1322 NEELY RD S1945 NELSON PARK RD S1537 NELSON RD S2864 NEW CENTER CHURCH RD S1244 NEW CENTURY DR S1121 NEW HOPE CHURCH RD S1181 NEW HOPE RD S2116 NEW SALEM RD S2922 NEWBERN AVE S2339 NIGHTWOOD DR S1825 NOLA ST S1826 NOLA ST EXT S2813 NOLEN AVE S2921 NOLEN AVE EXT S1438 NORMAN ST S2972 NORTH LAKE DR S2978 NORTH POINTE DR S2947 NORTHAMPTON DR S2041 NORTHLAND DR S3196 NORTHMONT DR S2214 NORTHVIEW DR S2938 NUBY PURVIS RD S2632 O H STALEY RD S3229 OAK BROOK CT S3208 OAK BUCKET RD S1893 OAK CT APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-24 of 38 ROAD #ROAD NAME S1175 OAK GROVE CHURCH RD S1895 OAK HAVEN CT S1894 OAK HAVEN DR S1367 OAK HOLLOW DR S1842 OAK KNOLL CT S1683 OAK KNOLL DR S1323 OAK LEAF RD S2910 OAK VIEW LN S1428 OAKGROVE RD S2982 OAKHURST RD S1483 OAKLAND AVE S2533 OAKLAND CHURCH RD S2514 OAKLEY RD S1870 OAKMONT DR S1628 OAKMONT VIEW RD S1861 OAKVIEW DR S1200 OAKWOOD ACRES RD S3185 OAKWOOD CT S1824 OAKWOOD DR S1006 OLD 421 RD S2673 OLD ASHEBORO RD S2904 OLD BACHELOR CREEK RD S1964 OLD BELL RD S2454 OLD BROWER MILL RD S2602 OLD BUFFALO FORD RD S2216 OLD CEDAR FALLS RD S2054 OLD CEDAR SQUARE RD S2107 OLD CLIMAX RD S2634 OLD COLERIDGE RD S1415 OLD COUNTY FARM RD S1513 OLD COURTHOUSE RD S2834 OLD COX RD S1528 OLD EDGAR RD S3152 OLD FARM RD S3255 OLD FARMER RD S1538 OLD FLINT HILL RD S1384 OLD FOREST CT S1571 OLD GLENOLA RD S2115 OLD GREENSBORO RD S1952 OLD HIGH POINT ST S2024 OLD HOCKETT LN S1883 OLD HOPEWELL CHURCH RD S2830 OLD HUMBLE MILL RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-25 of 38 ROAD #ROAD NAME S1004 OLD LEXINGTON RD S2261 OLD LIBERTY RD S1255 OLD MAPLE SPRINGS RD S1858 OLD MARLBORO RD S1881 OLD MEADOWBROOK RD S1616 OLD MENDENHALL RD S1165 OLD MILL RD S2899 OLD MOFFITT RD S1553 OLD MOUNTAIN RD S2845 OLD NC HWY 13 S1193 OLD NC HWY 49 S1305 OLD PLACE RD S1949 OLD PLANK RD S1919 OLD POOLE RD S1400 OLD POST OFFICE RD S2297 OLD PROVIDENCE RD S2403 OLD RED CROSS RD S2016 OLD ROCKETT RD S2642 OLD SILER CITY RD S2077 OLD SPENCER RD S2663 OLD STAGECOACH RD S2470 OLD STALEY RD S1148 OLD STATE HWY S1627 OLD THOMASVILLE RD S1188 OLD TROY RD S1882 OLD TURNPIKE RD S2859 OLD US 220 HWY S1344 OLD US HWY 64 S1186 OLD UWHARRIE RD S1939 OLD WALKER MILL RD S1514 OLD WAY RD S2461 OLIVERS CHAPEL RD S2263 ORLENDO DR S2903 OSBORN MILL RD S1633 OTIS RD S3301 OVERLOOK DR S2983 PAIGE CT S2840 PAINTER RD S1245 PALOMINO DR S2833 PANTHER CREEK RD S3184 PARINNA DR S3184 PARINNA RD S1462 PARK DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-26 of 38 ROAD #ROAD NAME S2710 PARK RD S1316 PARKER MILL RD S3241 PARKER ST S2628 PARKS CROSSRDS CHURCH RD S2415 PARKS PALMER RD S1801 PARKWAY DR S2737 PARKWOOD RD S1815 PARTRIDGE LN S2987 PASTUREVIEW RD S2303 PATRICIA DR S2081 PATRIOT WOODS DR S2491 PATTERSON GROVE RD S2192 PATTON AVE S2391 PEACE FOREST LN S2691 PEACE HAVEN RD S1704 PEACE RD S1484 PEACHTREE ST S1837 PEARL AVE S2374 PEARL CT S2228 PENTECOSTAL CHURCH RD S2532 PEPPERIDGE WAY S1814 PHEASANT RIDGE DR S2148 PHILLIPS RD S2896 PICKETTS MILL RD S3109 PIEDMONT DAIRY RD S2400 PIEDMONT ESTATES RD S2529 PIEDMONT ST S1308 PIERCE MEADOW RD S2464 PIKE FARM RD S1648 PIKE ST S2674 PILOT MOUNTAIN RD S1197 PILOTS VIEW RD S3112 PINE CONE CT S2734 PINE CREEK RDG S2718 PINE CT S2824 PINE HILL RD S2728 PINE LAKES DR S3146 PINE NEEDLE LN S3211 PINE NEEDLES DR S1725 PINE RIDGE DR S2014 PINEBROOK DR S3261 PINEVIEW AVE S1862 PINEVIEW DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-27 of 38 ROAD #ROAD NAME S2004 PINEWOOD DR S2958 PINEWOOD RD S2907 PINEY RIDGE CHURCH RD S1113 PISGAH CHURCH RD S1114 PISGAH COVERED BRIDGE RD S1109 PISGAH RD S1518 PLAINFIELD RD S2057 PLANTERS PL S2224 PLEASANT CROSS RD S2876 PLEASANT GROVE CHURCH RD S2902 PLEASANT HILL RD S1720 PLEASANT LOOP S2618 PLEASANT RIDGE CHURCH RD S1003 PLEASANT RIDGE RD S1336 PLEASANT UNION RD S1533 PLINEY FARLOW RD S2140 PLUM TREE RD S1486 PLUMMER ST S2335 PLYMOUTH DR S2435 POE RD S3271 POINTER LN S2890 POLLYFIELD RD S2715 PONDEROSA HEIGHTS PL S2053 POOLE RD S2055 POOLE RD EXT S1422 POOLE TOWN RD S3160 POPLAR RIDGE RD S1552 POST RD S2860 POTTERS WAY RD S2865 POTTERY RD S1969 PRICE NOBLE RD S1631 PROSPECT CHURCH RD S1619 PROSPECT ST S2114 PROVIDENCE CHURCH RD S2336 PROVIDENCE DR S2320 QUAIL HOLLOW DR S1855 QUAIL WAY S2334 QUAKER DR S1480 QUEENS RD S2278 QUEENS WAY S3156 RACE TRACK RD S2106 RACINE RD S2914 RAINBOW LOOP APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-28 of 38 ROAD #ROAD NAME S2862 RALPH LAWRENCE RD S1716 RAMBLEWOOD RD S2319 RAMBLING RD S2442 RAMSEUR JULIAN RD S2492 RAMSEUR LAKE RD S2669 RAMTEX DR S1110 RANDALL HURLEY RD S1961 RANDLEMAN LAKE RD S1007 RANDLEMAN RD S2443 RANDOLPH CHURCH RD S2527 RANDOLPH MEADOW RD S2217 RANDOLPH TABERNACLE RD S2323 RAVEN CT S2376 RAYLE FARM CT S2375 RAYLE FARM RD S2348 RED BIRD CT S2338 RED CROSS CT S1891 RED FOX RD S3115 RED FOX TRL S2241 RED LANE RD S3007 RED WOLF LN S1561 REDDICK ST S1813 REDDING CT S1812 REDDING CTRY RD S3172 REDDY FOXX LN S1237 REDWOOD DR S2668 REED CREEK RD S1122 REEDER RD S1493 REFLECTION LN S1886 REGALWOOD CT S1887 REGALWOOD DR S1733 REGINA ST S1430 REGISTER ST S1780 RHONDA DR S1377 RICHARDS CIR S1531 RICHARDSON RD S1306 RICHEY RD S2068 RICHFIELDS RD S2418 RICHLAND CHURCH RD S2847 RICHLAND PARK DR S1640 RIDGE DR S2915 RIDGE ST S3187 RIDGE TOP CT APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-29 of 38 ROAD #ROAD NAME S2973 RIDGECREST LN S1331 RIDGES MTN RD S1372 RIDGES MTN TRL S1669 RIDGEVIEW RD S1432 RIDGEWAY CIR S1431 RIDGEWAY DR S3284 RIDGEWORTH CT S2682 RILLA ST S1202 RISING VIEW WAY S3300 RIVER BLUFF DR S2991 RIVER HEIGHTS DR S2039 RIVER MILL RD S2386 RIVEROAKS DR S3186 RIVERSIDE ACRES CT S2873 RIVERSIDE RD S2062 RIVERVIEW CT S1804 RIVERVIEW DR S1940 RIVERWOOD RD ROADID ROAD_NAME S1978 ROB CRUTHIS RD S1333 ROBBINS CIR S1567 ROBBINS CTRY RD S1273 ROBERT WAY S2354 ROBIN LN S2627 ROBY COE RD S2191 ROCK CRUSHER RD S1892 ROCK DAM CT S1506 ROCK QUARRY RD S1429 ROCK SPRING RD S3268 ROCKAWAY DR S1937 ROCKETT RD S1597 ROCKFORD DR S1775 ROCKRIDGE CT S2666 ROCKY KNOLL RD S2943 ROCWOOD DR S2349 ROLLING MEADOWS RD S1853 ROLLINGWOOD CT S1850 ROLLINGWOOD DR S1565 RONNIEDALE RD S1426 ROOSEVELT RD S1212 ROSCOE RD S1353 ROSE GARDEN TRL S1782 ROSEWAY RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-30 of 38 ROAD #ROAD NAME S3127 ROSEWOOD DR S2835 ROSS HARRIS RD S1339 ROSS WOOD RD S1393 ROUNDCLIFF DR S2619 ROUNDLEAF RD S2448 ROUTH RD S1534 ROY FARLOW RD S2332 ROYAL DR S2638 ROYAL RIDGE RD S1833 RUNWAY DR S1335 RUSH MTN RD S1335 RUSH MTN RD EXT S1436 RUSHWOOD RD S1437 RUSSELL ST S2331 RYAN DR S2433 S ALLISON ST S1009 S MAIN ST S1304 SALEM CHURCH RD S2329 SALEM ST S1347 SAM JACKSON RD S2883 SAM LEONARD RD S2459 SANDY CREEK CHURCH RD S2524 SANDY CREEK DR S2550 SANDY RIDGE DR S1992 SARTIN RD S1521 SAWYER RD S1328 SAWYERSVILLE RD S1251 SCALEYBARK LN S1397 SCENIC POINT DR S1163 SCIENCE HILL RD S1130 SCOTT FARM RD S1235 SCOTT MTN RD S2846 SEAGROVE PLANK RD S2850 SEAGROVE PLANK RD EXT S2888 SEARCY RD S2478 SEAYS RD S1560 SECOND HEIGHTS DR S3280 SECOND PARK AVE S2126 SHADY FOREST RD S2472 SHADY GROVE CHURCH RD S2543 SHADY HOLLOW RD S1739 SHADY LAWN CT S1734 SHADYDALE ACRES LN APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-31 of 38 ROAD #ROAD NAME S3176 SHALLOW RIVER DR S3223 SHANNON DR S3222 SHARON ACRES DR S2017 SHARON DALE DR S2304 SHARON LN S2681 SHARRON DR S1380 SHAW ST S3170 SHAWNEE TRL S2307 SHEFFIELD AVE S2444 SHELTON CTRY RD S1210 SHERIDAN DR S3150 SHERRIE DR S1204 SHERWOOD AVE S1651 SHERWOOD FOREST DR S2407 SHILOH RD S2880 SHORT CUT RD S2875 SIDE CHURCH RD S2424 SILK HOPE RD S1520 SILVER SPRINGS RD S2298 SILVERWOOD LN S1346 SKEEN VIEW RD S1550 SKEENS MILL RD S1203 SKYCREST CTRY RD S2127 SKYHAVEN RD S2683 SKYLINE DR S1852 SKYVIEW CT S2946 SLATE AVE S1999 SLEEPY HOLLOW DR S1574 SLICK ROCK MTN RD S1963 SMALL RD S2457 SMITH ADKINS RD S2285 SMOKE WOOD RD S1548 SNYDER CTRY RD S2558 SOAPSTONE DR S2458 SOAPSTONE MTN RD S2692 SOHOMEY DR S1238 SOURWOOD DR S2975 SOUTH CREEK CT S3210 SOUTH CT S2967 SOUTH LAKE DR S1625 SOUTH RD S1719 SOUTHLAND DR S1274 SOUTHMONT DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-32 of 38 ROAD #ROAD NAME S1252 SOUTHMONT HEIGHTS AVE S1145 SOUTHMONT SCHOOL RD S2856 SOUTHROCK ST S2989 SOUTHWOOD DR S2526 SPAINHOUR ST S1228 SPANISH DR S1215 SPANISH LN S3125 SPARKY LN S3169 SPARTA DR S1418 SPENCER MEADOW RD S1929 SPENCER RD S1504 SPERO RD S2664 SPINKS RD S2667 SPOONS CHAPEL CHURCH RD S2606 SPOONS CHAPEL RD S1220 SPRING DR S3155 SPRING FOREST RD S3164 SPRING GARDEN CT S1447 SPRING VALLEY RD S2944 SPRINGDALE DR S2451 SPRINGSIDE RD S1965 ST PETER CHURCH RD S3011 STALEY FAMILY PL S2839 STALEYS FARM RD S1246 STALLION TRL S1984 STANLEY RD S2038 STANTON FARM RD S3191 STANTON RD S3232 STARLETTE LN S2407 STARMOUNT RD S1934 STEED RD S2918 STEELE ST S3173 STEEPLECHASE DR S1689 STEWART ST S2295 STONE HAVEN DR S3133 STONE RIDGE DR S1362 STONECREST CT S3275 STONEHENGE PL S3274 STONESIDE CIR S2623 STOUT ACRES RD S2698 STRATFORD WAY S1114 STRIEBY CHURCH RD S1326 STUTTS RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-33 of 38 ROAD #ROAD NAME S2394 SUBSTATION RD S2058 SUGAR CANE LN S1917 SUITS RD S2287 SUMMERSET RD S1848 SUMMERVILLE DR S1340 SUMMEY TOWN RD S1546 SUMNER RD S3001 SUNBEAM CT S1243 SUNBURST RD S3250 SUNDANCE TRL S1229 SUNNY LN S3113 SUNSET KNOLL DR S1679 SUNSET VIEW DR S1679 SUNSET VIEW DR EXT S1184 SURRATT CTRY RD S1595 SURRETT DR S2306 SURRIE TRL S2318 SUSSEX TRL S1635 SWEETBRIAR RD S2008 SYCAMORE DR S2687 SYLVAN DR S3129 SYLVAN TRL S3225 SYLVAN WAY S1405 TABERNACLE CHURCH RD S1311 TABERNACLE CHURCH RD EXT S1382 TABERNACLE SCHOOL RD S3130 TALL CEDAR LN S2840 TALL PINE ST S3239 TALLWOOD DR S2686 TANGLEWOOD LN S2360 TAYLOR WOODS LN S1368 TAYLORS CREEK DR S2925 TEACHEY SCHOOL DR S2487 TEMPLE VIEW RD S1259 TERESA WAY S1549 THAYER RD S2195 THOMAS ST S1620 THOMPSON RD S2483 THORNBROOK RD S1350 THORNBURG RD S1254 THOROUGHBRED RD S1425 THREE B RD S1989 TIGERS DEN RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-34 of 38 ROAD #ROAD NAME S2974 TIMBER LEA LN S1310 TIP TOP RD S2245 TIPPETT RD S1532 TOBACCO RD S1924 TOM BALL RD S2240 TOM BROWN RD S1570 TOM HILL RD S2655 TOMMY COX RD S1173 TOMS CREEK RD S3103 TONY DR S1515 TORY LN S1163 TOT HILL FARM RD S2501 TOWN CTRY RD S1494 TRANQUIL LN S1795 TREE HOLLOW EXT S1794 TREE HOLLOW RD S1606 TRINITY BLVD S2870 TRINITY CHURCH RD S1600 TRINITY COLLEGE RD S1831 TRINITY CT S1748 TRINITY HIGH SCHOOL DR S1004 TRINITY RD S2713 TROGDON HILL RD S1918 TROTTER CTRY RD S1169 TROTTER RD S2639 TROY CAVENESS RD S2434 TROY ESTATE RD S2409 TROY SMITH RD S1512 TURNER DAIRY RD S2519 TURNER LAKE RD S1399 TURNING OAKS TRL S1558 TURNPIKE RD S1920 TUTTLE RD S2249 TWAIN DR S2976 TWIN CREEK RD S1764 TWINWOOD CT S1766 TWINWOOD DR S2981 ULAH CT S2513 UNDERWOOD RD S1163 UNION CHURCH RD S2863 UNION GROVE CHURCH RD S1547 UNITY ST S1987 US HWY 220 BUS N APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-35 of 38 ROAD #ROAD NAME S1009 US HWY 311 S1612 UWHARRIE RD S2689 VALEWOOD DR S1791 VALLEY CIR S2356 VALLEY DALE LN S1845 VALLEY DR S1301 VALLEY FARM RD S1746 VALLEY FORGE DR S1211 VALLEY GROVE RD S1849 VALLEY RIDGE DR S3121 VALLEY RIDGE DR EXT S1790 VALLEY VIEW RD S1207 VANCROFT ST S1337 VARNER RD S2476 VAUGHN YORK RD S2010 VERMONT DR S1149 VETERANS LOOP RD S2078 VIEWMONT CT S1875 VIEWMONT DR S3167 VILLA DR S1567 VILLAGE DR S2015 VIOLET RIDGE RD S1147 VIRGIL HILL RD S3181 VIRGINIA CT S2269 VISION DR S2706 VISTA PKWY S2706 VISTA PKWY EXT S1103 VOLUNTEER RESCUE RD S1502 W BALFOUR AVE S2128 W O W RD S1889 W RIVER RUN S2874 WADDELLS FERRY RD S3207 WAGON WHEEL RD S3123 WAGONER RD S2372 WAKETA DR S2931 WALDEN RD S1236 WALKER CIR S1365 WALKER DR S1936 WALKER MILL RD S1231 WALKER RD S2142 WALKER STORE RD S1941 WALL BROTHERS RD S2436 WALL RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-36 of 38 ROAD #ROAD NAME S3000 WALNUT CREEK LN S2964 WALNUT DR S2314 WALNUT RIDGE RD S1962 WALTER MEADOWS RD S2908 WAYNE RD S2108 WAYNE WHITE RD S1174 WAYNICK MEADOW RD S1916 WEANT RD S1761 WEDGEWOOD TER S2469 WEEDEN ST S2365 WEEPING WILLOW CT S1556 WELBORN RD S3276 WELLINGTON PL S2275 WELLS LN S1630 WESLEYAN RD S1128 WEST EDGEWOOD CIR S3101 WEST LAKE DR S1352 WESTBURY DR S1424 WESTCHAPEL RD S1637 WESTFIELD CHURCH RD S2257 WESTMINSTER DR S3220 WESTOVER TER S3255 WESTSIDE CIR S3148 WESTWIND WAY S1233 WESTWOOD AVE S1195 WESTWOOD DR S3203 WHEATMORE CT S1877 WHIPPOORWILL DR S1132 WHITAKER RD S2042 WHITE LN S3262 WHITE OAK ST S2555 WHITE POPLAR ST S2456 WHITES CHAPEL RD S2141 WHITES MEMORIAL RD S3260 WHITETAIL DR S2103 WHITT HUNT RD S2144 WICKER LOVELL RD S2732 WILDFLOWER CT WILDLIFE WAY S2343 WILDWOOD LN S3256 WILDWOOD RD S1185 WILKES SNIDER RD S1942 WILL COLTRANE RD APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-37 of 38 ROAD #ROAD NAME S2438 WILLARD RD S1232 WILLIAM DR S3215 WILLIAM HENLEY PL S2064 WILLIAM LEE PL S2559 WILLIAMS CTRY RD S2450 WILLIAMS DAIRY RD S1133 WILLIAMS FARM RD S2662 WILLIE WRIGHT RD S2993 WILLOW DOWNS CT S2389 WILLOW HILL CT S2264 WILLOW LAKE RD S2388 WILLOW MEADOWS DR S2364 WILLOW SPRINGS DR S1839 WILLOW WOOD RD S1234 WILSON LN S1461 WILSON ST S1560 WILSON VIEW DR S2736 WINCHESTER HEIGHTS DR S1997 WINCREST DR S1726 WINDEMERE CIR S2733 WINDFLOWER LN S1360 WINDING WOODS LN S3134 WINDRIDGE CT S2259 WINDSOR DR S2308 WINDSOR TRL S1268 WOOD BLUFF TRL S3230 WOOD VILLAGE DR S3277 WOODALE CT S2945 WOODALE DR S3278 WOODALE FOREST LN S2928 WOODCREST DR S2065 WOODCREST RD S1819 WOODCREST ST S2909 WOODFERN RD S3163 WOODFIELD CT S3162 WOODFIELD DR S2720 WOODGLO DR S2997 WOODHAVEN DR S2324 WOODLAND TRL S1381 WOODLANE CT S2186 WOODLAWN ST S1799 WOODLYN WAY S2548 WOODMONT DR APPENDIX D-I: STATE ROAD INDEX SORTED BY NAME Revised: 5/25/2022 Appendix D I-38 of 38 ROAD #ROAD NAME S2012 WOODOAK TRL S2333 WOODRIDGE DR S1314 WOODS DAIRY RD S2729 WOODS STREAM LN S2378 WOODSTREAM RD S2515 WOODVERY DR S2122 WORTHVILLE RD S2477 WRIGHT CTRY RD S1554 WRIGHT RD S1388 YESTEROAKS CT S2410 YORK MARTIN RD S2371 YORKMONT CT S2613 YOUNG RD S1701 YOUTH CAMP RD S1685 ZELMA BLVD S2468 ZION CHURCH RD S3006 ZOO PKWY APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-1 of 38 ROAD #ROAD NAME S1001 FARMER DENTON RD S1002 BENNETT RD S1002 FORK CREEK MILL RD S1003 ERECT RD S1003 HOLLY SPRING RD S1003 PLEASANT RIDGE RD S1004 ARCHDALE RD S1004 CARAWAY MTN RD S1004 FLINT HILL RD S1004 HILLSVILLE RD S1004 OLD LEXINGTON RD S1004 TRINITY RD S1005 LANES MILL RD S1006 OLD 421 RD S1007 RANDLEMAN RD S1009 N MAIN ST S1009 S MAIN ST S1009 US HWY 311 S1100 BELLS GROVE RD S1101 CHAPEL HILL CHURCH RD S1102 CHARLES MTN RD S1103 VOLUNTEER RESCUE RD S1104 KIDDS MTN RD S1105 BURNEY MILL RD S1106 ELEAZER CHURCH RD S1107 LASSITER MILL RD S1108 KING MTN RD S1109 PISGAH RD S1110 RANDALL HURLEY RD S1111 MT LEBANON RD S1112 ABNER RD S1112 LANIER RD S1113 PISGAH CHURCH RD S1114 PISGAH COVERED BRIDGE RD S1114 STRIEBY CHURCH RD S1115 CENTER CROSS CHURCH RD S1115 COX MILL RD S1117 BEANE CTRY RD S1118 BETHEL LUCAS RD S1120 APPLE TREE RD S1121 NEW HOPE CHURCH RD S1122 REEDER RD S1123 KING VIEW RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-2 of 38 ROAD #ROAD NAME S1124 BOROUGH AVE S1125 MAPLE SPRINGS RD S1127 BURNEY RD S1128 WEST EDGEWOOD CIR S1129 EMMANUEL CHURCH RD S1130 SCOTT FARM RD S1131 COPPLES RD S1132 WHITAKER RD S1133 WILLIAMS FARM RD S1135 HOWARD AUMAN RD S1136 MEREDITH CTRY RD S1138 DAWSON MILLER RD S1139 BONDURANT RD S1140 BAILEY RD S1141 CALLICUTT HENLEY RD S1142 HOPEWELL FRIENDS RD S1143 HIGH PINE CHURCH RD S1145 SOUTHMONT SCHOOL RD S1146 BELL SIMMONS RD S1147 VIRGIL HILL RD S1148 OLD STATE HWY S1149 VETERANS LOOP RD S1157 LAMBERT DR S1159 FRIENDLY ACRES RD S1160 BILLY WALKER RD S1160 JASON HOOVER RD S1161 ASHWORTH RD S1163 SCIENCE HILL RD S1163 TOT HILL FARM RD S1163 UNION CHURCH RD S1164 MCDANIEL RD S1165 OLD MILL RD S1166 FALLING OAK RD S1167 BESSIE BELL RD S1168 BINGHAM LOFLIN RD S1169 TROTTER RD S1170 MECHANIC RD S1171 DUNBAR BRIDGE RD S1172 GRANGE HALL RD S1173 TOMS CREEK RD S1174 WAYNICK MEADOW RD S1175 OAK GROVE CHURCH RD S1176 BURRELL ALLEN RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-3 of 38 ROAD #ROAD NAME S1177 HUNT RD S1178 BOMBAY SCHOOL RD S1179 LOU CRANFORD RD S1180 LANIER HILL RD S1181 NEW HOPE RD S1182 CONELSON RD S1183 GRAVEL HILL RD S1184 SURRATT CTRY RD S1185 WILKES SNIDER RD S1186 OLD UWHARRIE RD S1187 HARVELL RD S1188 OLD TROY RD S1191 INDUSTRIAL PARK AVE S1193 OLD NC HWY 49 S1194 FIRE FIGHTER RD S1195 WESTWOOD DR S1196 CROW CREEK RD S1197 PILOTS VIEW RD S1199 DOUL MTN RD S1200 OAKWOOD ACRES RD S1202 RISING VIEW WAY S1203 SKYCREST CTRY RD S1204 SHERWOOD AVE S1205 FAIRWOOD TRL S1206 CANNON HEIGHTS DR S1207 VANCROFT ST S1208 MONROE AVE S1209 EDNA ST S1210 SHERIDAN DR S1211 VALLEY GROVE RD S1212 ROSCOE RD S1213 FRIENDLY CIR S1214 BRILES DR S1215 SPANISH LN S1216 MONTCLAIR CT S1217 LISBON RD S1219 DINAH RD S1220 SPRING DR S1221 CARDINAL ST S1222 ARABIAN DR S1223 APPALOOSA TRL S1224 FRANK RD S1225 FRANKIE TRL APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-4 of 38 ROAD #ROAD NAME S1226 CORTEZ RD S1227 BONITA LN S1228 SPANISH DR S1229 SUNNY LN S1230 ARMADILLO DR S1231 WALKER RD S1232 WILLIAM DR S1233 WESTWOOD AVE S1234 WILSON LN S1235 SCOTT MTN RD S1236 WALKER CIR S1237 REDWOOD DR S1238 SOURWOOD DR S1239 FOXBURROW RD S1240 COLE MTN RD S1241 HARVELL ST EXT S1242 BONITA ST S1243 SUNBURST RD S1244 NEW CENTURY DR S1245 PALOMINO DR S1246 STALLION TRL S1247 DRUM ST S1248 FOREST HILLS DR S1249 MURIEL LN S1250 FOREST OAKS DR S1251 SCALEYBARK LN S1252 SOUTHMONT HEIGHTS AVE S1253 MONTLEY VIEW DR S1254 THOROUGHBRED RD S1255 OLD MAPLE SPRINGS RD S1256 MONTEREY RD S1257 MARTIN HILL AVE S1258 GREENLEAF ACRES DR S1259 TERESA WAY S1261 IDLEBROOK TRL S1262 JOHNSON FARM RD S1263 GRAHAM DAVIS RD S1265 EAGLE CHASE RD S1266 HARVELL ST S1267 HOLLINGS RD S1268 WOOD BLUFF TRL S1269 CAROWOOD DR S1270 BETTY MCGEE DR APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-5 of 38 ROAD #ROAD NAME S1271 ERVIN LN S1272 JAECO CAUDILL DR S1273 ROBERT WAY S1274 SOUTHMONT DR S1301 VALLEY FARM RD S1302 GARNER LN S1303 BRANTLEY GORDON RD S1304 SALEM CHURCH RD S1305 OLD PLACE RD S1306 RICHEY RD S1307 CANAAN CHURCH RD S1308 PIERCE MEADOW RD S1310 TIP TOP RD S1311 BESCHER CHAPEL RD S1311 TABERNACLE CHURCH RD EXT S1312 GALLIMORE DAIRY RD S1313 LAKEWAY RD S1314 JACKSON CREEK RD S1314 WOODS DAIRY RD S1315 HOOVER GROVE RD S1316 PARKER MILL RD S1317 GOLDEN MEADOW RD S1318 MOORE RD S1319 BEN LAMBETH RD S1320 CABLE CREEK RD S1321 MOFFITT RD S1322 NEELY RD S1323 OAK LEAF RD S1325 EMERALD ROCK RD S1326 STUTTS RD S1327 BACK CREEK CHURCH RD S1328 SAWYERSVILLE RD S1329 JACKSON RD S1330 ASTEROID RD S1331 RIDGES MTN RD S1332 GARREN TOWN RD S1333 ROBBINS CIR S1335 RUSH MTN RD S1335 RUSH MTN RD EXT S1336 PLEASANT UNION RD S1337 VARNER RD S1338 JIM PIERCE RD S1339 ROSS WOOD RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-6 of 38 ROAD #ROAD NAME S1340 SUMMEY TOWN RD S1341 LOFLIN HILL RD S1342 HULIN MCDOWELL RD S1343 CHAPELWOOD RD S1344 OLD US HWY 64 S1345 HALTOM RD S1346 SKEEN VIEW RD S1347 SAM JACKSON RD S1348 GREENE OAK RD S1349 GARNER FARM RD S1350 THORNBURG RD S1351 HUNT DELK RD S1352 WESTBURY DR S1353 ROSE GARDEN TRL S1354 CRANBROOK WAY S1355 CRANBROOK CIR S1357 BRILES MEADOW RD S1358 HIDDEN SPRINGS RD S1359 BRANCHWATER RD S1360 WINDING WOODS LN S1361 COUNTRY TRL S1362 STONECREST CT S1363 GREENCASTLE RD S1364 MISTY DR S1365 WALKER DR S1366 GOPHER WOODS RD S1367 OAK HOLLOW DR S1368 TAYLORS CREEK DR S1369 FARMER CT S1370 BRANCHVIEW WAY S1372 RIDGES MTN TRL S1373 MCDANIEL DR S1374 BACK CREEK TER S1375 LARK DR S1376 CREEK HILLS DR S1377 RICHARDS CIR S1378 CREEKRIDGE DR S1379 DEERHORN CT S1380 SHAW ST S1381 WOODLANE CT S1382 TABERNACLE SCHOOL RD S1383 FOREST LN S1384 OLD FOREST CT APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-7 of 38 ROAD #ROAD NAME S1385 CEDARWOOD CT S1386 ARROWSTONE DR S1387 BEECHWOOD CT S1388 YESTEROAKS CT S1389 BROOKSIDE CT S1390 GALLIMORE TOWN RD S1392 CHASE RD S1393 ROUNDCLIFF DR S1394 HUNT MASTER TRL S1395 HUNTER CT S1396 GLADE RD S1397 SCENIC POINT DR S1398 FIRESIDE CT S1399 TURNING OAKS TRL S1400 HUGHES GROVE RD S1400 OLD POST OFFICE RD S1401 KENNEDY FARM RD N S1401 KENNEDY FARM RD S S1402 LITTLE UWHARRIE RD S1403 GRAY ROCK RD N S1403 GRAY ROCK RD S S1404 FULLER MILL RD N S1404 FULLER MILL RD S S1405 TABERNACLE CHURCH RD S1406 COVERED BRIDGE RD S1407 HARRIS RD S1408 HOOVER HILL RD S1409 LAKE PARK RD S1410 MT SHEPHERD RD S1411 JARVIS MILLER RD S1412 JERICO RD S1413 MT VIEW CHURCH RD S1414 KERMIT HUNT RD S1415 GREEN FARM RD S1415 OLD COUNTY FARM RD S1418 SPENCER MEADOW RD S1419 LOWE CTRY RD S1420 BACK CREEK RD S1421 CHARLOTTE CHURCH RD S1422 POOLE TOWN RD S1423 HENRY PARRISH RD S1424 WESTCHAPEL RD S1425 THREE B RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-8 of 38 ROAD #ROAD NAME S1426 ROOSEVELT RD S1427 HENRY RD S1428 OAKGROVE RD S1429 ROCK SPRING RD S1430 REGISTER ST S1431 RIDGEWAY DR S1432 RIDGEWAY CIR S1433 BUNTING RD S1434 DANWOOD ST S1435 HIGHRIDGE ST S1436 RUSHWOOD RD S1437 RUSSELL ST S1438 NORMAN ST S1439 HAMILTON ST S1446 LEWALLEN RD S1447 SPRING VALLEY RD S1448 DUNDEE ST S1450 BROOKWAY RD S1455 N MCCRARY ST S1458 LINCOLN AVE S1461 WILSON ST S1462 PARK DR S1476 N PARK DR S1479 LITTLE GATE DR S1480 QUEENS RD S1483 OAKLAND AVE S1484 PEACHTREE ST S1486 PLUMMER ST S1488 MCNEAL ST S1489 ENGLEWOOD DR S1489 MCMASTERS ST S1492 HARMONY TRL S1493 REFLECTION LN S1494 TRANQUIL LN S1502 W BALFOUR AVE S1504 SPERO RD S1506 ROCK QUARRY RD S1508 HOPEWOOD RD S1511 HEATH DAIRY RD S1512 TURNER DAIRY RD S1513 OLD COURTHOUSE RD S1514 OLD WAY RD S1515 TORY LN APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-9 of 38 ROAD #ROAD NAME S1516 LAMB CTRY RD S1517 DAVIDSON RD S1518 LAKE LUCAS RD S1518 PLAINFIELD RD S1519 FOXFIELD RD S1520 SILVER SPRINGS RD S1521 SAWYER RD S1522 MILLIKAN RD S1523 MARSH MTN RD S1524 BECKERDITE RD S1525 BEESON FARM RD S1526 EDGAR RD S1527 MARLBORO CHURCH RD S1528 OLD EDGAR RD S1529 HOG SLIDE RD S1530 JOHNSON ST S1531 RICHARDSON RD S1532 TOBACCO RD S1533 PLINEY FARLOW RD S1534 ROY FARLOW RD S1535 HARDINS FARM RD S1536 MT OLIVE CHURCH RD S1537 NELSON RD S1538 OLD FLINT HILL RD S1539 EARNHARDT RD S1539 JORDAN VALLEY RD S1540 JESS SMITH RD S1541 FARLOW MEADOW RD S1542 MT GILEAD CHURCH RD S1543 LEVEL PLAINS RD S1544 CRAVEN PINES RD S1545 MILLERS MILL RD S1546 SUMNER RD S1547 FINCH FARM RD S1547 UNITY ST S1548 SNYDER CTRY RD S1549 THAYER RD S1550 SKEENS MILL RD S1552 POST RD S1553 OLD MOUNTAIN RD S1554 WRIGHT RD S1555 GUMWOOD RD S1556 WELBORN RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-10 of 38 ROAD #ROAD NAME S1557 MORRIS RD S1558 TURNPIKE RD S1560 CROTTS DR S1560 SECOND HEIGHTS DR S1560 WILSON VIEW DR S1561 REDDICK ST S1562 COLLETT FARM RD S1563 COLTRANE ST S1564 MEADOWBROOK DR S1565 RONNIEDALE RD S1566 FAIRVIEW CHURCH RD S1567 ROBBINS CTRY RD S1567 VILLAGE DR S1568 DEATON RD S1570 TOM HILL RD S1571 OLD GLENOLA RD S1574 SLICK ROCK MTN RD S1595 SURRETT DR S1597 ROCKFORD DR S1600 TRINITY COLLEGE RD S1606 BROOKDALE DR S1606 HILLTOP AVE S1606 TRINITY BLVD S1607 DARR RD S1610 MENDENHALL RD S1611 HOWARD CIR S1612 UWHARRIE RD S1615 MENDENHALL PL S1616 OLD MENDENHALL RD S1617 CEDAR POST ST S1618 MIDDLE POINT RD S1619 PROSPECT ST S1620 THOMPSON RD S1621 BETHEL DR S1624 BOLIVAR AVE S1625 SOUTH RD S1626 ARTISAN AVE S1627 OLD THOMASVILLE RD S1628 OAKMONT VIEW RD S1630 WESLEYAN RD S1631 PROSPECT CHURCH RD S1632 DIXIE PL S1633 OTIS RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-11 of 38 ROAD #ROAD NAME S1634 CARRIAGE WAY RD S1635 SWEETBRIAR RD S1636 CASHATT RD S1637 CHARLIE HARRIS RD S1637 WESTFIELD CHURCH RD S1640 COLLETTE ST S1640 RIDGE DR S1643 BLUEBERRY CT S1644 JARRELL DR S1646 HOLLINGSWORTH RD S1648 PIKE ST S1651 SHERWOOD FOREST DR S1653 LAKE DARR RD S1654 ALFORD ST S1654 GROVE ST S1656 ELMWOOD ST S1661 MERLE DR S1663 AUCTION RD S1664 CLAYTON ST S1665 ALBERTSON RD S1668 EASTWARD AVE S1669 RIDGEVIEW RD S1679 SUNSET VIEW DR S1679 SUNSET VIEW DR EXT S1683 OAK KNOLL DR S1685 ZELMA BLVD S1686 MT SHEPHERD RD EXT S1688 HAMMOND RD S1689 STEWART ST S1697 GLENVIEW DR S1698 BUNDY DR S1699 DELWOOD DR S1701 YOUTH CAMP RD S1704 PEACE RD S1708 GEARREN ST S1713 ALBEMARLE RD S1716 RAMBLEWOOD RD S1719 SOUTHLAND DR S1720 PLEASANT LOOP S1725 PINE RIDGE DR S1726 WINDEMERE CIR S1727 ARBOR DR S1729 CLOVER DR APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-12 of 38 ROAD #ROAD NAME S1730 CARAWAY TRL S1731 COLONIAL CIR S1732 CEDARBERRY RD S1733 REGINA ST S1734 SHADYDALE ACRES LN S1735 JONES RD S1736 CARSON RD S1737 JOAN DR S1738 DRIFTWOOD DR S1739 SHADY LAWN CT S1740 LAKEWOOD CIR S1741 ERIK DR S1742 GREENWAY DR S1743 FOX MEADOW RD S1744 LAKEWOOD CT S1745 LAKEWOOD CT EXT S1746 VALLEY FORGE DR S1747 LILLY FLOWER RD S1748 TRINITY HIGH SCHOOL DR S1749 CHET DR S1749 CHET DR EXT S1750 MEADE DR S1751 FAIRVIEW DR S1752 FAIRVIEW DR EXT S1753 FAIRVIEW LN S1754 FAIRVIEW CT S1755 MANOR RIDGE DR S1756 ENFIELD DR S1757 ELMONT ST S1758 CLIFTON DR S1759 MOUNTAINVIEW ST S1760 BROKEN OAK RD S1761 WEDGEWOOD TER S1762 DAWNWOOD DR S1763 FAIRWOOD DR S1764 TWINWOOD CT S1765 HEATHWOOD DR S1766 TWINWOOD DR S1767 LOWERYWOOD CIR S1768 MEADOWDALE LN S1769 CRESTWOOD CTRY CT S1770 ALLWOOD DR S1772 HOLLYRIDGE DR APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-13 of 38 ROAD #ROAD NAME S1773 IVEY LN S1774 MARLBROOK CT S1775 ROCKRIDGE CT S1776 LANCER DR S1777 DAWN DR S1778 BEAUMONT DR S1779 HILLCREST CT S1780 RHONDA DR S1781 DENISE DR S1782 ROSEWAY RD S1783 KAY DR S1784 LYNN VIEW DR S1785 ARDEN RD S1786 MEADOWBROOK VIEW RD S1787 KINGSTON RD S1788 KINGSTON CT S1789 BRIARCLIFF RD S1790 VALLEY VIEW RD S1791 VALLEY CIR S1792 GARDENGATE RD S1793 LLOYD ST S1794 TREE HOLLOW RD S1795 TREE HOLLOW EXT S1797 LORD RANDOLPH CIR S1799 WOODLYN WAY S1800 KAY LYNN DR S1801 PARKWAY DR S1802 COTTAGE LN S1803 COLONY LN S1804 RIVERVIEW DR S1805 KYNWOOD DR S1806 CREEKVIEW DR S1807 KINDLEY RD S1808 FERNWOOD DR S1809 KREAMER DR S1810 ARNETTE DR S1811 CRESTWOOD DR S1812 REDDING CTRY RD S1813 REDDING CT S1814 PHEASANT RIDGE DR S1815 PARTRIDGE LN S1816 LOBLOLLY DR S1818 MEADOW LARK LN APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-14 of 38 ROAD #ROAD NAME S1819 WOODCREST ST S1820 CRESENT AVE S1821 AZALEA LN S1823 ALPINE DR S1824 OAKWOOD DR S1825 NOLA ST S1826 NOLA ST EXT S1827 MEYERS ST S1828 BROOK ST S1829 BROOK CIR S1831 TRINITY CT S1832 LAKESIDE DR S1833 RUNWAY DR S1834 CAROLE DR S1835 KNOLLVIEW DR S1836 GREY DR S1837 PEARL AVE S1838 CARLTON DR S1839 WILLOW WOOD RD S1840 COLONIAL CLUB DR S1841 LAKEVIEW CT S1842 OAK KNOLL CT S1843 CAMERON CIR S1844 HILLSDALE PARK DR S1845 VALLEY DR S1846 LANVALE AVE S1847 CALVERT ST S1848 SUMMERVILLE DR S1849 VALLEY RIDGE DR S1850 ROLLINGWOOD DR S1851 HILLVIEW CT S1852 SKYVIEW CT S1853 ROLLINGWOOD CT S1855 QUAIL WAY S1856 LANSDOWNE PL S1857 COURTNEY LN S1858 OLD MARLBORO RD S1859 LIBBY RD S1860 GREY OAKS RD S1861 OAKVIEW DR S1862 PINEVIEW DR S1863 BEECH CIR S1864 GREEN TREE RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-15 of 38 ROAD #ROAD NAME S1865 FARMBROOK PL S1866 MOUNTAIN VIEW WAY S1867 HARVEST DR S1868 KENNEDY CT S1869 KATRINA DR S1870 OAKMONT DR S1871 GREENMONT DR S1872 HARPER RD S1873 BACK CREEK CT S1874 GUM TREE RD S1875 VIEWMONT DR S1876 BERKLEY LN S1877 WHIPPOORWILL DR S1880 CAIN CT S1881 OLD MEADOWBROOK RD S1882 OLD TURNPIKE RD S1883 OLD HOPEWELL CHURCH RD S1884 DWIGHT ST S1885 JERRY ST S1886 REGALWOOD CT S1887 REGALWOOD DR S1888 BROKAW DR S1889 W RIVER RUN S1890 E RIVER RUN S1891 RED FOX RD S1892 ROCK DAM CT S1893 OAK CT S1894 OAK HAVEN DR S1895 OAK HAVEN CT S1896 EUGENE ST S1897 ALAMO DR S1898 ALAMO CT S1899 FOREST MANOR DR S1912 ALDRIDGE RD S1915 HUFF RD S1916 WEANT RD S1917 SUITS RD S1918 TROTTER CTRY RD S1919 OLD POOLE RD S1920 TUTTLE RD S1921 COLTRANE MILL RD S1922 MUDDY CREEK RD S1923 FRAZIER MARSH RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-16 of 38 ROAD #ROAD NAME S1924 TOM BALL RD S1925 EBENEZER CHURCH RD S1926 DAVIS CTRY RD S1926 HARLOW RD S1928 CEDAR SQUARE RD S1929 SPENCER RD S1931 BANNER WHITEHEAD RD S1932 ELMER BEESON RD S1933 LEWIS DAVIS RD S1934 STEED RD S1935 HEDGECOCK RD S1936 ADAMS FARM RD S1936 WALKER MILL RD S1937 ROCKETT RD S1938 HOCKETT DAIRY RD S1939 OLD WALKER MILL RD S1940 RIVERWOOD RD S1941 WALL BROTHERS RD S1942 WILL COLTRANE RD S1943 EARL JOHNSON RD S1944 BRANSON DAVIS RD S1945 NELSON PARK RD S1946 LOFLIN DAIRY RD S1949 OLD PLANK RD S1951 ISLAND FORD RD S1952 OLD HIGH POINT ST S1953 BROWN LOOP S1954 BOWMAN AVE S1956 MCCOLLUM ST S1958 LITTLE FOX RD S1961 JESSE SMALL RD S1961 RANDLEMAN LAKE RD S1962 WALTER MEADOWS RD S1963 SMALL RD S1964 OLD BELL RD S1965 ST PETER CHURCH RD S1968 HANNER RD S1969 PRICE NOBLE RD S1976 MCNEILL RD S1978 ROB CRUTHIS RD S1983 CANTER LN S1984 STANLEY RD S1985 COLONIAL LOOP APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-17 of 38 ROAD #ROAD NAME S1986 COLONIAL LN S1987 US HWY 220 BUS N S1988 HOLDER INMAN RD S1988 HOLDER INMAN RD EXT S1989 TIGERS DEN RD S1992 SARTIN RD S1993 MARSH CTRY LN S1995 ASHBROOK CIR S1997 WINCREST DR S1998 EBB SHORE DR S1999 SLEEPY HOLLOW DR S2001 CHANTERELLE DR S2002 CHADWICK DR S2003 GREENDALE RD S2004 PINEWOOD DR S2005 CEDAR LN S2006 HICKORY WOOD LN S2007 BIRCH DR S2008 SYCAMORE DR S2009 MAGNOLIA LN S2010 VERMONT DR S2011 HERITAGE LN S2012 WOODOAK TRL S2013 MAULDIN DR S2014 PINEBROOK DR S2015 VIOLET RIDGE RD S2016 OLD ROCKETT RD S2017 SHARON DALE DR S2018 HAZELWOOD LN S2024 OLD HOCKETT LN S2025 MARKET DR S2026 HILLTOP DR S2027 JASPER DR S2028 ALLEN DR S2029 ETTA CT S2030 KINLEY TRL S2031 BEECH TREE CT S2032 KNOLL DR S2033 HEATHER DR S2034 HOHN DAVIS RD S2035 HOLLY GROVE DR S2036 HOLLY GROVE CT S2038 STANTON FARM RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-18 of 38 ROAD #ROAD NAME S2039 RIVER MILL RD S2041 NORTHLAND DR S2042 WHITE LN S2043 DEAN VIEW DR S2045 DYNASTY DR S2046 BRIDGE POINT DR S2047 BEESON CT S2048 GILEAD DR S2049 FRAZIER VIEW RD S2050 HERITAGE VIEW LN S2051 FEATHERSTONE CT S2053 POOLE RD S2054 OLD CEDAR SQUARE RD S2055 POOLE RD EXT S2056 BETHEL DR EXT S2057 PLANTERS PL S2058 SUGAR CANE LN S2059 CALVARY WAY S2060 CREEKS CROSSING RD S2061 HIDDEN CT S2062 RIVERVIEW CT S2063 MADDY LN S2064 NEE NEE LN S2064 WILLIAM LEE PL S2065 WOODCREST RD S2066 HUGHES FARM RD S2067 GRAY FARM RD S2068 RICHFIELDS RD S2069 COOPER FARM RD S2070 BUCK LN S2071 LULA RAY RD S2072 BROOKWOOD ACRES DR S2075 JACKSON WAY S2077 OLD SPENCER RD S2078 VIEWMONT CT S2081 PATRIOT WOODS DR S2082 CHARTIER CT S2083 MOUNTAIN LAKE RD S2100 DEERFIELD CTRY RD S2101 BRANSON MILL RD S2102 BANTAM RD S2103 WHITT HUNT RD S2104 HOCKETT CTRY LN APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-19 of 38 ROAD #ROAD NAME S2105 GREGSON RD S2106 RACINE RD S2107 OLD CLIMAX RD S2108 WAYNE WHITE RD S2109 HUNTING LODGE RD S2110 MCCLINTOCK RD S2111 BULL RUN CREEK RD S2112 BETHEL CHURCH RD S2113 FRED LINEBERRY RD S2114 PROVIDENCE CHURCH RD S2115 OLD GREENSBORO RD S2116 NEW SALEM RD S2117 FOX ST S2118 BROWN OAKS RD S2119 NAOMI RD S2120 CAMP NAWAKA RD S2121 BEAVERCREEK RD S2122 MILLBORO RD S2122 WORTHVILLE RD S2123 CAUDLE RD S2124 BALDWIN DR S2124 CLAUDE HOLDEN DR S2125 BOWERS LN S2126 SHADY FOREST RD S2127 SKYHAVEN RD S2128 W O W RD S2131 HODGE RD S2132 BETHANY CHURCH RD S2132 BRUCE PUGH RD S2132 GEORGE YORK RD S2133 APPLEWOOD RD S2134 CREEKRIDGE CTRY RD S2135 CEDAR SPRINGS RD S2136 MAMIE MAY RD S2137 HAWKSVIEW RD S2138 MACK LINEBERRY RD S2140 PLUM TREE RD S2141 HALL RD S2141 WHITES MEMORIAL RD S2142 WALKER STORE RD S2143 CARL ALLRED RD S2144 WICKER LOVELL RD S2145 LITTLE POINT RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-20 of 38 ROAD #ROAD NAME S2148 PHILLIPS RD S2150 FOREST PARK DR S2182 E ALLRED ST S2183 GOLD HILL RD S2186 WOODLAWN ST S2187 BOOKER T WASHINGTON AVE S2188 DAISY RD S2189 MARTIN LUTHER KING JR DR S2191 ROCK CRUSHER RD S2192 PATTON AVE S2193 CALLICUT ST S2195 THOMAS ST S2196 LAKECREST RD S2207 FAITH ROCK RD S2208 LAKESIDE PARK RD S2213 CRESENT DR S2214 NORTHVIEW DR S2215 HENLEY CTRY RD S2216 OLD CEDAR FALLS RD S2217 RANDOLPH TABERNACLE RD S2218 GILES CHAPEL RD S2219 BARKWOOD RD S2220 JENNINGS RD S2221 LOFLIN POND RD S2222 FOXWORTH RD S2223 BOB KIVETT RD S2224 PLEASANT CROSS RD S2225 NANCE RD S2226 CEDAR FALLS RD S2227 ERNEST RD S2228 PENTECOSTAL CHURCH RD S2229 HILL TOP HOME RD S2230 BERRY LN S2233 LAUGHLIN RD S2235 ANDREW HUNTER RD S2237 E SALISBURY ST S2240 TOM BROWN RD S2241 RED LANE RD S2244 FOREST DR S2245 TIPPETT RD S2246 BROOKWOOD DR S2247 KEYSTONE DR S2248 CRAVEN DR APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-21 of 38 ROAD #ROAD NAME S2249 TWAIN DR S2250 FERN DR S2256 DEWEY RD S2257 WESTMINSTER DR S2258 ETON AVE S2259 WINDSOR DR S2261 OLD LIBERTY RD S2263 ORLENDO DR S2264 WILLOW LAKE RD S2265 MORGAN CTRY RD S2267 COUNTY LAND RD S2268 DOGWOOD DR S2269 VISION DR S2270 HWY 311 EXT S2271 CHAUCER TRL S2272 HARVEST CIR S2273 BRITTANY TRL S2274 ESSEX TRL S2275 WELLS LN S2276 BRISTOL LN S2277 KINGS RIDGE RD S2278 QUEENS WAY S2279 MILLIKAN WAY S2280 FARLEY DR S2281 GEORGIA DR S2282 LOWE DR S2283 FOREST HAVEN DR S2284 ARCADIA RD S2285 SMOKE WOOD RD S2286 CHERRYWOOD RD S2287 SUMMERSET RD S2288 MARCLIF RD S2289 CAMELOT DR S2290 ALLRED WAY S2292 INGRAM DR S2293 HONEYSUCKLE RD S2294 LANSDOWNE RD S2295 STONE HAVEN DR S2296 COVENTRY PL S2297 OLD PROVIDENCE RD S2298 SILVERWOOD LN S2300 CASTLEROCK RD S2301 ELK RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-22 of 38 ROAD #ROAD NAME S2302 HIDDEN LN S2303 PATRICIA DR S2304 SHARON LN S2305 JENNIFER DR S2306 SURRIE TRL S2307 SHEFFIELD AVE S2308 WINDSOR TRL S2310 GREENFOREST RD S2312 MORNING GLORY RD S2313 EFFIE ST S2314 WALNUT RIDGE RD S2315 CROATAN TRAIL RD S2316 DUNBAR ST S2317 GLOVINIA ST S2318 SUSSEX TRL S2319 RAMBLING RD S2320 QUAIL HOLLOW DR S2321 BLUE RIDGE RD S2322 FALCON DR S2323 RAVEN CT S2324 WOODLAND TRL S2325 COUNTRY PLACE RD S2326 MAPLE RIDGE RD S2328 LAUREL LN S2329 SALEM ST S2330 LIBRA PL S2331 RYAN DR S2332 ROYAL DR S2333 WOODRIDGE DR S2334 QUAKER DR S2335 PLYMOUTH DR S2336 PROVIDENCE DR S2337 MAYFLOWER DR S2338 RED CROSS CT S2339 NIGHTWOOD DR S2340 CREEKSIDE DR S2341 DASHWOOD DR S2342 MASON CIR S2343 WILDWOOD LN S2345 E PRESNELL ST S2348 RED BIRD CT S2349 ROLLING MEADOWS RD S2350 KERR DR APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-23 of 38 ROAD #ROAD NAME S2351 LAWRENCE FARM LN S2352 KELLY COLTRANE DR S2353 MEADOWLARK CT S2354 ROBIN LN S2355 JOHNSTON CT S2356 VALLEY DALE LN S2357 BEECH TREE PL S2358 DEERRUN DR S2359 BARKER DR S2360 TAYLOR WOODS LN S2363 LAMPLIGHT DR S2364 WILLOW SPRINGS DR S2365 WEEPING WILLOW CT S2366 CARRIAGE CROSSING DR S2367 CAMDEN CT S2368 BRIAROAK DR S2369 CHEDDINGTON DR S2370 LANSDOWNE LAKES LN S2371 YORKMONT CT S2372 WAKETA DR S2373 CEDAR MEADOWS CT S2374 PEARL CT S2375 RAYLE FARM RD S2376 RAYLE FARM CT S2377 BRECKENWOOD CT S2378 WOODSTREAM RD S2380 CHEROKEE TRL S2381 CROOKED CREEK RD S2382 GUILFORD WAY S2383 LEONAE DR S2384 BROOKDALE RD S2385 CEDAR RUN DR S2386 RIVEROAKS DR S2387 ATLAS DR S2388 WILLOW MEADOWS DR S2389 WILLOW HILL CT S2391 PEACE FOREST LN S2392 FRED EAST LN S2393 FRANKLIN HILLS CT S2394 SUBSTATION RD S2400 PIEDMONT ESTATES RD S2401 LEDBETTER RD S2402 GREESON CTRY RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-24 of 38 ROAD #ROAD NAME S2403 OLD RED CROSS RD S2404 HAROLD MEADOW RD S2405 FOLGER RD S2406 HOLLOW HILL RD S2407 COLONIAL TRADING PATH S2407 SHILOH RD S2407 STARMOUNT RD S2408 BROWNS MEADOW RD S2409 MACEDONIA LOOP RD S2409 TROY SMITH RD S2410 YORK MARTIN RD S2411 BUNTON SWAIM RD S2412 BULB RD S2413 BOWMAN DAIRY RD S2414 LAKE JUNO RD S2415 PARKS PALMER RD S2417 LIBERTY GROVE RD S2418 RICHLAND CHURCH RD S2419 BUTLER RD S2422 HIGHFILL ST S2424 SILK HOPE RD S2425 FLYNT RD S2426 HINSHAW CTRY RD S2427 KINRO RD S2429 KIRKMAN ST EXT S2433 S ALLISON ST S2434 TROY ESTATE RD S2435 POE RD S2436 WALL RD S2437 BUMPAS RD S2438 WILLARD RD S2439 FOUST RD S2440 BROWER MEADOW RD S2441 HERMAN HUSBAND RD S2442 RAMSEUR JULIAN RD S2443 RANDOLPH CHURCH RD S2444 SHELTON CTRY RD S2445 BENNY LINEBERRY RD S2446 JESS HACKETT RD S2447 GRAYS CHAPEL SCHOOL RD S2448 ROUTH RD S2449 KINGS WAY RD S2450 WILLIAMS DAIRY RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-25 of 38 ROAD #ROAD NAME S2451 SPRINGSIDE RD S2452 CLARENCE YORK RD S2453 KIDDS MILL RD S2454 OLD BROWER MILL RD S2455 HARDIN ELLISON RD S2456 WHITES CHAPEL RD S2457 SMITH ADKINS RD S2458 SOAPSTONE MTN RD S2459 SANDY CREEK CHURCH RD S2460 BROOKSDALE RD S2461 OLIVERS CHAPEL RD S2462 MARGARET CHAPEL RD S2463 JOHN MARSH RD S2464 PIKE FARM RD S2468 ZION CHURCH RD S2469 BROWNS CROSSROADS RD S2469 WEEDEN ST S2470 OLD STALEY RD S2471 LANGLEY RD S2472 SHADY GROVE CHURCH RD S2473 COX MEADOW RD S2474 HICKS FARM RD S2475 J C TEAGUE RD S2475 J C TEAGUE RD EXT S2476 VAUGHN YORK RD S2477 WRIGHT CTRY RD S2478 SEAYS RD S2479 FERGUSON RD S2480 MT OLIVET CHURCH RD S2481 EASTERN RANDOLPH RD S2481 LOW BRIDGE RD S2482 GOLDSTON RD S2483 THORNBROOK RD S2484 CRESTWICK RD S2486 ARROW HEAD RD S2487 TEMPLE VIEW RD S2488 KING RD S2489 BRADY ST EXT S2489 N BRADY ST S2491 PATTERSON GROVE RD S2492 RAMSEUR LAKE RD S2495 ACADEMY ST S2495 MULBERRY ACADEMY ST APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-26 of 38 ROAD #ROAD NAME S2498 CLARK AVE S2499 BUTLERS CHAPEL RD S2500 ACADEMY RD EXT S2501 TOWN CTRY RD S2502 JULIAN AIRPORT RD S2502 LAMINA LN S2503 KIVETT COUNCIL RD S2507 LACKEY RD S2510 CHEEK RD S2511 MCQUEEN RD S2513 UNDERWOOD RD S2514 OAKLEY RD S2515 WOODVERY DR S2516 COUNTRY RIDGE RD S2517 BURROW RD S2518 CURTIS LN S2519 TURNER LAKE RD S2520 DEVINEY RD S2522 GILMORE DR S2523 CALHOUN DR S2524 SANDY CREEK DR S2525 LORENE AVE S2526 SPAINHOUR ST S2527 RANDOLPH MEADOW RD S2528 JULIAN ST S2529 PIEDMONT ST S2530 NANCE CTRY DR S2531 FRANK LN S2532 PEPPERIDGE WAY S2533 OAKLAND CHURCH RD S2534 GRAVES THOMAS RD S2535 FOX GROVE RD S2536 MARLEY CIR S2537 FRIENDLY LN S2538 CEDAR FOREST RD S2539 CURTIS INDUSTRIAL DR S2540 BENT OAK AVE S2541 LEONARD MEADOW RD S2542 COOK COLLIER RD S2543 SHADY HOLLOW RD S2545 GOLDFIELD RD S2547 LANGLEY LOOP S2548 WOODMONT DR APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-27 of 38 ROAD #ROAD NAME S2549 BRINTON PL S2550 SANDY RIDGE DR S2552 GLENN SMITH DR S2553 C C SQUARE RD S2554 COX LN S2555 WHITE POPLAR ST S2556 GRIFFIN DR S2557 EMERALD DR S2558 SOAPSTONE DR S2559 WILLIAMS CTRY RD S2600 BRIARCLIFF DR S2601 GREEN VALLEY RD S2602 OLD BUFFALO FORD RD S2603 GLENN CTRY RD S2604 LUCK RD S2605 IRON MOUNTAIN RD S2606 SPOONS CHAPEL RD S2607 BUFFALO FORD RD S2608 FILLER RD S2609 IRON MOUNTAIN VIEW RD S2610 CHANEY RD S2611 FOXFIRE RD S2612 COX BROTHERS RD S2613 YOUNG RD S2614 GRANTVILLE LN S2615 BROOKLYN AVE EXT S2616 JONES ST EXT S2617 GREENHILL RD S2618 PLEASANT RIDGE CHURCH RD S2619 ROUNDLEAF RD S2621 FOUSHEE RD S2622 GRACEWOOD RD S2623 STOUT ACRES RD S2624 EDWARDS FARM RD S2625 CANOY FARM RD S2626 LEE LAYNE RD S2627 ROBY COE RD S2628 PARKS CROSSRDS CHURCH RD S2629 BURGESS KIVETT RD S2630 KILDEE CHURCH RD S2631 FRAZIER RD S2632 O H STALEY RD S2633 COLTRANE MEADOW RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-28 of 38 ROAD #ROAD NAME S2634 OLD COLERIDGE RD S2635 BROWERDALE RD S2636 MANOR ROCK RD S2638 ROYAL RIDGE RD S2639 TROY CAVENESS RD S2640 CRAVEN BRANCH RD S2641 LAMBETH MILL RD S2642 OLD SILER CITY RD S2643 BRUSH CREEK RD S2644 FLIPPIN RD S2645 LEWIS BROWN RD S2646 JOE BRANSON RD S2647 COUNTRY FARM RD S2648 CLIPWOOD RD S2651 FELLOWSHIP RD S2652 CONCORD CHURCH RD S2653 DOC HAYWORTH RD S2654 MACON FARM RD S2655 TOMMY COX RD S2656 HINSHAW TOWN RD S2657 MILL CREEK RD S2658 HOLLY SPRINGS CHURCH RD S2659 EARL BROWN RD S2660 BETHEL FRIENDS RD S2661 MT TABOR CHURCH RD S2662 WILLIE WRIGHT RD S2663 OLD STAGECOACH RD S2664 SPINKS RD S2665 KINDLEY FARM RD S2666 ROCKY KNOLL RD S2667 SPOONS CHAPEL CHURCH RD S2668 REED CREEK RD S2669 RAMTEX DR S2670 CRYSTAL WOOD RD S2671 KENNEDY CTRY DR S2672 INDIAN SPRINGS RD S2673 OLD ASHEBORO RD S2674 PILOT MOUNTAIN RD S2675 DANIEL RD S2676 CLIFFWOOD DR S2678 CREEKWOOD RD S2680 LAWRENCE HEIGHTS AVE S2681 SHARRON DR APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-29 of 38 ROAD #ROAD NAME S2682 RILLA ST S2683 SKYLINE DR S2684 LANTERN DR S2685 MEADOW RD S2686 TANGLEWOOD LN S2687 SYLVAN DR S2688 GLENN DR S2689 VALEWOOD DR S2690 LOE FALL AVE S2691 PEACE HAVEN RD S2692 SOHOMEY DR S2693 CHILTON RD S2695 CRISTY CIR S2696 CANTERBURY TRL S2697 CARRIAGE LN S2698 STRATFORD WAY S2699 HAMPTON CT S2700 HENLEY DR S2701 FOREST VALLEY DR S2702 ARLINGTON DR S2702 ARLINGTON DR EXT S2703 MEDFIELD CIR S2704 CRAIG ST S2705 BALSAM ST S2706 VISTA PKWY S2706 VISTA PKWY EXT S2707 BEANE ST S2708 CRESTWOOD LN S2709 HOLLY LEAF RD S2710 PARK RD S2711 GREENBRUSH RD S2712 DEEP RIVER CHURCH RD S2713 TROGDON HILL RD S2714 CLEON ST S2715 PONDEROSA HEIGHTS PL S2716 FIELDCREST CT S2718 PINE CT S2719 COLONIAL RD S2720 WOODGLO DR S2721 JENNIFER VIEW DR S2722 GRACELAND DR S2723 BURGESS FARM DR S2724 BROWNSTONE HILLS DR APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-30 of 38 ROAD #ROAD NAME S2725 MADISON CIR S2726 HAYFIELD DR S2727 LINNIE CT S2728 PINE LAKES DR S2729 WOODS STREAM LN S2730 MOUNTAIN LN S2731 DEERBERRY CT S2732 WILDFLOWER CT S2733 WINDFLOWER LN S2734 PINE CREEK RDG S2735 MARATHON DR S2736 WINCHESTER HEIGHTS DR S2737 PARKWOOD RD S2738 MOUNTAIN OAK VIEW DR S2810 BROOK DR S2811 BOYD AVE S2812 CHARLES AVE S2813 NOLEN AVE S2814 LEGEND DR S2815 MCDERMOTT ST S2816 BRAY BLVD S2816 MORTON AVE S2817 CROOMCREST RD S2818 HOWARD AVE S2819 HAWTHORNE DR S2820 CRESTVIEW CHURCH RD S2821 MCCRANFORD RD S2823 HALL DR S2824 PINE HILL RD S2825 INWOOD RD S2826 BROWERS CHAPEL RD S2827 FLETA BROWN RD S2828 MILES MOFFITT RD S2830 OLD HUMBLE MILL RD S2832 CANE MILL RD S2832 FAIRVIEW FARM RD S2833 PANTHER CREEK RD S2834 OLD COX RD S2835 ROSS HARRIS RD S2836 ARCHIE NEWSOM RD S2837 LIONS REST RD S2839 STALEYS FARM RD S2840 PAINTER RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-31 of 38 ROAD #ROAD NAME S2840 TALL PINE ST S2841 LEO CRANFORD RD S2842 NASSAU TRL S2843 CLYDE KING RD S2843 HAPPY HOLLOW RD S2844 AUMAN CLAY RD S2845 OLD NC HWY 13 S2846 SEAGROVE PLANK RD S2847 RICHLAND PARK DR S2848 BENNETT FARM RD S2849 BACHELOR CREEK RD S2850 SEAGROVE PLANK RD EXT S2854 GRAVES CTRY RD S2855 BOYD DR S2856 SOUTHROCK ST S2857 FARLOW CORNER RD S2858 LEATHER RD S2859 OLD US 220 HWY S2860 POTTERS WAY RD S2861 CAGLE LOOP RD S2862 RALPH LAWRENCE RD S2863 UNION GROVE CHURCH RD S2864 NEW CENTER CHURCH RD S2865 POTTERY RD S2866 BROWER MILL RD S2867 JUGTOWN RD S2868 LITTLE BROOK RD S2869 MEADOWBRANCH RD S2870 TRINITY CHURCH RD S2871 MANESS RD S2872 KISER RD S2873 RIVERSIDE RD S2874 WADDELLS FERRY RD S2875 SIDE CHURCH RD S2876 CURTIS POWERS RD S2876 PLEASANT GROVE CHURCH RD S2877 HOWARD MILL RD S2878 CAVINESS RD S2879 BEULAH CHURCH RD S2880 SHORT CUT RD S2881 JIMMY COX RD S2882 CARL COX RD S2883 SAM LEONARD RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-32 of 38 ROAD #ROAD NAME S2884 COUNTRY LOOP RD S2885 CARL BRADY RD S2886 FLAT CREEK RD S2887 ANTIOCH CHURCH RD S2888 SEARCY RD S2889 BENT RIDGE RD S2890 POLLYFIELD RD S2891 JOEL JESSUP RD S2892 CLINT CAVINESS RD S2893 LOG CABIN RD S2894 HERRINGTON CTRY RD S2895 MOFFITT MILL RD S2896 PICKETTS MILL RD S2898 FARMSTEAD RD S2899 OLD MOFFITT RD S2900 LITTLE BEANE STORE RD S2902 PLEASANT HILL RD S2903 OSBORN MILL RD S2904 OLD BACHELOR CREEK RD S2905 LEACH MEADOW RD S2906 GERTRUDE LOOP RD S2907 PINEY RIDGE CHURCH RD S2908 WAYNE RD S2909 WOODFERN RD S2910 OAK VIEW LN S2911 KEMP MILL RD S2913 AUMAN AVE S2914 RAINBOW LOOP S2915 RIDGE ST S2916 LOWDERMILK RD S2917 ANCHOR DR S2918 STEELE ST S2919 ELDORADO RD S2920 EAST DR S2921 NOLEN AVE EXT S2922 NEWBERN AVE S2925 TEACHEY SCHOOL DR S2926 CEDAR GROVE RD S2928 WOODCREST DR S2930 CEDAR GROVE DR S2931 WALDEN RD S2932 FOSTER ST S2934 APRIL LN APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-33 of 38 ROAD #ROAD NAME S2935 HALIFAX ST S2936 JABO HUSSEY RD S2937 LEDWELL RD S2938 NUBY PURVIS RD S2939 MIDWAY ACRES RD S2940 EASTWOOD DR S2941 BROWNMIRE DR S2942 HOLLY DR S2943 ROCWOOD DR S2944 SPRINGDALE DR S2945 WOODALE DR S2946 SLATE AVE S2947 NORTHAMPTON DR S2948 LINDALE DR S2949 ANTHONY CT S2950 CLEARVIEW DR S2951 KIMBERLY DR S2952 HAYES DR S2953 DEER RUN LN S2954 LEWIS THOMAS RD S2955 EAGLE PASS RD S2958 PINEWOOD RD S2961 FOUST DR S2962 HICKORY DR S2963 GREENVIEW DR S2964 WALNUT DR S2967 SOUTH LAKE DR S2971 FARLOW LAKE CT S2972 NORTH LAKE DR S2973 RIDGECREST LN S2974 TIMBER LEA LN S2975 SOUTH CREEK CT S2976 TWIN CREEK RD S2977 MANORVIEW RD S2978 NORTH POINTE DR S2979 HORSE MOUNTAIN DR S2981 ULAH CT S2982 OAKHURST RD S2983 PAIGE CT S2984 HILLARY CT S2985 BRANTLEY DR S2986 KEN LEE CT S2987 PASTUREVIEW RD APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-34 of 38 ROAD #ROAD NAME S2988 ALEXANDER CT S2989 SOUTHWOOD DR S2990 AUTUMN LN S2991 RIVER HEIGHTS DR S2992 LAWRENCE DR S2993 WILLOW DOWNS CT S2994 FREEDOM TRL S2995 INDEPENDENCE AVE S2996 DONNA RD S2997 WOODHAVEN DR S2998 CORDIE DR S3000 WALNUT CREEK LN S3001 SUNBEAM CT S3002 FAITH MEADOWS LN S3003 LASSITER LN S3004 LAZELL AVE S3006 ZOO PKWY S3007 RED WOLF LN S3008 DRAGONFLY LN S3009 IVEYDALE DR S3010 FOOTHILLS DR S3011 STALEY FAMILY PL S3012 BRAY BLVD S3101 WEST LAKE DR S3102 COMMERCE PL S3103 TONY DR S3104 JAMES AVE S3105 BRAD RD S3106 KENNEDY RD S3107 EVERGREEN DR S3108 GADDY DR S3109 PIEDMONT DAIRY RD S3110 LEESVILLE ST S3111 HILLCREST LN S3112 PINE CONE CT S3113 SUNSET KNOLL DR S3114 LOIS LN S3115 RED FOX TRL S3116 FOREST LAKE DR S3117 DOGWOOD TRL S3118 LINDA LN S3119 MOUNTAIN VIEW DR S3120 CEDAR CREEK DR APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-35 of 38 ROAD #ROAD NAME S3121 VALLEY RIDGE DR EXT S3122 COLLINS ST S3123 WAGONER RD S3124 CEDAR DR S3125 SPARKY LN S3126 CREEK DR S3127 ROSEWOOD DR S3129 SYLVAN TRL S3130 TALL CEDAR LN S3131 GIANT OAKS DR S3132 GIANT OAKS CT S3133 STONE RIDGE DR S3134 WINDRIDGE CT S3135 CAMERON DR S3136 APPLEGATE LN S3137 LAZY PINE RD S3140 GATE DR S3143 CARAWAY DR S3144 BENTON RD S3145 CASSADY RD S3146 PINE NEEDLE LN S3147 CHEYENNE CIR S3148 WESTWIND WAY S3149 JENNIFER CT S3150 SHERRIE DR S3151 COLONIAL MANOR DR S3152 OLD FARM RD S3153 CEDAR TRL S3155 SPRING FOREST RD S3156 RACE TRACK RD S3157 DOGWOOD CIR S3158 AKINS ST S3159 LAKE CTRY DR S3160 POPLAR RIDGE RD S3161 KOONCE DR S3162 WOODFIELD DR S3163 WOODFIELD CT S3164 SPRING GARDEN CT S3165 MILL RACE CT S3166 MILL POND DR S3167 VILLA DR S3168 MARCAL CIR S3169 SPARTA DR APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-36 of 38 ROAD #ROAD NAME S3170 SHAWNEE TRL S3171 BREVARD DR S3172 REDDY FOXX LN S3173 STEEPLECHASE DR S3174 BRIAR PATCH LN S3175 FOX HUNT CT S3176 SHALLOW RIVER DR S3177 MEADOW ACRES LN S3178 FOREST TRL S3179 LONGVIEW AVE S3181 VIRGINIA CT S3183 GREEN GLADE RD S3184 PARINNA DR S3184 PARINNA RD S3185 OAKWOOD CT S3186 RIVERSIDE ACRES CT S3187 RIDGE TOP CT S3188 LYNN OAKS DR S3189 GRA LAN DR S3190 BERKLEY PL S3191 STANTON RD S3192 EVANS DR S3193 ASHETON DR S3194 FARLOW ST S3196 NORTHMONT DR S3198 MEADOW DR S3199 MEADOW CT S3200 MOUNTAIN BROOK RD S3201 COUNTRY MEADOWS LN S3202 LAURA CT S3203 WHEATMORE CT S3204 HOOVER HILL CT S3205 MEADOWOOD CT S3206 KOONCE CT S3207 WAGON WHEEL RD S3208 OAK BUCKET RD S3209 LAKE CT S3210 SOUTH CT S3211 PINE NEEDLES DR S3212 ALBERTSON VIEW ST S3214 LIBERTYS RUN DR S3215 WILLIAM HENLEY PL S3220 WESTOVER TER APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-37 of 38 ROAD #ROAD NAME S3221 HOFFMAN ST S3222 SHARON ACRES DR S3223 SHANNON DR S3225 SYLVAN WAY S3226 BLUEBIRD LN S3227 INDIAN TRL S3228 HUNTERS RUN S3229 OAK BROOK CT S3230 WOOD VILLAGE DR S3231 LAUREN TAYLOR DR S3232 STARLETTE LN S3238 JILL DR S3239 TALLWOOD DR S3240 GREENBROOK RD S3241 PARKER ST S3242 LAND DALE DR S3243 BYRD LN S3244 BETSY LN S3245 ABIGAIL DR S3246 LEAH JUSTINE DR S3248 JENNIFER LYNN DR S3249 EAGLE LANDING DR S3250 SUNDANCE TRL S3251 DESTIN DR S3252 HOPEWELL CHURCH RD S3253 COURTLAND DR S3254 JOSH CT S3255 OLD FARMER RD S3255 WESTSIDE CIR S3256 WILDWOOD RD S3257 HUCKLEBERRY LN S3258 HUNTINGTON DR S3259 HUNT RIDGE CT S3260 WHITETAIL DR S3261 PINEVIEW AVE S3262 WHITE OAK ST S3264 IDLEWILD DR S3264 IDLEWILD DR EXT S3266 HUNTERS WOODS DR S3268 ROCKAWAY DR S3269 EAGLE POINT DR S3270 EAGLE NEST CT S3271 POINTER LN APPENDIX D-II: STATE ROAD INDEX SORTED BY ROAD NUMBER Revised: 5/25/2022 Appendix D II-38 of 38 ROAD #ROAD NAME S3272 ALLRED HEIGHTS DR S3274 STONESIDE CIR S3275 STONEHENGE PL S3276 WELLINGTON PL S3277 WOODALE CT S3278 WOODALE FOREST LN S3279 LOFLIN FARLOW LN S3280 SECOND PARK AVE S3281 BROOKSHIRE CT S3282 MOUNTAIN VALLEY DR S3283 CLEAR RIDGE DR S3284 RIDGEWORTH CT S3300 RIVER BLUFF DR S3301 OVERLOOK DR S3304 FARMWOOD LN APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-1 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7741395 ABBY LN 27205 PRIVATE DRIVE 3,664.13 S3245 ABIGAIL DR 27370 STATE ROAD 2,038.49 S1112 ABNER RD 27205 STATE ROAD 10,151.69 S1112 ABNER RD 27371 STATE ROAD 6,111.45 S2500 ACADEMY RD EXT 27248 STATE ROAD 6,897.23 C0003001 ACADEMY ST 27248 CITY STREET 4,237.73 S2495 ACADEMY ST 27248 STATE ROAD 1,248.20 C0006001 ACCESS RD 27317 CITY STREET 187.05 P7776546 ACORN DR 27317 PRIVATE DRIVE 2,891.15 P7782496 ACORN RDG 27248 PRIVATE DRIVE 3,106.16 P7767388 ACTS TEMPLE DR 27317 PRIVATE DRIVE 628.25 S1936 ADAMS FARM RD 27317 STATE ROAD 17,050.71 P7767385 ADAMS RD 27317 PRIVATE DRIVE 2,294.64 P7767386 ADAMS RD EXT 27317 PRIVATE DRIVE 406.78 P7776543 ADAMS WAY 27317 PRIVATE DRIVE 1,594.01 C0005062 ADMIRAL DR 27316 CITY STREET 400.08 P7778543 AILEEN DR 27313 PRIVATE DRIVE 1,373.13 S3158 AKINS ST 27205 STATE ROAD 816.17 O9999 ALAMANCE LINE DR 27298 OUT OF COUNTY 701.05 S1898 ALAMO CT 27370 STATE ROAD 325.11 S1897 ALAMO DR 27370 STATE ROAD 2,067.80 S1713 ALBEMARLE RD 27203 STATE ROAD 3,881.22 S1713 ALBEMARLE RD 27205 STATE ROAD 1,629.01 P7791143 ALBERT MARTIN RD 27248 PRIVATE DRIVE 1,290.80 P7707521 ALBERTSON FARM RD 27370 PRIVATE DRIVE 2,963.46 S1665 ALBERTSON RD 27263 STATE ROAD 1,789.23 P6798157 ALBERTSON RD EXT 27263 PRIVATE DRIVE 840.59 S3212 ALBERTSON VIEW ST 27370 STATE ROAD 373.76 C0002001 ALDRIDGE RD 27263 CITY STREET 6,314.60 S1912 ALDRIDGE RD 27263 STATE ROAD 703.46 S2988 ALEXANDER CT 27205 STATE ROAD 635.11 P7717546 ALEXANDRIA DR 27370 PRIVATE DRIVE 1,703.22 S1654 ALFORD ST 27370 STATE ROAD 801.18 C0002184 ALISON LN 27263 CITY STREET 1,665.27 P7639445 ALLEN CT 27205 PRIVATE DRIVE 1,792.29 S2028 ALLEN DR 27350 STATE ROAD 2,021.78 P7774310 ALLEN VESTAL RD 27317 PRIVATE DRIVE 1,728.72 C0002244 ALLENDALE DR 27263 CITY STREET 2,927.38 P7791144 ALLIE LN 27248 PRIVATE DRIVE 2,564.26 P8726458 ALLISON ST EXT 27298 PRIVATE DRIVE 218.11 P7755363 ALLRED CIR 27317 PRIVATE DRIVE 985.97 S3272 ALLRED HEIGHTS DR 27350 STATE ROAD 1,733.35 C0003002 ALLRED ST 27248 CITY STREET 1,953.79 S2290 ALLRED WAY 27317 STATE ROAD 1,774.10 P8702247 ALLREDVIEW AVE 27316 PRIVATE DRIVE 846.29 S1770 ALLWOOD DR 27370 STATE ROAD 633.00 S1823 ALPINE DR 27370 STATE ROAD 1,438.80 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-2 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7795391 ALTON DR 27248 PRIVATE DRIVE 1,136.23 P7728548 AMBER WAY 27263 PRIVATE DRIVE 666.31 C0001002 AMELIA CT 27203 CITY STREET 106.46 P8704210 AMICK LN 27298 PRIVATE DRIVE 979.60 C0001003 AMITY RD 27203 CITY STREET 3,620.72 S2917 ANCHOR DR 27205 STATE ROAD 1,661.04 P7763510 ANDERSON DR 27317 PRIVATE DRIVE 1,084.13 P7796417 ANDREW CTRY LN 27233 PRIVATE DRIVE 2,452.88 C0003015 ANDREW HUNTER RD 27248 CITY STREET 1,871.11 S2235 ANDREW HUNTER RD 27248 STATE ROAD 6,054.58 S2235 ANDREW HUNTER RD 27203 STATE ROAD 1,585.36 P7782472 ANDREW JACKSON TRL 27248 PRIVATE DRIVE 226.70 P7675389 ANGEL FIRE TRL 27341 PRIVATE DRIVE 1,489.26 P7763312 ANGUS TRL 27317 PRIVATE DRIVE 294.12 C0002238 ANNA CT 27263 CITY STREET 271.99 P7708391 ANNE ST 27263 PRIVATE DRIVE 606.37 C0001597 ANNS CT 27205 CITY STREET 3,691.75 S2949 ANTHONY CT 27205 STATE ROAD 641.98 S2887 ANTIOCH CHURCH RD 27341 STATE ROAD 25,487.73 C0002003 APACHE RD 27263 CITY STREET 1,868.43 P7734086 APACHE TRL 27350 PRIVATE DRIVE 1,668.31 C0002004 APOLLO CIR 27263 CITY STREET 3,581.31 S1223 APPALOOSA TRL 27205 STATE ROAD 1,360.54 S1120 APPLE TREE RD 27205 STATE ROAD 1,284.49 S3136 APPLEGATE LN 27205 STATE ROAD 733.38 S2133 APPLEWOOD RD 27317 STATE ROAD 4,240.69 S2934 APRIL LN 27205 STATE ROAD 900.28 S1222 ARABIAN DR 27205 STATE ROAD 1,975.77 S1727 ARBOR DR 27370 STATE ROAD 1,270.80 S2284 ARCADIA RD 27317 STATE ROAD 1,522.45 C0002005 ARCHDALE BLVD 27263 CITY STREET 3,200.90 C0002006 ARCHDALE RD 27263 CITY STREET 6,835.07 C0002006 ARCHDALE RD 27370 CITY STREET 8,022.95 S1004 ARCHDALE RD 27370 STATE ROAD 16,623.06 S2836 ARCHIE NEWSOM RD 27205 STATE ROAD 2,724.21 P8712341 ARDEN CT 27316 PRIVATE DRIVE 547.90 S1785 ARDEN RD 27360 STATE ROAD 1,524.79 S2702 ARLINGTON DR 27205 STATE ROAD 379.36 S2702 ARLINGTON DR EXT 27205 STATE ROAD 1,205.74 S1230 ARMADILLO DR 27205 STATE ROAD 695.66 C0001004 ARMFIELD AVE 27203 CITY STREET 1,042.29 C0002007 ARMSTRONG CT 27263 CITY STREET 633.42 S1810 ARNETTE DR 27263 STATE ROAD 1,587.61 C0001005 ARNOLD ST 27203 CITY STREET 416.62 S2486 ARROW HEAD RD 27316 STATE ROAD 163.90 C0003051 ARROW ST 27316 CITY STREET 679.66 C0001006 ARROW WOOD RD 27205 CITY STREET 3,142.47 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-3 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1386 ARROWSTONE DR 27205 STATE ROAD 1,281.07 C0001007 ART BRYAN DR 27203 CITY STREET 2,200.53 C0001008 ARTHUR ST 27203 CITY STREET 689.61 P7791350 ARTHURS CT 27248 PRIVATE DRIVE 933.09 S1626 ARTISAN AVE 27263 STATE ROAD 364.33 P8606258 ASBILL LN 27341 PRIVATE DRIVE 3,598.00 C0011007 ASCOT DR 27370 CITY STREET 1,271.94 C0004092 ASH AVE 27298 CITY STREET 1,118.49 S1995 ASHBROOK CIR 27263 STATE ROAD 3,023.11 P7648255 ASHBROOK VIEW LN 27205 PRIVATE DRIVE 1,464.30 C0001009 ASHDOL ST 27203 CITY STREET 1,025.03 C0008001 ASHEBORO ST 27355 CITY STREET 1,060.26 C0001579 ASHEFORD CT 27205 CITY STREET 234.35 S3193 ASHETON DR 27370 STATE ROAD 1,281.05 C0001515 ASHEWOOD CIR 27203 CITY STREET 1,772.43 C0002008 ASHLAND ST 27263 CITY STREET 4,689.86 C0001010 ASHLEY ST 27203 CITY STREET 521.79 C0001580 ASHMONT CT 27205 CITY STREET 493.22 C0002009 ASHWORTH CT 27370 CITY STREET 489.34 C0002010 ASHWORTH DR 27370 CITY STREET 989.14 S1161 ASHWORTH RD 27205 STATE ROAD 1,348.42 P7730408 ASHWORTH RD EXT 27205 PRIVATE DRIVE 1,158.39 P7649245 ASHWORTH VIEW DR 27205 PRIVATE DRIVE 830.49 C0001510 ASPEN CT 27203 CITY STREET 412.05 S1330 ASTEROID RD 27205 STATE ROAD 1,010.15 C0001011 ATLANTIC AVE 27205 CITY STREET 2,022.19 S2387 ATLAS DR 27317 STATE ROAD 551.55 S1663 AUCTION RD 27263 STATE ROAD 3,257.02 S2913 AUMAN AVE 27205 STATE ROAD 1,100.11 S2844 AUMAN CLAY RD 27205 STATE ROAD 1,105.56 P7664189 AUMAN FARM RD 27341 PRIVATE DRIVE 2,501.58 C0007001 AUMAN ST 27341 CITY STREET 1,351.58 P6796596 AUTUMN ACRES LN 27370 PRIVATE DRIVE 2,049.56 C0002214 AUTUMN HILL CT 27263 CITY STREET 607.57 S2990 AUTUMN LN 27205 STATE ROAD 818.52 P8720101 AUTUMN RIDGE DR 27316 PRIVATE DRIVE 1,197.97 P7649177 AUTUMN WOOD LN 27205 PRIVATE DRIVE 2,685.78 P6796595 AUTUMN WOODS CT 27370 PRIVATE DRIVE 811.70 P7679421 AVANTI DR 27205 PRIVATE DRIVE 1,672.63 C0001012 AVONDALE AVE 27203 CITY STREET 2,617.75 P7765258 AVONLEA LN 27317 PRIVATE DRIVE 374.68 C0001013 AYCOCK ST 27203 CITY STREET 383.81 C0006002 AZALEA DR 27317 CITY STREET 653.30 S1821 AZALEA LN 27370 STATE ROAD 735.39 P7745393 AZEL DR 27350 PRIVATE DRIVE 1,034.36 C0002011 AZTEC DR 27263 CITY STREET 947.35 P7669216 B B TRL 27205 PRIVATE DRIVE 1,538.34 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-4 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2849 BACHELOR CREEK RD 27205 STATE ROAD 10,003.24 S2849 BACHELOR CREEK RD 27341 STATE ROAD 13,682.85 S1327 BACK CREEK CHURCH RD 27205 STATE ROAD 4,083.14 S1873 BACK CREEK CT 27205 STATE ROAD 961.35 S1420 BACK CREEK RD 27205 STATE ROAD 11,227.66 S1374 BACK CREEK TER 27205 STATE ROAD 3,196.69 C0006003 BACK ST 27317 CITY STREET 1,385.75 P7639448 BADIN LN 27205 PRIVATE DRIVE 1,544.04 S1140 BAILEY RD 27205 STATE ROAD 4,236.78 C0002245 BAILEYS WAY 27263 CITY STREET 444.13 C0002012 BAINBRIDGE ST 27263 CITY STREET 1,285.98 P7736013 BAKER FARM RD 27350 PRIVATE DRIVE 3,148.78 C0002013 BAKER RD 27263 CITY STREET 435.61 S2124 BALDWIN DR 27317 STATE ROAD 744.28 C0002014 BALFOUR DR 27263 CITY STREET 4,367.09 S2705 BALSAM ST 27205 STATE ROAD 765.25 C0001014 BANK ST 27203 CITY STREET 2,210.80 S1931 BANNER WHITEHEAD RD 27350 STATE ROAD 9,714.88 S2102 BANTAM RD 27313 STATE ROAD 7,767.17 P6796490 BARBARA LN 27370 PRIVATE DRIVE 679.93 C0004099 BARBER DR 27298 CITY STREET 658.14 C0001015 BARBER ST 27203 CITY STREET 567.07 P7781564 BARBERRY CT 27205 PRIVATE DRIVE 558.90 C0001016 BARCLAY PL 27317 CITY STREET 517.44 S2359 BARKER DR 27317 STATE ROAD 3,429.19 C0006020 BARKER ST 27317 CITY STREET 844.90 P7717338 BARKLEY ST 27370 PRIVATE DRIVE 306.77 S2219 BARKWOOD RD 27317 STATE ROAD 978.90 C0002015 BARRETT DR 27263 CITY STREET 2,539.19 C0002016 BARWOOD TER 27370 CITY STREET 2,140.22 P7792455 BAY DOE ST 27316 PRIVATE DRIVE 1,356.97 C0001017 BAY LEAF CT 27203 CITY STREET 295.42 P7725409 BAYBERRY DR 27350 PRIVATE DRIVE 1,192.62 S1117 BEANE CTRY RD 27205 STATE ROAD 4,055.72 O9999 BEANE RD 27263 OUT OF COUNTY 93.79 S2707 BEANE ST 27205 STATE ROAD 794.33 C0002017 BEARD AVE 27263 CITY STREET 1,979.53 P7713384 BEAU CT 27370 PRIVATE DRIVE 1,262.66 S1778 BEAUMONT DR 27350 STATE ROAD 2,874.08 C0004087 BEAVER DAM CT 27298 CITY STREET 303.09 C0004086 BEAVER DAM RD 27298 CITY STREET 1,588.45 S2121 BEAVERCREEK RD 27317 STATE ROAD 1,412.34 P7774146 BECK CTRY DR 27317 PRIVATE DRIVE 424.75 P8605160 BECK FARM RD 27341 PRIVATE DRIVE 2,561.60 S1524 BECKERDITE RD 27350 STATE ROAD 26,086.42 S1863 BEECH CIR 27370 STATE ROAD 1,270.45 S2031 BEECH TREE CT 27350 STATE ROAD 1,510.35 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-5 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7797216 BEECH TREE DR 27233 PRIVATE DRIVE 1,916.69 S2357 BEECH TREE PL 27203 STATE ROAD 678.98 S1387 BEECHWOOD CT 27205 STATE ROAD 219.78 P7732428 BEECHWOOD DR 27205 PRIVATE DRIVE 2,475.99 S2047 BEESON CT 27350 STATE ROAD 384.08 S1525 BEESON FARM RD 27350 STATE ROAD 20,309.60 C0002219 BELGIAN DR 27263 CITY STREET 2,418.36 C0006004 BELL AVE 27317 CITY STREET 315.97 S1146 BELL SIMMONS RD 27205 STATE ROAD 2,820.97 C0011036 BELLAWOOD DR 27370 CITY STREET 4,091.30 S1100 BELLS GROVE RD 27239 STATE ROAD 19,665.52 C0009005 BELMAR ST 27260 CITY STREET 1,293.65 C0011004 BELMONT DR 27370 CITY STREET 2,093.39 P7737341 BELO RUSH DR 27263 PRIVATE DRIVE 755.02 C0002018 BELVA CT 27263 CITY STREET 250.25 S1319 BEN LAMBETH RD 27205 STATE ROAD 2,990.10 P8614280 BENJAMIN RD 27341 PRIVATE DRIVE 2,193.74 S2848 BENNETT FARM RD 27205 STATE ROAD 1,302.66 S1002 BENNETT RD 27208 STATE ROAD 11,533.61 S1002 BENNETT RD 27341 STATE ROAD 24,135.00 C0001018 BENNETT ST 27203 CITY STREET 1,002.35 S2445 BENNY LINEBERRY RD 27233 STATE ROAD 12,127.48 P7666198 BENSON FOX DR 27205 PRIVATE DRIVE 996.99 S2540 BENT OAK AVE 27316 STATE ROAD 448.79 P8713418 BENT OAK AVE EXT 27316 PRIVATE DRIVE 360.51 S2889 BENT RIDGE RD 27341 STATE ROAD 7,725.17 P7755485 BENTLEY DR 27317 PRIVATE DRIVE 1,726.82 S3144 BENTON RD 27350 STATE ROAD 759.84 P7743006 BENTON RD EXT 27350 PRIVATE DRIVE 1,258.31 C0001630 BERG ST 27203 CITY STREET 992.36 S1876 BERKLEY LN 27205 STATE ROAD 4,518.59 S3190 BERKLEY PL 27205 STATE ROAD 522.81 C0009007 BERKLEY ST 27260 CITY STREET 502.47 P7752302 BERRIE PL 27205 PRIVATE DRIVE 295.72 S2230 BERRY LN 27313 STATE ROAD 3,833.46 S1311 BESCHER CHAPEL RD 27370 STATE ROAD 14,143.25 S1311 BESCHER CHAPEL RD 27239 STATE ROAD 16,071.76 S1167 BESSIE BELL RD 27205 STATE ROAD 1,346.24 S2132 BETHANY CHURCH RD 27248 STATE ROAD 11,826.14 P8726309 BETHANY WAY 27355 PRIVATE DRIVE 1,987.85 S2112 BETHEL CHURCH RD 27313 STATE ROAD 4,844.78 S2112 BETHEL CHURCH RD 27233 STATE ROAD 4,144.85 S1621 BETHEL DR 27260 STATE ROAD 2,966.74 P6798500 BETHEL DR EXT 27260 PRIVATE DRIVE 1,105.55 S2056 BETHEL DR EXT 27260 STATE ROAD 1,035.67 S2660 BETHEL FRIENDS RD 27205 STATE ROAD 8,483.23 S1118 BETHEL LUCAS RD 27205 STATE ROAD 15,011.88 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-6 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P6798102 BETHEL PARK DR 27260 PRIVATE DRIVE 267.28 S3244 BETSY LN 27317 STATE ROAD 1,704.00 C0001019 BETTS ST 27203 CITY STREET 570.00 S1270 BETTY MCGEE DR 27205 STATE ROAD 1,040.23 S2879 BEULAH CHURCH RD 27208 STATE ROAD 3,267.54 P6795364 BEVAN DR 27370 PRIVATE DRIVE 1,663.26 P6798197 BEVERLY HILLS DR 27260 PRIVATE DRIVE 805.98 P8708416 BIG BUCK RD 27283 PRIVATE DRIVE 750.02 P7608468 BIG CTRY DR 27205 PRIVATE DRIVE 2,074.83 P7624296 BIG LEAF RD 27371 PRIVATE DRIVE 1,416.88 P7767486 BIG OAK WAY 27317 PRIVATE DRIVE 797.73 P8737465 BIG TREE RD 27298 PRIVATE DRIVE 1,184.28 C0002019 BILLY AVE 27263 CITY STREET 670.20 P8627361 BILLY BRADY RD 27208 PRIVATE DRIVE 2,028.04 P7782495 BILLY COLTRANE DR 27248 PRIVATE DRIVE 535.82 P7659391 BILLY CRANFORD LN 27205 PRIVATE DRIVE 299.83 P7717301 BILLY LEE RD 27370 PRIVATE DRIVE 939.68 S1160 BILLY WALKER RD 27205 STATE ROAD 4,350.61 S1168 BINGHAM LOFLIN RD 27205 STATE ROAD 4,694.45 C0001548 BIRCH BARK LN 27317 CITY STREET 476.41 S2007 BIRCH DR 27317 STATE ROAD 956.05 C0002020 BIRCHWOOD CT 27370 CITY STREET 210.91 P7658472 BIRDIE PL 27205 PRIVATE DRIVE 473.61 P7777445 BIRDS VIEW RD 27317 PRIVATE DRIVE 1,261.93 C0001020 BIRKHEAD ST 27203 CITY STREET 474.07 P7616357 BLACK MTN RD 27205 PRIVATE DRIVE 5,423.86 P6795527 BLACK OAK CT 27360 PRIVATE DRIVE 222.80 C0002021 BLAIR CT 27263 CITY STREET 1,761.10 C0002022 BLAIR DR 27263 CITY STREET 2,194.32 P6798361 BLAIR FARM RD 27263 PRIVATE DRIVE 1,139.72 P6799415 BLAZING STAR DR 27263 PRIVATE DRIVE 704.38 P7776540 BLUE HERON LN 27317 PRIVATE DRIVE 1,973.99 P6793146 BLUE QUARTZ DR 27360 PRIVATE DRIVE 1,692.00 S2321 BLUE RIDGE RD 27313 STATE ROAD 799.11 P7754278 BLUE VIOLET DR 27317 PRIVATE DRIVE 1,021.35 S1643 BLUEBERRY CT 27370 STATE ROAD 412.07 P7723155 BLUEBILL LN 27205 PRIVATE DRIVE 658.71 S3226 BLUEBIRD LN 27205 STATE ROAD 945.62 S2223 BOB KIVETT RD 27203 STATE ROAD 1,769.86 O9999 BOBBY JEAN RD 27283 OUT OF COUNTY 255.00 P7666196 BOBBY MORAN DR 27205 PRIVATE DRIVE 1,168.79 P7753171 BOBCAT TRL 27317 PRIVATE DRIVE 1,376.69 C0001625 BOBWHITE LN 27205 CITY STREET 253.60 C0001614 BOGEY LN 27205 CITY STREET 532.49 P8704479 BOGGS TRL 27298 PRIVATE DRIVE 2,695.93 P6799417 BOLES AVE 27260 PRIVATE DRIVE 873.51 C0001506 BOLING DR 27203 CITY STREET 409.35 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-7 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1624 BOLIVAR AVE 27260 STATE ROAD 1,209.79 S1178 BOMBAY SCHOOL RD 27239 STATE ROAD 4,335.21 S1139 BONDURANT RD 27205 STATE ROAD 577.58 S1227 BONITA LN 27205 STATE ROAD 459.60 S1242 BONITA ST 27205 STATE ROAD 925.03 P7763340 BONKEMEYER CTRY TRL 27317 PRIVATE DRIVE 659.82 C0001519 BONKEMEYER DR 27317 CITY STREET 1,216.09 P7763316 BONKEMEYER DR 27317 PRIVATE DRIVE 1,142.53 O8888 BONNIE DEWEESE RD 27360 OUT OF COUNTY 25.36 C0002197 BONNIE PL 27263 CITY STREET 560.48 S2187 BOOKER T WASHINGTON AVE 27203 STATE ROAD 2,174.77 C0006115 BOOKER T WOMBLE RD 27317 CITY STREET 1,477.45 P7664100 BOONE FARM RD 27205 PRIVATE DRIVE 5,727.26 C0007002 BOONE ST 27341 CITY STREET 1,184.49 C0011035 BORDEAUX DR 27370 CITY STREET 794.48 S1124 BOROUGH AVE 27341 STATE ROAD 3,908.47 C0007003 BOROUGH AVE 27341 CITY STREET 621.46 C0001022 BOSSONG DR 27205 CITY STREET 1,278.75 P7737287 BOULDER CT 27263 PRIVATE DRIVE 351.43 P7737289 BOULDER DR 27263 PRIVATE DRIVE 2,138.88 C0002255 BOULDIN CT 27370 CITY STREET 533.01 P7763119 BOUNDARY DR 27317 PRIVATE DRIVE 2,192.73 C0002023 BOWEN DR 27263 CITY STREET 1,102.81 P7764451 BOWERS CREEK RD 27317 PRIVATE DRIVE 2,037.46 S2125 BOWERS LN 27317 STATE ROAD 5,056.39 P7764263 BOWERS MEADOW DR 27317 PRIVATE DRIVE 616.27 S1954 BOWMAN AVE 27317 STATE ROAD 5,908.42 C0006005 BOWMAN AVE 27317 CITY STREET 1,214.55 S2413 BOWMAN DAIRY RD 27298 STATE ROAD 962.68 P7737345 BOWMAN LOOP DR 27263 PRIVATE DRIVE 1,089.81 S2811 BOYD AVE 27205 STATE ROAD 718.06 S2855 BOYD DR 27341 STATE ROAD 1,182.88 C0007004 BOYD DR 27341 CITY STREET 621.46 P7656212 BOYLES DR 27205 PRIVATE DRIVE 1,980.31 S3105 BRAD RD 27350 STATE ROAD 624.81 C0002213 BRADFORD LN 27263 CITY STREET 3,550.09 C0006006 BRADSHER CT 27317 CITY STREET 334.53 C0001023 BRADY AVE 27203 CITY STREET 1,078.33 S2489 BRADY ST EXT 27316 STATE ROAD 10,390.02 S1370 BRANCHVIEW WAY 27239 STATE ROAD 1,253.65 S1359 BRANCHWATER RD 27205 STATE ROAD 875.57 P7639235 BRANCHWOOD DR 27205 PRIVATE DRIVE 644.75 C0002024 BRANDON LN 27370 CITY STREET 997.66 C0002240 BRANIFF PL 27263 CITY STREET 394.30 S1944 BRANSON DAVIS RD 27350 STATE ROAD 14,628.09 S1944 BRANSON DAVIS RD 27317 STATE ROAD 4,321.33 P7748087 BRANSON MEADOWS RD 27263 PRIVATE DRIVE 2,617.49 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-8 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2101 BRANSON MILL RD 27317 STATE ROAD 7,794.13 S2101 BRANSON MILL RD 27313 STATE ROAD 5,250.30 S2985 BRANTLEY DR 27205 STATE ROAD 737.22 S1303 BRANTLEY GORDON RD 27239 STATE ROAD 21,512.06 P7658471 BRASSIE CT 27205 PRIVATE DRIVE 260.17 S1603 BRAXTON CRAVEN RD 27370 STATE ROAD 3,433.30 S2816 BRAY BLVD 27205 STATE ROAD 1,651.02 S3012 BRAY BLVD 27205 STATE ROAD 475.20 P7750445 BRAY BLVD 27205 PRIVATE DRIVE 207.64 C0010001 BRECKENRIDGE DR 27360 CITY STREET 1,486.09 S2377 BRECKENWOOD CT 27203 STATE ROAD 1,664.81 C0001024 BREEZE HILL RD 27203 CITY STREET 3,404.89 C0001025 BREEZEWAY CT 27203 CITY STREET 393.94 C0001026 BRENTWOOD CT 27203 CITY STREET 178.19 S3171 BREVARD DR 27205 STATE ROAD 1,087.63 C0001027 BREWER ST 27203 CITY STREET 4,268.96 C0011044 BRIANNA PL 27370 CITY STREET 364.80 S3174 BRIAR PATCH LN 27360 STATE ROAD 1,474.78 S2600 BRIARCLIFF DR 27205 STATE ROAD 3,884.44 S1789 BRIARCLIFF RD 27360 STATE ROAD 1,242.42 S2368 BRIAROAK DR 27233 STATE ROAD 1,702.49 S2046 BRIDGE POINT DR 27350 STATE ROAD 941.66 C0011014 BRIDLEWOOD DR 27370 CITY STREET 2,552.50 P7617458 BRIGHT STAR LN 27205 PRIVATE DRIVE 754.48 C0002210 BRIGHTLEAF CT 27263 CITY STREET 589.33 S1214 BRILES DR 27205 STATE ROAD 3,641.10 S1357 BRILES MEADOW RD 27370 STATE ROAD 5,736.92 P8737364 BRINKLEY CTRY LN 27298 PRIVATE DRIVE 538.02 S2549 BRINTON PL 27316 STATE ROAD 354.20 S2276 BRISTOL LN 27317 STATE ROAD 1,119.75 C0001029 BRITT AVE 27203 CITY STREET 1,015.02 C0001028 BRITTAIN ST 27203 CITY STREET 1,797.04 C0006105 BRITTANY LN 27317 CITY STREET 484.63 S2273 BRITTANY TRL 27313 STATE ROAD 4,500.06 C0002227 BRITTANY WAY 27263 CITY STREET 2,049.81 P7782473 BROAD OAKS ST 27203 PRIVATE DRIVE 980.94 C0005002 BROAD ST 27316 CITY STREET 800.59 S1888 BROKAW DR 27370 STATE ROAD 1,456.05 S1760 BROKEN OAK RD 27370 STATE ROAD 2,605.61 S1930 BRONZIE LAWSON RD 27263 STATE ROAD 2,395.64 S1829 BROOK CIR 27263 STATE ROAD 1,740.76 C0011029 BROOK CIR EXT 27263 CITY STREET 1,091.90 C0001031 BROOK DR 27205 CITY STREET 947.59 S2810 BROOK DR 27205 STATE ROAD 2,509.45 P7764166 BROOK ESTATES RD 27317 PRIVATE DRIVE 916.42 S1828 BROOK ST 27263 STATE ROAD 837.25 C0002256 BROOKBANK CT 27370 CITY STREET 475.25 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-9 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1606 BROOKDALE DR 27370 STATE ROAD 566.06 S1724 BROOKDALE DR 27370 STATE ROAD 889.84 C0001032 BROOKDALE DR 27205 CITY STREET 3,101.02 S2384 BROOKDALE RD 27203 STATE ROAD 1,206.19 S2485 BROOKGREEN RD 27316 STATE ROAD 1,918.97 P8711343 BROOKHAVEN RD 27316 PRIVATE DRIVE 1,037.87 C0002026 BROOKHOLLOW LN 27263 CITY STREET 2,024.09 C0002027 BROOKLEIGH CT 27370 CITY STREET 592.87 C0005003 BROOKLYN AVE 27316 CITY STREET 3,677.84 S2615 BROOKLYN AVE EXT 27316 STATE ROAD 6,688.01 S2460 BROOKSDALE RD 27355 STATE ROAD 3,042.70 S3281 BROOKSHIRE CT 27350 STATE ROAD 1,299.42 C0006007 BROOKSHIRE RD 27317 CITY STREET 1,581.55 S1389 BROOKSIDE CT 27205 STATE ROAD 931.05 C0001033 BROOKSIDE DR 27203 CITY STREET 793.76 C0005004 BROOKVIEW CIR 27316 CITY STREET 354.12 S1450 BROOKWAY RD 27205 STATE ROAD 554.91 S2072 BROOKWOOD ACRES DR 27317 STATE ROAD 3,917.81 C0002178 BROOKWOOD CIR 27263 CITY STREET 612.92 S2246 BROOKWOOD DR 27203 STATE ROAD 595.41 C0001604 BROOKWOOD DR 27203 CITY STREET 796.34 P7736336 BROOKWOOD ESTATES RD 27350 PRIVATE DRIVE 617.43 S2440 BROWER MEADOW RD 27355 STATE ROAD 8,998.78 S2866 BROWER MILL RD 27341 STATE ROAD 21,847.61 S2635 BROWERDALE RD 27344 STATE ROAD 2,964.80 S2826 BROWERS CHAPEL RD 27205 STATE ROAD 15,250.73 P7706201 BROWN HOUSE RD 27370 PRIVATE DRIVE 461.59 S1953 BROWN LOOP 27317 STATE ROAD 1,585.15 S2118 BROWN OAKS RD 27317 STATE ROAD 5,870.45 P7707228 BROWN ST 27370 PRIVATE DRIVE 664.24 C0001413 BROWN TRL 27205 CITY STREET 904.29 P7634001 BROWNLOW LN 27371 PRIVATE DRIVE 2,108.81 S2941 BROWNMIRE DR 27205 STATE ROAD 463.03 S2469 BROWNS CROSSROADS RD 27355 STATE ROAD 17,761.34 S2408 BROWNS MEADOW RD 27298 STATE ROAD 1,422.97 S2724 BROWNSTONE HILLS DR 27205 STATE ROAD 1,184.84 P7797215 BROWNWOOD DR 27233 PRIVATE DRIVE 2,502.80 P7730571 BRUBAKER LN 27205 PRIVATE DRIVE 2,665.62 S2132 BRUCE PUGH RD 27248 STATE ROAD 10,440.51 S2643 BRUSH CREEK RD 27208 STATE ROAD 8,743.89 C0001034 BRYAN AVE 27203 CITY STREET 328.77 P7646561 BUCK FORD RD 27205 PRIVATE DRIVE 3,606.49 S2070 BUCK LN 27350 STATE ROAD 1,058.00 P7733460 BUCK MOUNTAIN TRL 27350 PRIVATE DRIVE 966.92 C0001565 BUCKHORN DR 27317 CITY STREET 2,472.07 S2607 BUFFALO FORD RD 27205 STATE ROAD 21,667.12 S2607 BUFFALO FORD RD 27316 STATE ROAD 14,909.13 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-10 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P8710183 BUFFALO TRL 27316 PRIVATE DRIVE 997.93 P7679428 BUGATTI AVE 27205 PRIVATE DRIVE 208.37 C0003003 BUIE LN 27248 CITY STREET 352.20 C0003004 BUIE LN EXT 27248 CITY STREET 755.78 P6796386 BUILDERS DR 27360 PRIVATE DRIVE 632.99 S2412 BULB RD 27283 STATE ROAD 642.79 S2111 BULL RUN CREEK RD 27248 STATE ROAD 10,185.00 S2111 BULL RUN CREEK RD 27317 STATE ROAD 545.09 C0001035 BULLA ST 27203 CITY STREET 217.60 P7666197 BULLINS LN 27205 PRIVATE DRIVE 784.14 S2437 BUMPAS RD 27355 STATE ROAD 7,264.46 S1698 BUNDY DR 27263 STATE ROAD 581.21 S1433 BUNTING RD 27205 STATE ROAD 4,702.34 S2411 BUNTON SWAIM RD 27298 STATE ROAD 7,751.99 C0002028 BURGEMERE ST 27263 CITY STREET 1,276.01 P8720102 BURGESS CATTLE DR 27344 PRIVATE DRIVE 3,350.91 S2723 BURGESS FARM DR 27316 STATE ROAD 2,842.90 S2629 BURGESS KIVETT RD 27316 STATE ROAD 16,899.66 C0001036 BURGESS ST 27203 CITY STREET 723.30 C0006008 BURGESS ST 27317 CITY STREET 553.39 C0001037 BURMIL RD 27203 CITY STREET 1,766.56 S1105 BURNEY MILL RD 27371 STATE ROAD 7,253.33 S1105 BURNEY MILL RD 27239 STATE ROAD 11,528.39 S1127 BURNEY RD 27205 STATE ROAD 27,158.64 P7781449 BURNS FARM RD 27205 PRIVATE DRIVE 991.16 C0001038 BURNS ST 27203 CITY STREET 1,432.96 S1176 BURRELL ALLEN RD 27239 STATE ROAD 8,014.28 S2517 BURROW RD 27283 STATE ROAD 427.79 S2000 BURRWOOD DR 27263 STATE ROAD 948.41 P7783229 BUSH CREEK DR 27248 PRIVATE DRIVE 1,366.12 C0005005 BUSH ST 27316 CITY STREET 1,442.30 S2419 BUTLER RD 27298 STATE ROAD 6,665.74 S2499 BUTLERS CHAPEL RD 27248 STATE ROAD 3,590.71 C0001566 BUTTERFLY TRL 27317 CITY STREET 589.32 P7756301 BUTTKE DAIRY LOOP 27317 PRIVATE DRIVE 920.78 P8725110 BYRD HOUSE RD 27355 PRIVATE DRIVE 2,731.68 S3243 BYRD LN 27350 STATE ROAD 621.50 C0002243 BYRON LN 27263 CITY STREET 1,404.65 P8712129 C C SQUARE RD 27316 PRIVATE DRIVE 426.91 S2553 C C SQUARE RD 27316 STATE ROAD 513.92 S1320 CABLE CREEK RD 27205 STATE ROAD 8,705.27 P7768156 CABLE FARM TRL 27317 PRIVATE DRIVE 2,666.95 S2861 CAGLE LOOP RD 27341 STATE ROAD 6,329.87 C0006009 CAGLE ST 27317 CITY STREET 891.69 S1880 CAIN CT 27370 STATE ROAD 404.85 S2523 CALHOUN DR 27298 STATE ROAD 2,781.89 C0002029 CALLAHAN ST 27263 CITY STREET 677.56 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-11 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2193 CALLICUT ST 27203 STATE ROAD 711.82 S1141 CALLICUTT HENLEY RD 27205 STATE ROAD 3,683.10 P7664422 CALLIE DR 27341 PRIVATE DRIVE 483.10 S2059 CALVARY WAY 27360 STATE ROAD 981.93 S1847 CALVERT ST 27370 STATE ROAD 630.59 P7717335 CALVERT ST 27370 PRIVATE DRIVE 154.25 S2367 CAMDEN CT 27203 STATE ROAD 543.79 P7764445 CAMELLIA LN 27317 PRIVATE DRIVE 815.73 S2289 CAMELOT DR 27203 STATE ROAD 1,143.05 S1843 CAMERON CIR 27205 STATE ROAD 1,663.92 C0002030 CAMERON CT 27370 CITY STREET 544.34 S3224 CAMERON DR 27205 STATE ROAD 1,202.11 P7712388 CAMERON PL 27205 PRIVATE DRIVE 557.74 P7733343 CAMP MUNDO VISTA TRL 27350 PRIVATE DRIVE 3,433.32 S2120 CAMP NAWAKA RD 27317 STATE ROAD 1,811.35 P7775126 CAMP NAWAKA RD EXT 27317 PRIVATE DRIVE 838.27 P8702319 CAMP ST 27316 PRIVATE DRIVE 207.92 P7778391 CAMPBELL RD 27313 PRIVATE DRIVE 1,619.25 P7775115 CAMPFIRE RD 27317 PRIVATE DRIVE 302.27 S1307 CANAAN CHURCH RD 27239 STATE ROAD 6,089.58 P7665295 CANDLEBROOK DR 27205 PRIVATE DRIVE 2,197.39 C0004002 CANDLEWOOD DR 27298 CITY STREET 1,357.34 S2832 CANE MILL RD 27205 STATE ROAD 9,404.31 C0001557 CANNON CT 27205 CITY STREET 558.80 S1206 CANNON HEIGHTS DR 27205 STATE ROAD 2,398.47 C0001039 CANOY DR 27203 CITY STREET 833.62 S2625 CANOY FARM RD 27316 STATE ROAD 6,112.97 C0011002 CANTER DR 27370 CITY STREET 2,918.32 S1983 CANTER LN 27263 STATE ROAD 1,592.05 S1927 CANTER RD 27263 STATE ROAD 9,441.98 S2696 CANTERBURY TRL 27205 STATE ROAD 1,104.09 P7760540 CANTERBURY TRL 27205 PRIVATE DRIVE 1,405.92 C0005006 CAPEL ST 27316 CITY STREET 278.47 P7743005 CARAWAY CT 27350 PRIVATE DRIVE 1,047.59 S3143 CARAWAY DR 27350 STATE ROAD 2,673.18 S1004 CARAWAY MTN RD 27205 STATE ROAD 2,781.60 S1004 CARAWAY MTN RD 27350 STATE ROAD 17,296.02 P7733458 CARAWAY SPRINGS TRL 27350 PRIVATE DRIVE 3,352.49 S1730 CARAWAY TRL 27350 STATE ROAD 1,758.85 P8736258 CARDINAL CT 27298 PRIVATE DRIVE 339.15 C0002258 CARDINAL PL 27263 CITY STREET 314.08 S1221 CARDINAL ST 27205 STATE ROAD 726.83 P8736257 CARDINAL VIEW DR 27298 PRIVATE DRIVE 818.55 S2143 CARL ALLRED RD 27248 STATE ROAD 16,780.08 S2885 CARL BRADY RD 27208 STATE ROAD 11,063.89 S2882 CARL COX RD 27208 STATE ROAD 7,092.44 C0001040 CARL DR 27203 CITY STREET 5,383.60 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-12 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P6782250 CARL LEE DR 27292 PRIVATE DRIVE 1,433.18 C0006010 CARLISLE AVE 27317 CITY STREET 705.40 C0006011 CARLISLE AVE EXT 27317 CITY STREET 303.01 S1838 CARLTON DR 27350 STATE ROAD 1,976.27 S1834 CAROLE DR 27350 STATE ROAD 1,866.72 C0001041 CAROLINA AVE 27203 CITY STREET 611.41 C0002031 CAROLINA CT 27263 CITY STREET 306.67 S1269 CAROWOOD DR 27205 STATE ROAD 590.00 S2366 CARRIAGE CROSSING DR 27313 STATE ROAD 1,156.06 P6796281 CARRIAGE HOUSE CIR 27370 PRIVATE DRIVE 1,586.16 S2697 CARRIAGE LN 27205 STATE ROAD 768.52 C0011012 CARRIAGE PL 27370 CITY STREET 340.71 S1634 CARRIAGE WAY RD 27205 STATE ROAD 718.72 C0011045 CARRINGTON CT 27370 CITY STREET 303.54 C0002233 CARRINGTON LN 27263 CITY STREET 123.42 C0002032 CARROLL ST 27263 CITY STREET 549.21 S1736 CARSON RD 27203 STATE ROAD 638.41 C0005007 CARTER ST 27316 CITY STREET 815.99 C0001042 CASCADE AVE 27203 CITY STREET 900.41 S1636 CASHATT RD 27370 STATE ROAD 4,290.97 C0001526 CASPN DR 27203 CITY STREET 283.82 S3145 CASSADY RD 27341 STATE ROAD 1,086.75 S2300 CASTLEROCK RD 27317 STATE ROAD 719.48 P7724279 CATHERINE WAY 27350 PRIVATE DRIVE 600.75 P7764342 CAUDLE ESTATE DR 27317 PRIVATE DRIVE 2,761.26 P7775327 CAUDLE FARM LN 27248 PRIVATE DRIVE 2,679.42 S2123 CAUDLE RD 27317 STATE ROAD 10,960.44 P7763152 CAUSEY DR 27317 PRIVATE DRIVE 162.92 S2878 CAVINESS RD 27325 STATE ROAD 1,032.20 P7776128 CECIL NORMAN RD 27317 PRIVATE DRIVE 1,410.95 P6799395 CECIL ST 27260 PRIVATE DRIVE 470.00 P7767488 CECIL VIEW LN 27317 PRIVATE DRIVE 1,892.99 C0001523 CECYLIA CT 27317 CITY STREET 314.43 P7783326 CEDAR BRADY LN 27248 PRIVATE DRIVE 1,243.45 S3120 CEDAR CREEK DR 27205 STATE ROAD 5,962.47 S3124 CEDAR DR 27350 STATE ROAD 486.64 P7782199 CEDAR FALLS CHURCH DR 27317 PRIVATE DRIVE 555.61 S2226 CEDAR FALLS RD 27248 STATE ROAD 8,755.24 C0001043 CEDAR FALLS RD 27203 CITY STREET 978.35 S2538 CEDAR FOREST RD 27248 STATE ROAD 1,422.97 S2930 CEDAR GROVE DR 27205 STATE ROAD 1,065.79 P7659444 CEDAR GROVE DR EXT 27205 PRIVATE DRIVE 949.30 S2926 CEDAR GROVE RD 27205 STATE ROAD 2,361.85 C0011052 CEDAR HILL CT 27370 CITY STREET 103.91 S2005 CEDAR LN 27317 STATE ROAD 2,330.65 P7771333 CEDAR LODGE RD 27205 PRIVATE DRIVE 718.82 S2373 CEDAR MEADOWS CT 27313 STATE ROAD 869.97 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-13 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1617 CEDAR POST ST 27263 STATE ROAD 1,957.29 C0001044 CEDAR RD 27203 CITY STREET 1,957.82 P7637236 CEDAR ROCK MTN RD 27205 PRIVATE DRIVE 4,471.40 S2385 CEDAR RUN DR 27317 STATE ROAD 2,353.31 S2135 CEDAR SPRINGS RD 27317 STATE ROAD 2,129.30 S1928 CEDAR SQUARE RD 27317 STATE ROAD 6,549.68 S1928 CEDAR SQUARE RD 27263 STATE ROAD 12,590.73 U 311 CEDAR SQUARE RD 27263 US HIGHWAY 1,859.61 S3153 CEDAR TRL 27360 STATE ROAD 1,584.76 P7715148 CEDAR WOOD DR 27370 PRIVATE DRIVE 3,449.29 P7762458 CEDAR WOOD PL 27203 PRIVATE DRIVE 1,501.69 C0002265 CEDAR XING 27370 CITY STREET 977.16 S1732 CEDARBERRY RD 27370 STATE ROAD 969.33 C0001547 CEDARDALE CT 27317 CITY STREET 363.55 P7717145 CEDARDALE ST 27370 PRIVATE DRIVE 700.47 S1385 CEDARWOOD CT 27205 STATE ROAD 1,045.61 P7727205 CEEBEE DR 27263 PRIVATE DRIVE 251.47 C0001045 CELESTE LN 27203 CITY STREET 514.04 S1115 CENTER CROSS CHURCH RD 27205 STATE ROAD 9,270.58 C0002271 CENTER POINTE CT 27263 CITY STREET 268.73 C0004089 CENTER ST 27298 CITY STREET 254.86 C0001046 CENTER ST 27203 CITY STREET 1,653.27 C0001047 CENTRAL FALLS RD 27203 CITY STREET 3,474.92 C0006121 CENTRAL PIEDMONT CT 27317 CITY STREET 1,027.40 P6795528 CENTURY DR 27360 PRIVATE DRIVE 1,083.79 S2002 CHADWICK DR 27263 STATE ROAD 716.67 C0001576 CHAMBERLIN DR 27205 CITY STREET 3,267.16 C0001048 CHAMPAGNE DR 27203 CITY STREET 1,419.19 S2610 CHANEY RD 27205 STATE ROAD 7,291.37 S2001 CHANTERELLE DR 27263 OUT OF COUNTY DRIVE 47.17 S2001 CHANTERELLE DR 27263 STATE ROAD 337.28 S1101 CHAPEL HILL CHURCH RD 27239 STATE ROAD 13,917.77 C0001049 CHAPELGATE LN 27205 CITY STREET 552.50 S1343 CHAPELWOOD RD 27239 STATE ROAD 2,788.88 P6781228 CHAPELWOOD RD EXT 27239 PRIVATE DRIVE 488.00 C0011010 CHAPSWORTH DR 27370 CITY STREET 2,452.92 P6798156 CHARITY CHURCH LN 27263 PRIVATE DRIVE 544.74 S2812 CHARLES AVE 27205 STATE ROAD 2,392.95 S1102 CHARLES MTN RD 27239 STATE ROAD 10,213.85 P7787299 CHARLES PL 27313 PRIVATE DRIVE 485.67 S1637 CHARLIE HARRIS RD 27370 STATE ROAD 4,191.43 S1421 CHARLOTTE CHURCH RD 27205 STATE ROAD 558.47 P7750389 CHARMIN DR 27205 PRIVATE DRIVE 444.20 P7765259 CHARTER OAKS DR 27317 PRIVATE DRIVE 3,304.59 C0010007 CHARTER PL 27360 CITY STREET 316.10 S2082 CHARTIER CT 27205 STATE ROAD 509.05 P7774418 CHARTWELL LN 27317 PRIVATE DRIVE 641.11 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-14 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1392 CHASE RD 27360 STATE ROAD 622.16 C0011046 CHATEAU DR 27370 CITY STREET 208.85 P8732010 CHATHAM VIEW RD 27316 PRIVATE DRIVE 3,209.46 S2271 CHAUCER TRL 27313 STATE ROAD 3,940.26 P6695319 CHECKMARK RD 27239 PRIVATE DRIVE 4,879.72 S2369 CHEDDINGTON DR 27203 STATE ROAD 667.05 P8635007 CHEEK PURVIS TRL 27208 PRIVATE DRIVE 889.58 S2510 CHEEK RD 27316 STATE ROAD 668.21 C0002228 CHELSEA SQ 27263 CITY STREET 219.32 C0001050 CHEROKEE ST 27203 CITY STREET 363.44 S2380 CHEROKEE TRL 27313 STATE ROAD 4,460.22 S2286 CHERRYWOOD RD 27317 STATE ROAD 1,951.68 C0002236 CHESAPEAKE LN 27263 CITY STREET 1,486.17 P7741598 CHESHIRE PL 27205 PRIVATE DRIVE 1,714.23 P7754275 CHESTNUTT OAK RD 27317 PRIVATE DRIVE 1,192.50 C0001051 CHESTNUT ST 27203 CITY STREET 2,297.48 S1749 CHET DR 27370 STATE ROAD 928.48 S1749 CHET DR EXT 27370 STATE ROAD 522.35 S3147 CHEYENNE CIR 27205 STATE ROAD 1,895.93 C0002033 CHEYENNE DR 27263 CITY STREET 4,110.71 C0001590 CHICKADEE CIR 27203 CITY STREET 123.13 S2693 CHILTON RD 27316 STATE ROAD 1,958.51 P6793348 CHIPPER TRL 27360 PRIVATE DRIVE 3,060.40 C0005008 CHISHOLM RD 27316 CITY STREET 1,454.71 P8713375 CHRISTOPHER WAY DR 27316 PRIVATE DRIVE 572.10 C0008002 CHURCH ST 27355 CITY STREET 549.49 C0006012 CHURCH ST 27317 CITY STREET 1,287.47 C0003005 CHURCH ST 27248 CITY STREET 1,586.15 C0005009 CHURCH ST 27316 CITY STREET 2,189.78 P7770329 CIRCLE B DR 27205 PRIVATE DRIVE 2,362.10 C0011037 CIRCLE CT 27370 CITY STREET 1,771.74 C0002034 CIRCLE DR 27263 CITY STREET 2,797.47 P7708163 CIRCLE DR EXT 27263 PRIVATE DRIVE 572.70 C0011005 CITATION DR 27370 CITY STREET 578.31 C0001052 CITY VIEW ST 27203 CITY STREET 1,778.72 P7777575 CLACIE LN 27298 PRIVATE DRIVE 1,143.54 P7781156 CLAPP DR 27205 PRIVATE DRIVE 823.34 P7703212 CLARA THOMAS DR 27370 PRIVATE DRIVE 906.79 P7764137 CLARENCE BOWERS RD 27317 PRIVATE DRIVE 550.35 S2452 CLARENCE YORK RD 27298 STATE ROAD 3,564.55 P7751112 CLARENDON RD 27205 PRIVATE DRIVE 1,061.52 S2498 CLARK AVE 27248 STATE ROAD 1,359.42 C0003006 CLARK AVE 27248 CITY STREET 3,297.68 C0003007 CLARK ST 27248 CITY STREET 1,556.91 P7757404 CLASSIC DR 27317 PRIVATE DRIVE 484.00 S2124 CLAUDE HOLDEN DR 27317 STATE ROAD 631.68 C0001053 CLAY ST 27203 CITY STREET 154.98 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-15 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P8723398 CLAYBROOK RD 27316 PRIVATE DRIVE 936.69 S1664 CLAYTON ST 27263 STATE ROAD 960.57 S1626 CLAYTON ST 27263 STATE ROAD 509.78 P7699529 CLAYTON THOMAS DR 27316 PRIVATE DRIVE 1,005.01 P7725299 CLEAR MORNING RD 27350 PRIVATE DRIVE 1,323.80 S3283 CLEAR RIDGE DR 27370 STATE ROAD 900.08 P7715524 CLEAR RIDGE DR 27370 PRIVATE DRIVE 1,076.96 S2950 CLEARVIEW DR 27205 STATE ROAD 1,778.27 P7791354 CLEARWATER CT 27205 PRIVATE DRIVE 347.99 C0001054 CLEGG AVE 27203 CITY STREET 576.04 S2714 CLEON ST 27205 STATE ROAD 1,655.55 P7742198 CLETUS LN 27350 PRIVATE DRIVE 231.87 C0001055 CLEVELAND ST 27205 CITY STREET 684.03 C0001056 CLIFF RD 27203 CITY STREET 5,381.87 C0001056 CLIFF RD 27205 CITY STREET 783.81 S2676 CLIFFWOOD DR 27205 STATE ROAD 1,739.74 S1758 CLIFTON DR 27263 STATE ROAD 1,270.04 S2892 CLINT CAVINESS RD 27316 STATE ROAD 3,664.12 S2648 CLIPWOOD RD 27208 STATE ROAD 2,597.88 P7768357 CLODFELTER TRL 27317 PRIVATE DRIVE 2,181.18 S1729 CLOVER DR 27350 STATE ROAD 3,155.99 C0001057 CLOVER ST 27203 CITY STREET 831.56 C0002182 CLOVERDALE CT 27263 CITY STREET 510.87 C0002035 CLOVERDALE DR 27263 CITY STREET 1,533.29 P7646562 CLOVERFIELD RD 27205 PRIVATE DRIVE 2,090.87 P7722454 CLUB VIEW DR 27205 PRIVATE DRIVE 3,430.92 P7700227 CLYDE GRAVES CIR 27239 PRIVATE DRIVE 1,725.73 S2843 CLYDE KING RD 27205 STATE ROAD 6,031.40 S2843 CLYDE KING RD 27341 STATE ROAD 11,666.13 P7767191 CLYDE TOOMES LN 27317 PRIVATE DRIVE 1,043.46 C0002220 CLYDESDALE DR 27263 CITY STREET 509.67 P7707323 COLD BROOK CT 27370 PRIVATE DRIVE 548.62 S1240 COLE MTN RD 27205 STATE ROAD 3,180.68 N 22S COLERIDGE RD 27316 NC HIGHWAY 5,642.97 C0001058 COLERIDGE RD 27203 CITY STREET 1,282.21 P6797499 COLLETT FARM RD 27370 PRIVATE DRIVE 926.20 S1562 COLLETT FARM RD 27370 STATE ROAD 1,143.98 S1640 COLLETTE ST 27370 STATE ROAD 550.27 P7707286 COLLINS ST 27370 PRIVATE DRIVE 338.13 S3122 COLLINS ST 27370 STATE ROAD 365.76 S1731 COLONIAL CIR 27370 STATE ROAD 4,328.01 S1840 COLONIAL CLUB DR 27360 STATE ROAD 7,496.67 S1986 COLONIAL LN 27317 STATE ROAD 435.80 S1985 COLONIAL LOOP 27317 STATE ROAD 1,639.84 S3151 COLONIAL MANOR DR 27360 STATE ROAD 1,053.48 S2719 COLONIAL RD 27205 STATE ROAD 474.21 C0002036 COLONIAL ST 27263 CITY STREET 366.93 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-16 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2407 COLONIAL TRADING PATH 27283 STATE ROAD 2,342.86 C0006107 COLONY CT 27317 CITY STREET 252.06 S1803 COLONY LN 27370 STATE ROAD 679.85 C0001059 COLONY RD 27205 CITY STREET 1,455.67 P6797521 COLORADO BLVD 27360 PRIVATE DRIVE 1,339.07 P7745433 COLTRANE CEDAR RD 27350 PRIVATE DRIVE 2,173.31 S2633 COLTRANE MEADOW RD 27316 STATE ROAD 4,930.08 S1921 COLTRANE MILL RD 27263 STATE ROAD 5,254.51 S2044 COLTRANE MILL RD 27317 STATE ROAD 4,937.39 S1921 COLTRANE MILL RD 27317 STATE ROAD 1,264.69 S1563 COLTRANE ST 27370 STATE ROAD 3,928.05 S1563 COLTRANE ST 27370 STATE ROAD 218.79 C0005011 COLUMBIA AVE 27316 CITY STREET 2,773.61 C0008003 COLUMBIA ST 27355 CITY STREET 1,621.49 C0002037 COLUMBUS AVE 27263 CITY STREET 1,059.12 C0002038 COMANCHE RD 27263 CITY STREET 2,325.10 S3102 COMMERCE PL 27203 STATE ROAD 5,711.94 C0006013 COMMERCE SQ 27317 CITY STREET 320.65 C0006102 COMMONWEALTH RD 27317 CITY STREET 7,041.10 C0006014 COMMONWEALTH ST 27317 CITY STREET 1,006.48 S2652 CONCORD CHURCH RD 27316 STATE ROAD 1,087.83 P7764168 CONE ESTATES ST 27317 PRIVATE DRIVE 525.64 S1182 CONELSON RD 27239 STATE ROAD 5,981.73 P7733353 CONFERENCE CENTER DR 27350 PRIVATE DRIVE 5,866.92 S2542 COOK COLLIER RD 27298 STATE ROAD 2,686.65 P8727150 COOK COLLIER RD EXT 27298 PRIVATE DRIVE 311.91 P7743122 COOL SHADE DR 27350 PRIVATE DRIVE 353.08 C0001060 COOL SPRING ST 27203 CITY STREET 896.79 P7794284 COOL SPRINGS CHURCH RD 27248 PRIVATE DRIVE 1,524.30 P7794285 COOL SPRINGS CHURCH RD EXT 27248 PRIVATE DRIVE 1,502.75 P7743469 COOLERS KNOB TRL 27205 PRIVATE DRIVE 923.38 S2069 COOPER FARM RD 27350 STATE ROAD 2,373.06 P7668445 COOPER RD 27205 PRIVATE DRIVE 1,732.75 C0008004 COOPER ST 27355 CITY STREET 1,015.15 C0001061 COOPER ST 27203 CITY STREET 2,068.38 P7669255 COPPERHEAD RD 27205 PRIVATE DRIVE 1,486.44 S1131 COPPLES RD 27205 STATE ROAD 1,474.75 P7666182 COPPLES RD EXT 27205 PRIVATE DRIVE 872.51 S2998 CORDIE DR 27205 STATE ROAD 559.36 C0002039 CORINA CIR 27263 CITY STREET 1,166.89 C0001062 CORNELL ST 27203 CITY STREET 961.04 C0002040 CORPORATION DR 27263 CITY STREET 3,088.31 S1226 CORTEZ RD 27205 STATE ROAD 3,225.58 P7679423 CORVETTE AVE 27205 PRIVATE DRIVE 2,166.35 C0001063 CORWITH ST 27205 CITY STREET 1,292.35 C0002198 COTTAGE CT 27263 CITY STREET 227.96 S1802 COTTAGE LN 27370 STATE ROAD 874.17 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-17 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7718313 COTTON RD 27370 PRIVATE DRIVE 700.66 P8712340 COTTONWOOD DR 27316 PRIVATE DRIVE 489.12 P7754179 COUNTRY ACRES DR 27317 PRIVATE DRIVE 2,446.81 C0001064 COUNTRY CLUB DR 27205 CITY STREET 2,151.73 C0002041 COUNTRY CT 27263 CITY STREET 457.58 P7708390 COUNTRY DREAM LN 27263 PRIVATE DRIVE 854.19 P7791247 COUNTRY ESTATES DR 27248 PRIVATE DRIVE 2,013.04 P7791248 COUNTRY ESTATES DR EXT 27248 PRIVATE DRIVE 203.90 S2647 COUNTRY FARM RD 27208 STATE ROAD 3,351.02 C0002042 COUNTRY LN 27263 CITY STREET 1,154.49 P7752116 COUNTRY LN 27205 PRIVATE DRIVE 1,965.82 S2884 COUNTRY LOOP RD 27208 STATE ROAD 11,064.94 S3201 COUNTRY MEADOWS LN 27370 STATE ROAD 1,021.40 S2325 COUNTRY PLACE RD 27203 STATE ROAD 2,826.39 S2516 COUNTRY RIDGE RD 27298 STATE ROAD 624.36 S1361 COUNTRY TRL 27205 STATE ROAD 768.07 P7657216 COUNTRYSIDE ACRES DR 27205 PRIVATE DRIVE 1,795.48 P7657217 COUNTRYSIDE CT 27205 PRIVATE DRIVE 484.25 S2267 COUNTY LAND RD 27317 STATE ROAD 5,862.59 O9999 COUNTY LINE RD 27360 OUT OF COUNTY 1,600.23 P6795518 COURTLAND CIR 27360 PRIVATE DRIVE 3,867.53 S3253 COURTLAND DR 27360 STATE ROAD 2,193.50 C0002185 COURTLAND LN 27263 CITY STREET 1,124.46 S1857 COURTNEY LN 27360 STATE ROAD 1,045.12 C0001520 COVENANT MOUNTAIN RD 27203 CITY STREET 1,548.85 S2296 COVENTRY PL 27203 STATE ROAD 661.28 S1406 COVERED BRIDGE RD 27370 STATE ROAD 12,251.46 P8737347 COWARD PICKARD LN 27298 PRIVATE DRIVE 2,015.65 C0001065 COX AVE 27205 CITY STREET 931.87 S2612 COX BROTHERS RD 27205 STATE ROAD 4,967.34 S2554 COX LN 27298 STATE ROAD 2,357.25 S2473 COX MEADOW RD 27355 STATE ROAD 3,184.86 S1115 COX MILL RD 27205 STATE ROAD 12,664.84 C0005012 COX ST 27316 CITY STREET 352.60 P7748084 COX VIEW DR 27317 PRIVATE DRIVE 471.83 C0001067 COXEMOOR PL 27205 CITY STREET 1,339.73 P7658479 COY STELLA TRL 27205 PRIVATE DRIVE 1,859.86 C0001591 CRACKLIN DR 27203 CITY STREET 317.07 P7776545 CRACKLING WOODS LN 27317 PRIVATE DRIVE 775.52 C0002043 CRAIG DR 27263 CITY STREET 805.23 S2704 CRAIG ST 27205 STATE ROAD 903.06 S1355 CRANBROOK CIR 27205 STATE ROAD 1,173.20 S1354 CRANBROOK WAY 27205 STATE ROAD 654.43 C0006015 CRANFORD ST 27317 CITY STREET 373.59 C0001068 CRANFORD ST 27203 CITY STREET 635.31 P7674194 CRASTON DR 27341 PRIVATE DRIVE 451.93 S2640 CRAVEN BRANCH RD 27344 STATE ROAD 4,517.76 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-18 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2640 CRAVEN BRANCH RD 27316 STATE ROAD 1,490.72 S2248 CRAVEN DR 27203 STATE ROAD 761.15 P7649341 CRAVEN LN 27205 PRIVATE DRIVE 1,556.67 S1544 CRAVEN PINES RD 27350 STATE ROAD 5,109.56 C0003008 CRAVEN ST 27248 CITY STREET 372.36 C0005013 CRAVEN ST 27316 CITY STREET 944.24 P7783530 CRAVENS NEST DR 27248 PRIVATE DRIVE 455.70 P7737348 CRAY DR 27263 PRIVATE DRIVE 390.90 P7737301 CRAY DR EXT 27263 PRIVATE DRIVE 389.29 S3126 CREEK DR 27350 STATE ROAD 462.37 S1376 CREEK HILLS DR 27370 STATE ROAD 1,040.27 S2134 CREEKRIDGE CTRY RD 27317 STATE ROAD 8,825.52 S1378 CREEKRIDGE DR 27205 STATE ROAD 2,725.57 P7713382 CREEKS CROSSING RD 27205 PRIVATE DRIVE 445.99 S2060 CREEKS CROSSING RD 27205 STATE ROAD 1,066.91 S2340 CREEKSIDE DR 27317 STATE ROAD 1,387.05 C0001509 CREEKSIDE DR 27203 CITY STREET 1,929.70 S1806 CREEKVIEW DR 27370 STATE ROAD 4,207.48 P7781350 CREEKWAY RDG 27205 PRIVATE DRIVE 2,454.51 C0002044 CREEKWOOD DR 27263 CITY STREET 478.37 P7783528 CREEKWOOD DR 27248 PRIVATE DRIVE 3,155.09 S2678 CREEKWOOD RD 27344 STATE ROAD 1,251.96 C0002045 CRESCENT DR 27263 CITY STREET 1,471.93 S1820 CRESENT AVE 27370 STATE ROAD 1,990.73 S2213 CRESENT DR 27203 STATE ROAD 2,191.08 S2820 CRESTVIEW CHURCH RD 27205 STATE ROAD 10,203.10 C0001069 CRESTVIEW ST 27205 CITY STREET 700.91 S2484 CRESTWICK RD 27316 STATE ROAD 5,534.48 S1769 CRESTWOOD CTRY CT 27370 STATE ROAD 683.78 S1811 CRESTWOOD DR 27263 STATE ROAD 1,727.33 S2708 CRESTWOOD LN 27205 STATE ROAD 1,264.31 S2695 CRISTY CIR 27205 STATE ROAD 638.70 S2315 CROATAN TRAIL RD 27313 STATE ROAD 1,030.55 P7787251 CROATAN TRL EXT 27313 PRIVATE DRIVE 450.02 S2381 CROOKED CREEK RD 27233 STATE ROAD 4,821.11 P6796591 CROOKED STREAM LN 27360 PRIVATE DRIVE 949.45 S2817 CROOMCREST RD 27205 STATE ROAD 1,318.66 P7608266 CROSS CREEK RD 27205 PRIVATE DRIVE 5,376.46 P7775328 CROSS LN 27248 PRIVATE DRIVE 2,010.27 C0001070 CROSS ST 27203 CITY STREET 2,675.68 S1560 CROTTS DR 27263 STATE ROAD 388.19 S1560 CROTTS DR 27263 STATE ROAD 330.89 P7724066 CROTTS EDWARDS DR 27350 PRIVATE DRIVE 1,181.93 S1196 CROW CREEK RD 27239 STATE ROAD 2,735.75 P6695320 CROW CREEK RD EXT 27239 PRIVATE DRIVE 1,361.33 O8888 CROWFLIGHT RD 27298 OUT OF COUNTY DRIVE 31.51 C0001611 CROWNE PARK AVE 27203 CITY STREET 679.13 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-19 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P8735153 CRUTCHFIELD CTRY RD 27298 PRIVATE DRIVE 2,974.19 P8708413 CRUTCHFIELD FARM RD 27298 PRIVATE DRIVE 1,542.79 S2670 CRYSTAL WOOD RD 27205 STATE ROAD 2,030.69 P7717142 CUMBY RD 27370 PRIVATE DRIVE 1,596.15 C0001554 CURRY DR 27205 CITY STREET 928.26 S2539 CURTIS INDUSTRIAL DR 27298 STATE ROAD 1,035.81 S2518 CURTIS LN 27355 STATE ROAD 4,319.84 S2876 CURTIS POWERS RD 27208 STATE ROAD 8,199.57 P7797217 CURTIS SMITH CIR 27233 PRIVATE DRIVE 509.55 C0005014 CURTIS ST 27316 CITY STREET 1,427.95 C0001071 CYPRESS DR 27205 CITY STREET 586.93 P7797408 CYPRESS LN 27233 PRIVATE DRIVE 1,768.52 P7754180 DAIRY BREEZE DR 27317 PRIVATE DRIVE 1,268.02 S2188 DAISY RD 27203 STATE ROAD 1,145.55 C0002047 DALE ST 27263 CITY STREET 939.37 C0002186 DANIEL PAUL DR 27263 CITY STREET 4,748.87 S2675 DANIEL RD 27205 STATE ROAD 1,067.79 P7708545 DANIELS CIR 27263 PRIVATE DRIVE 488.94 C0006016 DANIELS ST 27317 CITY STREET 907.35 S1162 DANNY BELL RD 27205 STATE ROAD 13,677.52 S1434 DANWOOD ST 27205 STATE ROAD 1,825.83 S1607 DARR RD 27370 STATE ROAD 2,222.19 P7717140 DARR RD EXT 27370 PRIVATE DRIVE 1,855.72 S2341 DASHWOOD DR 27313 STATE ROAD 795.68 C0001540 DAVES MTN CT 27205 CITY STREET 798.77 P7786456 DAVID ALLRED DR 27233 PRIVATE DRIVE 1,296.24 P7772470 DAVID LN 27317 PRIVATE DRIVE 499.88 C0002049 DAVID ST 27263 CITY STREET 1,246.29 P7752114 DAVIDSON CTRY LN 27205 PRIVATE DRIVE 1,136.33 S1517 DAVIDSON RD 27205 STATE ROAD 2,057.02 P7752115 DAVIDSON RD EXT 27205 PRIVATE DRIVE 884.45 C0002050 DAVIDSON ST 27263 CITY STREET 854.15 P7747303 DAVIS ACRES TRL 27317 PRIVATE DRIVE 1,726.97 S1926 DAVIS CTRY RD 27317 STATE ROAD 17,212.50 P7736337 DAVIS ESTATES ST 27350 PRIVATE DRIVE 466.95 P7747270 DAVIS FARM TRL 27317 PRIVATE DRIVE 1,240.23 P7725411 DAVIS NELSON LN 27350 PRIVATE DRIVE 1,393.20 C0006017 DAVIS ST 27317 CITY STREET 521.87 C0001072 DAVIS ST 27203 CITY STREET 942.38 C0011038 DAWN ACRES DR 27370 CITY STREET 544.56 S1777 DAWN DR 27263 STATE ROAD 814.47 S1762 DAWNWOOD DR 27370 STATE ROAD 2,516.51 S1138 DAWSON MILLER RD 27205 STATE ROAD 6,723.42 P7792453 DAWSON ST 27316 PRIVATE DRIVE 554.05 P8733098 DEAD END LN 27355 PRIVATE DRIVE 1,939.20 C0002051 DEAN DR 27263 CITY STREET 607.45 S2043 DEAN VIEW DR 27317 STATE ROAD 856.64 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-20 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0004006 DEATON CIR 27298 CITY STREET 970.52 P8735152 DEATON LANGLEY DR 27298 PRIVATE DRIVE 494.49 C0002052 DEATON RD 27370 CITY STREET 1,502.09 S1568 DEATON RD 27370 STATE ROAD 3,625.16 P8724347 DEBRA DR 27298 PRIVATE DRIVE 598.11 S2712 DEEP RIVER CHURCH RD 27316 STATE ROAD 12,067.49 P7605369 DEER FOREST LN 27239 PRIVATE DRIVE 1,928.84 P7638235 DEER RIDGE RD 27205 PRIVATE DRIVE 636.85 S2953 DEER RUN LN 27205 STATE ROAD 311.76 P7721450 DEER TRACK RD 27205 PRIVATE DRIVE 1,614.31 P6695470 DEER TRAIL DR 27239 PRIVATE DRIVE 6,142.96 S2731 DEERBERRY CT 27205 STATE ROAD 828.22 S2100 DEERFIELD CTRY RD 27317 STATE ROAD 3,663.50 C0002242 DEERFIELD PL 27263 CITY STREET 386.28 S1379 DEERHORN CT 27205 STATE ROAD 751.37 S2358 DEERRUN DR 27317 STATE ROAD 3,837.13 P7717430 DEERWOOD LN 27370 PRIVATE DRIVE 2,308.51 P8629009 DELBERT LN 27344 PRIVATE DRIVE 436.06 C0001073 DELLWOOD AVE 27203 CITY STREET 992.47 C0002053 DELLWOOD ST 27263 CITY STREET 1,440.57 C0002231 DELTA CT 27263 CITY STREET 322.78 P7775325 DELTA DR 27317 PRIVATE DRIVE 941.57 S1699 DELWOOD DR 27263 STATE ROAD 883.58 S1781 DENISE DR 27370 STATE ROAD 1,293.15 C0001074 DENNIS ST 27205 CITY STREET 1,134.06 P7774401 DENNY DR 27317 PRIVATE DRIVE 685.89 P7774401 DENNY DR 27248 PRIVATE DRIVE 589.08 C0006018 DEPOT ST 27317 CITY STREET 2,638.18 C0003009 DEPOT ST 27248 CITY STREET 2,034.87 C0005015 DEPOT ST 27316 CITY STREET 374.70 C0003010 DEPOT ST EXT 27248 CITY STREET 576.03 C0011019 DERBY WAY 27370 CITY STREET 1,589.66 S3251 DESTIN DR 27370 STATE ROAD 592.77 P7724271 DEVIE CANOY DR 27350 PRIVATE DRIVE 2,530.58 P8716234 DEVINEY KIRKMAN DR 27298 PRIVATE DRIVE 1,159.58 S2520 DEVINEY RD 27283 STATE ROAD 1,305.64 S2256 DEWEY RD 27203 STATE ROAD 1,696.08 P7737492 DEWITT COLTRANE DR 27263 PRIVATE DRIVE 938.69 P8635008 DEWITT CTRY LN 27208 PRIVATE DRIVE 1,305.90 S1219 DINAH RD 27205 STATE ROAD 912.16 P7658159 DINAH RD EXT 27205 PRIVATE DRIVE 192.08 S1632 DIXIE PL 27260 STATE ROAD 846.94 C0001076 DIXON AVE 27203 CITY STREET 1,531.12 C0001077 DIXON ST 27203 CITY STREET 548.94 C0005016 DIXON ST 27316 CITY STREET 1,489.44 P8702231 DIXON TILLEY RD 27316 PRIVATE DRIVE 838.24 S2653 DOC HAYWORTH RD 27316 STATE ROAD 6,434.36 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-21 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P8734514 DOE RUN TRL 27355 PRIVATE DRIVE 1,320.32 P8734514 DOE RUN TRL 27355 PRIVATE DRIVE 1,672.99 P6798154 DOGWOOD BLOSSOM CT 27360 PRIVATE DRIVE 519.96 S3157 DOGWOOD CIR 27360 STATE ROAD 444.46 C0004008 DOGWOOD DR 27298 CITY STREET 1,308.40 S2268 DOGWOOD DR 27317 STATE ROAD 1,838.48 P7707227 DOGWOOD HEIGHTS LN 27370 PRIVATE DRIVE 886.25 C0002212 DOGWOOD LN 27263 CITY STREET 1,499.11 P7760548 DOGWOOD ST 27205 PRIVATE DRIVE 1,412.04 S3117 DOGWOOD TRL 27205 STATE ROAD 1,820.75 P8725113 DOGWOOD WAY 27355 PRIVATE DRIVE 520.00 C0002054 DON AVE 27370 CITY STREET 1,529.47 S2996 DONNA RD 27205 STATE ROAD 1,077.21 P7727201 DONNA VIEW DR 27263 PRIVATE DRIVE 685.08 P7748443 DONNYBROOK RD 27317 PRIVATE DRIVE 1,061.28 C0001078 DOOLEY DR 27203 CITY STREET 1,252.39 P7689427 DORIS ACRES ST 27205 PRIVATE DRIVE 937.43 C0002055 DORSETT ST 27263 CITY STREET 402.15 P7659548 DOT DR 27205 PRIVATE DRIVE 2,239.90 P7788512 DOTTIE COX DR 27313 PRIVATE DRIVE 1,528.78 P8705323 DOUGLAS DR 27248 PRIVATE DRIVE 459.16 S1199 DOUL MTN RD 27205 STATE ROAD 3,612.80 C0002056 DOVE MEADOWS DR 27263 CITY STREET 3,011.87 P7792454 DOVE VIEW ST 27316 PRIVATE DRIVE 1,655.46 P7774419 DOVER RD EXT 27317 PRIVATE DRIVE 441.65 C0001080 DOVER ST 27203 CITY STREET 854.42 S3008 DRAGONFLY LN 27205 STATE ROAD 491.09 P7766472 DRAKE CT 27317 PRIVATE DRIVE 197.97 C0001081 DRAPER ST 27203 CITY STREET 2,400.56 S1738 DRIFTWOOD DR 27263 STATE ROAD 2,680.15 S1247 DRUM ST 27205 STATE ROAD 1,108.44 C0001082 DUBLIN RD 27203 CITY STREET 2,982.94 P7760156 DUBLIN RD EXT 27203 PRIVATE DRIVE 286.55 C0001422 DUBLIN SQUARE RD 27203 CITY STREET 983.00 P8702118 DUCKWORTH COX RD 27316 PRIVATE DRIVE 1,152.85 C0001083 DUMONT ST 27203 CITY STREET 598.33 S1171 DUNBAR BRIDGE RD 27205 STATE ROAD 7,844.10 P7761484 DUNBAR ST 27203 PRIVATE DRIVE 156.34 S2316 DUNBAR ST 27203 STATE ROAD 666.63 P8725506 DUNCAN FARM RD 27298 PRIVATE DRIVE 1,381.65 S1448 DUNDEE ST 27205 STATE ROAD 1,803.67 C0001084 DUNLAP ST 27203 CITY STREET 1,541.86 C0001511 DUNWOODY CT 27203 CITY STREET 620.84 P7669363 DUSTY PATH DR 27205 PRIVATE DRIVE 2,010.07 P6796590 DUSTY ROCK DR 27360 PRIVATE DRIVE 1,158.79 P8634004 DUSTY TRAIL RD 27208 PRIVATE DRIVE 3,039.56 S1884 DWIGHT ST 27370 STATE ROAD 579.55 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-22 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7724275 DYLAN LN 27350 PRIVATE DRIVE 1,303.76 C0002188 DYLAN SCOTT DR 27263 CITY STREET 677.34 S2045 DYNASTY DR 27205 STATE ROAD 1,243.67 C0001085 E ACADEMY ST 27203 CITY STREET 1,217.42 C0006019 E ACADEMY ST 27317 CITY STREET 2,185.45 S2182 E ALLRED ST 27203 STATE ROAD 8,313.71 C0001086 E ALLRED ST 27203 CITY STREET 2,141.29 C0001087 E BAILEY ST 27203 CITY STREET 1,725.60 C0001088 E BALFOUR AVE 27203 CITY STREET 2,353.07 C0001089 E BEASLEY ST 27203 CITY STREET 872.64 C0004009 E BROOKWOOD AVE 27298 CITY STREET 2,423.07 C0004010 E BROWER AVE 27298 CITY STREET 1,163.62 C0006021 E BROWN ST 27317 CITY STREET 4,145.66 C0004011 E BUTLER AVE 27298 CITY STREET 4,311.41 C0001090 E CENTRAL AVE 27203 CITY STREET 3,507.60 C0001577 E CHAMBERLIN DR 27205 CITY STREET 2,045.17 C0004012 E DAMERON AVE 27298 CITY STREET 3,012.89 U 64BUS E DIXIE DR 27203 US HIGHWAY 13,149.78 C0001079 E DORSETT AVE 27203 CITY STREET 2,928.50 C0008006 E FRANKLINVILLE ST 27355 CITY STREET 2,942.89 C0004013 E FRAZIER AVE 27298 CITY STREET 2,143.40 C0004031 E GRAHAM AVE 27298 CITY STREET 518.59 C0004032 E GRANDVIEW AVE 27298 CITY STREET 1,234.96 C0004035 E HIGH AVE 27298 CITY STREET 586.52 C0004014 E HIGHFILL AVE 27298 CITY STREET 2,081.63 C0005017 E JONES ST 27316 CITY STREET 496.94 C0004015 E KIME AVE 27298 CITY STREET 2,964.85 C0007005 E KING AVE 27341 CITY STREET 1,083.58 C0001093 E KIVETT ST 27203 CITY STREET 3,167.18 C0004016 E LOWE AVE 27298 CITY STREET 1,965.68 C0004017 E LUTHER AVE 27298 CITY STREET 1,620.21 N 705 E MAIN ST 27341 NC HIGHWAY 3,631.87 N 22N E MAIN ST 27248 NC HIGHWAY 3,612.36 C0001214 E MILLER ST 27203 CITY STREET 330.56 C0001094 E MINE ST 27205 CITY STREET 1,303.92 C0004018 E MOFFITT AVE 27298 CITY STREET 414.49 C0006022 E NAOMI ST 27317 CITY STREET 5,416.27 C0004019 E NEWBERRY AVE 27298 CITY STREET 465.12 C0004020 E PATTERSON AVE 27298 CITY STREET 970.39 S2345 E PRESNELL ST 27203 STATE ROAD 10,841.60 C0001095 E PRESNELL ST 27203 CITY STREET 4,174.01 C0001096 E PRITCHARD ST 27203 CITY STREET 3,842.45 C0004021 E RALEIGH AVE 27298 CITY STREET 3,416.29 C0004056 E RIDGE AVE 27298 CITY STREET 2,074.05 C0005018 E RIDGE ST 27316 CITY STREET 1,233.46 C0006023 E RIVER DR 27317 CITY STREET 1,006.12 S1890 E RIVER RUN 27205 STATE ROAD 697.21 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-23 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7742399 E RIVER RUN EXT 27205 PRIVATE DRIVE 874.78 N 42N E SALISBURY ST 27203 NC HIGHWAY 4,944.51 S2237 E SALISBURY ST 27203 STATE ROAD 4,468.26 C0001097 E SALISBURY ST 27203 CITY STREET 991.14 C0004022 E STARMOUNT AVE 27298 CITY STREET 1,565.88 C0001098 E STRIDER ST 27203 CITY STREET 926.19 C0011020 E SUNRISE AVE 27360 CITY STREET 1,801.40 N 49N E SWANNANOA AVE 27298 NC HIGHWAY 3,364.22 C0001533 E TAFT AVE 27203 CITY STREET 686.84 C0004024 E TEAGUE AVE 27298 CITY STREET 2,323.87 C0001099 E WAINMAN AVE 27203 CITY STREET 1,168.37 C0001535 E WALKER AVE 27203 CITY STREET 1,211.99 C0001100 E WARD ST 27203 CITY STREET 1,515.30 C0002059 E WHITE DR 27263 CITY STREET 1,436.63 S1265 EAGLE CHASE RD 27205 STATE ROAD 1,110.12 S3249 EAGLE LANDING DR 27370 STATE ROAD 2,753.86 S3270 EAGLE NEST CT 27370 STATE ROAD 897.56 C0001615 EAGLE OAKS LN 27205 CITY STREET 1,144.37 S2955 EAGLE PASS RD 27205 STATE ROAD 717.70 S3269 EAGLE POINT DR 27370 STATE ROAD 2,375.36 P7625385 EAGLES FIELD RD 27205 PRIVATE DRIVE 6,429.34 S2659 EARL BROWN RD 27205 STATE ROAD 2,177.06 S1943 EARL JOHNSON RD 27350 STATE ROAD 3,742.33 P8708098 EARL TRL 27283 PRIVATE DRIVE 2,121.07 S1539 EARNHARDT RD 27205 STATE ROAD 11,234.84 S1539 EARNHARDT RD 27350 STATE ROAD 3,102.45 P7705208 EASEMENT DR 27370 PRIVATE DRIVE 663.72 C0007007 EAST AVE 27341 CITY STREET 1,472.36 C0003012 EAST BEND ST 27248 CITY STREET 1,524.89 S2920 EAST DR 27205 STATE ROAD 1,610.64 P7695568 EAST FORK DR 27341 PRIVATE DRIVE 4,390.21 C0006024 EAST ST 27317 CITY STREET 275.48 C0001101 EAST ST 27203 CITY STREET 347.46 S2481 EASTERN RANDOLPH RD 27316 STATE ROAD 6,606.96 C0001609 EASTON EXT 27205 CITY STREET 225.01 C0001102 EASTVIEW DR 27203 CITY STREET 2,188.21 P8711179 EASTVIEW LN 27316 PRIVATE DRIVE 530.41 S1668 EASTWARD AVE 27260 STATE ROAD 693.48 P6799396 EASTWARD AVE EXT 27260 PRIVATE DRIVE 327.73 C0002230 EASTWIND DR 27263 CITY STREET 1,102.14 S2940 EASTWOOD DR 27205 STATE ROAD 1,528.11 S1998 EBB SHORE DR 27263 STATE ROAD 1,542.78 S1925 EBENEZER CHURCH RD 27263 STATE ROAD 2,206.32 P7710101 ECHO RDG 27205 PRIVATE DRIVE 1,012.54 C0001103 ECKERD ST 27203 CITY STREET 1,511.56 P7757405 ED DAVIS LN 27317 PRIVATE DRIVE 768.45 P7743007 EDEN FOREST DR 27350 PRIVATE DRIVE 946.89 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-24 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0002060 EDEN TER 27263 CITY STREET 6,224.04 S1526 EDGAR RD 27263 STATE ROAD 4,377.36 S1526 EDGAR RD 27350 STATE ROAD 17,164.61 P7737351 EDGAR VIEW DR 27263 PRIVATE DRIVE 683.67 C0001575 EDGE CT 27205 CITY STREET 156.67 P7716477 EDGE FARM LN 27370 PRIVATE DRIVE 543.40 C0002251 EDGEWOOD CT 27263 CITY STREET 155.69 P6797497 EDGEWOOD DR 27370 PRIVATE DRIVE 441.11 C0004025 EDGEWOOD DR 27298 CITY STREET 1,286.41 C0001104 EDGEWOOD RD 27205 CITY STREET 1,949.75 P7665294 EDGEWOOD VIEW DR 27205 PRIVATE DRIVE 591.66 C0006025 EDITH RUSSELL RD 27317 CITY STREET 1,384.38 P7748080 EDMONDS TRL 27263 PRIVATE DRIVE 822.01 S1209 EDNA ST 27205 STATE ROAD 1,498.95 P7737349 EDWARD WALKER ST 27263 PRIVATE DRIVE 810.17 S2624 EDWARDS FARM RD 27316 STATE ROAD 1,855.84 C0008007 EDWARDS ST 27355 CITY STREET 1,097.89 S2313 EFFIE ST 27317 STATE ROAD 429.31 C0002002 ELAINE ST 27370 CITY STREET 1,990.93 C0005019 ELAM AVE 27316 CITY STREET 3,656.74 P7699427 ELBERT BRADY RD 27205 PRIVATE DRIVE 305.43 P8604174 ELBERT DAVIS RD 27341 PRIVATE DRIVE 1,170.33 P7781563 ELDERBERRY CT 27205 PRIVATE DRIVE 520.57 S2919 ELDORADO RD 27205 STATE ROAD 2,454.95 P7649444 ELEANOR ANNE LN 27205 PRIVATE DRIVE 663.51 S1106 ELEAZER CHURCH RD 27371 STATE ROAD 5,338.60 C0005059 ELIZABETH ST 27316 CITY STREET 578.95 C0002241 ELK HORN CT 27263 CITY STREET 353.37 S2301 ELK RD 27317 STATE ROAD 1,487.20 P7737491 ELKES PL 27263 PRIVATE DRIVE 783.75 P6797214 ELLEN AVE 27263 PRIVATE DRIVE 2,837.19 P7791145 ELLIOTT BROWN TRL 27248 PRIVATE DRIVE 2,078.14 C0002062 ELLIOTT ST 27263 CITY STREET 848.76 S1932 ELMER BEESON RD 27263 STATE ROAD 2,524.86 S1757 ELMONT ST 27263 STATE ROAD 1,268.57 S1656 ELMWOOD ST 27370 STATE ROAD 2,788.23 P8706295 ELNORA DR 27298 PRIVATE DRIVE 1,056.28 P7750105 ELWOOD STOUT ST 27205 PRIVATE DRIVE 827.47 P8713371 ELWORTH DR 27316 PRIVATE DRIVE 296.41 C0002267 EMERALD CT 27370 CITY STREET 423.99 S2557 EMERALD DR 27298 STATE ROAD 2,249.83 P7795189 EMERALD FARM RD 27233 PRIVATE DRIVE 2,927.38 S1325 EMERALD ROCK RD 27205 STATE ROAD 3,186.27 C0001105 EMERSON DR 27205 CITY STREET 986.32 S1129 EMMANUEL CHURCH RD 27205 STATE ROAD 2,334.65 S1756 ENFIELD DR 27263 STATE ROAD 696.63 C0002063 ENGLEWOOD DR 27263 CITY STREET 2,910.17 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-25 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1687 ENGLEWOOD DR 27203 STATE ROAD 1,193.14 C0002196 ENGLISH CT 27370 CITY STREET 681.13 C0002259 ENGLISH FARM RD 27370 CITY STREET 713.85 C0011021 ENGLISH PRIDE DR 27370 CITY STREET 2,083.83 C0001106 ENGLISH ST 27203 CITY STREET 994.61 C0008008 ENTERPRISE ST 27355 CITY STREET 774.51 C0001107 ENTERPRISE ST 27205 CITY STREET 441.15 P7679429 ENZO LN 27205 PRIVATE DRIVE 75.01 S1003 ERECT RD 27316 STATE ROAD 9,135.80 S1003 ERECT RD 27341 STATE ROAD 36,793.33 C0002206 ERICA DR 27263 CITY STREET 1,100.79 S1741 ERIK DR 27370 STATE ROAD 1,528.05 P7774498 ERMINE ST 27317 PRIVATE DRIVE 1,272.28 P7774498 ERMINE ST 27317 PRIVATE DRIVE 573.51 S2227 ERNEST RD 27203 STATE ROAD 1,131.21 S1271 ERVIN LN 27205 STATE ROAD 611.37 C0002229 ESSEX SQ 27263 CITY STREET 169.80 S2274 ESSEX TRL 27313 STATE ROAD 1,593.48 P7740328 ETHAN CT 27205 PRIVATE DRIVE 515.73 P7645530 ETHAN SPRINGS RD 27205 PRIVATE DRIVE 885.46 S2258 ETON AVE 27203 STATE ROAD 1,259.91 S2029 ETTA CT 27350 STATE ROAD 439.30 P7736334 EUGENE ESTATE DR 27350 PRIVATE DRIVE 865.43 S1896 EUGENE ST 27350 STATE ROAD 1,245.81 P7767282 EVANS CEDAR LN 27317 PRIVATE DRIVE 3,802.07 P7703476 EVANS DR 27370 PRIVATE DRIVE 309.28 S3192 EVANS DR 27370 STATE ROAD 359.45 C0006118 EVANS TRL 27317 CITY STREET 502.76 P7706274 EVELYN DR 27370 PRIVATE DRIVE 2,063.69 P7787298 EVELYN LN 27313 PRIVATE DRIVE 2,955.97 P7735019 EVELYN ST 27350 PRIVATE DRIVE 854.74 C0011033 EVELYN VIEW DR 27263 CITY STREET 706.93 P7625429 EVENING SHADE RD 27371 PRIVATE DRIVE 3,406.56 P7797410 EVERGREEN CT 27233 PRIVATE DRIVE 457.04 S3107 EVERGREEN DR 27370 STATE ROAD 5,346.07 P7708471 EWINGS ST 27370 PRIVATE DRIVE 1,180.02 C0001530 EXECUTIVE WAY 27203 CITY STREET 607.52 P7777240 EZRA DR 27313 PRIVATE DRIVE 1,651.90 C0001108 FAIRFAX CT 27203 CITY STREET 163.24 C0001109 FAIRFIELD ST 27203 CITY STREET 260.10 S1566 FAIRVIEW CHURCH RD 27370 STATE ROAD 20,215.57 S1754 FAIRVIEW CT 27370 STATE ROAD 1,160.65 S1751 FAIRVIEW DR 27370 STATE ROAD 1,182.88 S1752 FAIRVIEW DR EXT 27370 STATE ROAD 1,159.53 S2832 FAIRVIEW FARM RD 27205 STATE ROAD 27,639.39 S1753 FAIRVIEW LN 27370 STATE ROAD 968.64 C0001110 FAIRWAY RD 27205 CITY STREET 1,612.74 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-26 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7755484 FAIRWAY VIEW DR 27317 PRIVATE DRIVE 1,944.68 S1763 FAIRWOOD DR 27370 STATE ROAD 2,029.52 S1205 FAIRWOOD TRL 27205 STATE ROAD 1,074.87 S3002 FAITH MEADOWS LN 27205 STATE ROAD 1,372.55 C0003050 FAITH ROCK RD 27248 CITY STREET 1,708.72 S2207 FAITH ROCK RD 27248 STATE ROAD 8,750.90 P7773208 FAITH WAY TRL 27317 PRIVATE DRIVE 928.32 S2322 FALCON DR 27313 STATE ROAD 1,468.95 P7771332 FALCON HILLS DR 27205 PRIVATE DRIVE 526.61 C0011008 FALCON WAY 27370 CITY STREET 1,144.79 S1166 FALLING OAK RD 27205 STATE ROAD 2,340.67 S2280 FARLEY DR 27317 STATE ROAD 2,055.61 S2857 FARLOW CORNER RD 27341 STATE ROAD 1,521.08 P7747077 FARLOW FARM RD 27263 PRIVATE DRIVE 1,581.01 S2971 FARLOW LAKE CT 27205 STATE ROAD 1,073.90 S1541 FARLOW MEADOW RD 27350 STATE ROAD 3,450.50 P7725097 FARLOW PINES DR 27350 PRIVATE DRIVE 964.55 S3194 FARLOW ST 27263 STATE ROAD 1,416.74 P7736030 FARLOWE DAVIS DR 27350 PRIVATE DRIVE 2,143.83 S1865 FARMBROOK PL 27360 STATE ROAD 1,226.67 P7782270 FARMCREEK DR 27248 PRIVATE DRIVE 1,948.10 S1369 FARMER CT 27239 STATE ROAD 1,953.84 S1001 FARMER DENTON RD 27239 STATE ROAD 31,898.80 C0001111 FARMER RD 27203 CITY STREET 2,122.29 P8737464 FARMHOUSE RD 27298 PRIVATE DRIVE 2,559.21 S2898 FARMSTEAD RD 27341 STATE ROAD 6,821.22 P7639449 FARMWOOD LN 27205 PRIVATE DRIVE 523.91 S3304 FARMWOOD LN 27205 STATE ROAD 1,127.61 C0001112 FARR ST 27203 CITY STREET 1,559.08 P7724062 FAW DR 27350 PRIVATE DRIVE 1,468.64 P7742411 FAWN DR 27205 PRIVATE DRIVE 1,421.17 S2051 FEATHERSTONE CT 27370 STATE ROAD 1,050.54 S2651 FELLOWSHIP RD 27316 STATE ROAD 778.14 P7797407 FERGUSON FARM LN 27298 PRIVATE DRIVE 1,336.75 S2479 FERGUSON RD 27298 STATE ROAD 8,488.79 S2479 FERGUSON RD 27316 STATE ROAD 11,615.22 C0006026 FERGUSON ST 27317 CITY STREET 761.46 C0001113 FERMER RD 27203 CITY STREET 1,004.79 S2250 FERN DR 27203 STATE ROAD 1,059.15 C0007030 FERNANDEZ LOOP 27341 CITY STREET 791.65 S1808 FERNWOOD DR 27263 STATE ROAD 464.41 P7743004 FERNWOOD FOREST RD 27350 PRIVATE DRIVE 807.65 P7679424 FERRARI DR 27205 PRIVATE DRIVE 2,000.11 C0006027 FERREE ST 27317 CITY STREET 869.88 C0001412 FESMIRE ST 27205 CITY STREET 1,155.66 P7637237 FIDDLERS CREEK RD 27205 PRIVATE DRIVE 4,482.09 S2716 FIELDCREST CT 27205 STATE ROAD 1,277.39 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-27 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P8619375 FIELDS COX RD 27316 PRIVATE DRIVE 1,381.95 P7763124 FIFTH PARK AVE 27317 PRIVATE DRIVE 1,271.18 S2608 FILLER RD 27205 STATE ROAD 2,771.07 P7780238 FILLER RD EXT 27205 PRIVATE DRIVE 767.68 S1547 FINCH FARM RD 27370 STATE ROAD 35,785.68 C0001587 FINCHLEY CT 27203 CITY STREET 967.84 S1194 FIRE FIGHTER RD 27239 STATE ROAD 2,183.03 S1398 FIRESIDE CT 27205 STATE ROAD 266.36 P6798302 FIRST HEIGHTS DR 27263 PRIVATE DRIVE 417.60 P7763120 FIRST PARK AVE 27317 PRIVATE DRIVE 1,533.45 C0001114 FIRST ST 27205 CITY STREET 1,647.81 P7750107 FISHER CIR 27205 PRIVATE DRIVE 1,505.35 P6792101 FLAKE BRILES RD 27370 PRIVATE DRIVE 1,668.38 S2886 FLAT CREEK RD 27208 STATE ROAD 10,485.09 P8625102 FLAT CREEK RD 27208 PRIVATE DRIVE 1,114.26 S2827 FLETA BROWN RD 27205 STATE ROAD 3,365.00 P8705120 FLINCHUM FARM RD 27298 PRIVATE DRIVE 1,439.82 S1004 FLINT HILL RD 27350 STATE ROAD 18,808.59 C0001115 FLINT ST 27203 CITY STREET 1,755.26 S2644 FLIPPIN RD 27208 STATE ROAD 2,040.05 P7716496 FLORA MAE LN 27370 PRIVATE DRIVE 1,018.95 C0010009 FLORIDA DR 27360 CITY STREET 1,294.14 P7740231 FLOYD DR 27205 PRIVATE DRIVE 923.77 S2425 FLYNT RD 27298 STATE ROAD 8,813.53 P7657378 FOGGY MTN RD 27205 PRIVATE DRIVE 3,721.75 P7772162 FOGGY TOP RD 27317 PRIVATE DRIVE 748.54 C0006100 FOGLEMAN LN 27317 CITY STREET 329.98 S2405 FOLGER RD 27283 STATE ROAD 2,303.28 P7737195 FOLWELL DR 27263 PRIVATE DRIVE 1,131.93 S3010 FOOTHILLS DR 27205 STATE ROAD 555.81 C0001508 FOREST BROOK CIR 27203 CITY STREET 4,672.38 S2244 FOREST DR 27317 STATE ROAD 2,463.37 C0004028 FOREST DR 27298 CITY STREET 372.47 P7763135 FOREST EAST LN 27317 PRIVATE DRIVE 1,548.88 P7764264 FOREST ESTATES DR 27317 PRIVATE DRIVE 772.78 P7715147 FOREST GROVE DR 27370 PRIVATE DRIVE 1,017.85 S2283 FOREST HAVEN DR 27233 STATE ROAD 2,041.86 P7636200 FOREST HILLS DR 27205 PRIVATE DRIVE 1,995.53 S1248 FOREST HILLS DR 27205 STATE ROAD 2,109.64 P7713375 FOREST LAKE DR 27205 PRIVATE DRIVE 1,571.96 S3116 FOREST LAKE DR 27205 STATE ROAD 944.31 S1383 FOREST LN 27205 STATE ROAD 655.47 S1899 FOREST MANOR DR 27370 STATE ROAD 2,180.50 S1250 FOREST OAKS DR 27205 STATE ROAD 635.94 S2150 FOREST PARK DR 27317 STATE ROAD 4,941.38 C0001116 FOREST PARK DR 27203 CITY STREET 2,151.89 S3178 FOREST TRL 27350 STATE ROAD 1,863.04 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-28 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2701 FOREST VALLEY DR 27205 STATE ROAD 810.24 P8702320 FORESTVIEW ST 27316 PRIVATE DRIVE 499.61 C0002171 FORESTWOOD DR 27263 CITY STREET 1,056.47 S1002 FORK CREEK MILL RD 27341 STATE ROAD 41,460.65 S2932 FOSTER ST 27205 STATE ROAD 2,113.67 P7748083 FOSTER VIEW DR 27317 PRIVATE DRIVE 815.77 C0002065 FOUNTAIN ST 27263 CITY STREET 744.87 P7763123 FOURTH PARK AVE 27317 PRIVATE DRIVE 894.38 S2621 FOUSHEE RD 27316 STATE ROAD 15,749.94 C0005021 FOUSHEE RD 27316 CITY STREET 546.10 C0008009 FOUSHEE ST 27355 CITY STREET 3,277.58 P8736356 FOUST ACRES DR 27298 PRIVATE DRIVE 268.96 S2961 FOUST DR 27205 STATE ROAD 706.21 S2439 FOUST RD 27355 STATE ROAD 10,755.81 C0001119 FOUST ST 27203 CITY STREET 1,179.53 C0011003 FOX CHASE DR 27370 CITY STREET 2,149.66 P7763226 FOX CTRY RD 27317 PRIVATE DRIVE 3,996.53 P7657489 FOX DR 27205 PRIVATE DRIVE 985.13 S2535 FOX GROVE RD 27316 STATE ROAD 712.37 P7765256 FOX HOLLOW LN 27317 PRIVATE DRIVE 2,786.64 S3175 FOX HUNT CT 27360 STATE ROAD 301.71 S1743 FOX MEADOW RD 27370 STATE ROAD 864.57 P7638232 FOX RIDGE RD 27205 PRIVATE DRIVE 2,563.92 P7790135 FOX RUN DR 27205 PRIVATE DRIVE 3,511.79 P6783442 FOX RUN VIEW LN 27370 PRIVATE DRIVE 2,870.10 C0006028 FOX ST 27317 CITY STREET 2,920.67 S2117 FOX ST 27317 STATE ROAD 2,576.36 C0002066 FOXBORO CT 27370 CITY STREET 287.63 S1239 FOXBURROW RD 27205 STATE ROAD 871.08 S1519 FOXFIELD RD 27350 STATE ROAD 1,320.71 S2611 FOXFIRE RD 27205 STATE ROAD 15,872.05 C0006120 FOXWOOD CT 27317 CITY STREET 484.20 S2222 FOXWORTH RD 27203 STATE ROAD 3,587.94 C0004029 FRANCES DR 27298 CITY STREET 1,259.34 C0001120 FRANCIS ST 27203 CITY STREET 607.45 P7656310 FRANK LAMB DR 27205 PRIVATE DRIVE 1,784.05 S2531 FRANK LN 27233 STATE ROAD 687.89 S1224 FRANK RD 27205 STATE ROAD 1,964.60 P7727250 FRANK WHITE DR 27263 PRIVATE DRIVE 780.53 S1225 FRANKIE TRL 27205 STATE ROAD 922.47 P7773582 FRANKLIN DR 27317 PRIVATE DRIVE 3,870.97 S2393 FRANKLIN HILLS CT 27317 STATE ROAD 1,925.49 C0001121 FRANKS ST 27203 CITY STREET 1,501.05 C0001601 FRANKTON CT 27205 CITY STREET 304.32 P7755390 FRAZIER CTRY DR 27350 PRIVATE DRIVE 833.09 S1923 FRAZIER MARSH RD 27263 STATE ROAD 3,410.01 S2631 FRAZIER RD 27316 STATE ROAD 7,355.05 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-29 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0001122 FRAZIER ST 27203 CITY STREET 530.91 C0002067 FRAZIER ST 27263 CITY STREET 1,234.67 S2049 FRAZIER VIEW RD 27317 STATE ROAD 1,736.84 S2392 FRED EAST LN 27313 STATE ROAD 1,490.24 P7746396 FRED FRANK TRL 27350 PRIVATE DRIVE 1,110.52 S2113 FRED LINEBERRY RD 27317 STATE ROAD 14,282.19 P7776127 FRED LINEBERRY RD EXT 27317 PRIVATE DRIVE 983.70 C0001123 FREEDOM DR 27203 CITY STREET 421.84 P7669468 FREEDOM STATE ST 27205 PRIVATE DRIVE 746.16 S2994 FREEDOM TRL 27205 STATE ROAD 1,043.96 C0002068 FREEMAN PL 27263 CITY STREET 1,442.38 C0006029 FREEMAN ST 27317 CITY STREET 463.21 C0010005 FREEMONT CT 27360 CITY STREET 544.14 C0010004 FREEMONT DR 27360 CITY STREET 2,481.07 S1159 FRIENDLY ACRES RD 27205 STATE ROAD 2,919.11 S1213 FRIENDLY CIR 27205 STATE ROAD 417.52 S2537 FRIENDLY LN 27316 STATE ROAD 815.48 C0001501 FRIENDLY RD 27203 CITY STREET 452.42 C0002199 FRIENDS LN 27263 CITY STREET 668.48 P7716494 FRIENDSHIP LN 27370 PRIVATE DRIVE 545.06 P7656311 FRIENDSHIP RD 27205 PRIVATE DRIVE 1,467.02 P7701514 FRITZ FARM RD 27370 PRIVATE DRIVE 4,215.16 C0002069 FRONTIER ST 27263 CITY STREET 687.22 P7753373 FRYE FARMS RD 27205 PRIVATE DRIVE 1,547.76 P7717239 FRYE ST 27370 PRIVATE DRIVE 1,496.82 S1547 FULLER MILL RD N 27360 STATE ROAD 19,030.78 S1404 FULLER MILL RD N 27370 STATE ROAD 10,268.96 S1404 FULLER MILL RD N 27360 STATE ROAD 8,933.64 S1404 FULLER MILL RD S 27370 STATE ROAD 798.78 P7657379 FULTON RD 27205 PRIVATE DRIVE 2,116.16 C0009004 GABLE ST 27260 CITY STREET 1,132.53 P6783440 GADDY CIR 27360 PRIVATE DRIVE 645.44 S3108 GADDY DR 27370 STATE ROAD 1,169.39 C0002070 GAITHER CT 27263 CITY STREET 687.99 S1312 GALLIMORE DAIRY RD 27239 STATE ROAD 16,824.70 P7764261 GALLIMORE DR 27317 PRIVATE DRIVE 375.29 S1390 GALLIMORE TOWN RD 27370 STATE ROAD 8,175.87 C0002218 GALLOP WAY 27263 CITY STREET 238.26 C0001124 GALWAY PL 27203 CITY STREET 528.35 C0001125 GANT ST 27203 CITY STREET 697.55 S1792 GARDENGATE RD 27205 STATE ROAD 1,573.75 C0001126 GARDINER RD 27203 CITY STREET 777.29 S1349 GARNER FARM RD 27205 STATE ROAD 1,651.24 S1302 GARNER LN 27239 STATE ROAD 2,364.63 P7674192 GARNER MASHBURN DR 27341 PRIVATE DRIVE 551.21 C0007008 GARNER ST 27341 CITY STREET 720.72 C0002071 GARRELL ST 27263 CITY STREET 2,208.21 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-30 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1332 GARREN TOWN RD 27205 STATE ROAD 22,736.68 P8704209 GARY MCMASTERS RD 27298 PRIVATE DRIVE 1,317.99 P7755387 GARYDALE DR 27350 PRIVATE DRIVE 951.03 S3140 GATE DR 27360 STATE ROAD 1,132.28 P7736018 GATEWOOD AVE 27350 PRIVATE DRIVE 636.38 P8615501 GATLIN CTRY DR 27341 PRIVATE DRIVE 619.06 S1708 GEARREN ST 27205 STATE ROAD 627.14 P7667338 GEFFEN LN 27205 PRIVATE DRIVE 1,135.44 P7792458 GEMSTONE CT 27248 PRIVATE DRIVE 426.29 P7774392 GENE ALLRED DR 27317 PRIVATE DRIVE 721.34 P7666183 GENTRY ACRES RD 27205 PRIVATE DRIVE 824.20 P7763415 GEORGE CONNOR RD 27317 PRIVATE DRIVE 501.64 S2132 GEORGE YORK RD 27317 STATE ROAD 12,909.22 S2281 GEORGIA DR 27317 STATE ROAD 3,254.83 P8733003 GERTRUDE DR 27355 PRIVATE DRIVE 1,039.57 S2906 GERTRUDE LOOP RD 27341 STATE ROAD 3,782.51 P7697372 GERTRUDE LOOP RD EXT 27341 PRIVATE DRIVE 295.36 S3132 GIANT OAKS CT 27350 STATE ROAD 380.84 S3131 GIANT OAKS DR 27350 STATE ROAD 2,444.96 P7743003 GIBNEY MCCRACKEN TRL 27350 PRIVATE DRIVE 576.86 P7747236 GILBERT DAVIS DR 27317 PRIVATE DRIVE 1,480.98 S2048 GILEAD DR 27350 STATE ROAD 1,127.93 C0001127 GILES CHAPEL RD 27203 CITY STREET 1,215.65 S2218 GILES CHAPEL RD 27203 STATE ROAD 3,593.76 S2522 GILMORE DR 27298 STATE ROAD 1,449.51 C0001524 GINGER CT 27317 CITY STREET 221.00 S1396 GLADE RD 27205 STATE ROAD 2,349.05 C0001517 GLEN CIR 27203 CITY STREET 366.64 C0002072 GLENDALE DR 27263 CITY STREET 838.53 P7750385 GLENDALE DR 27205 PRIVATE DRIVE 764.84 S2603 GLENN CTRY RD 27205 STATE ROAD 3,370.89 S2688 GLENN DR 27205 STATE ROAD 802.25 P7782167 GLENN RICH LN 27317 PRIVATE DRIVE 1,135.98 S2552 GLENN SMITH DR 27298 STATE ROAD 1,004.11 P7766322 GLENN WILLIAMS DR 27317 PRIVATE DRIVE 787.10 C0006126 GLENNS WAY 27317 CITY STREET 573.95 P7707422 GLENNVILLE DR 27370 PRIVATE DRIVE 1,072.04 P7737344 GLENOLA INDUSTRIAL DR 27263 PRIVATE DRIVE 490.02 S1697 GLENVIEW DR 27263 STATE ROAD 3,364.72 C0001128 GLENWOOD RD 27203 CITY STREET 3,555.06 S2317 GLOVINIA ST 27203 STATE ROAD 210.58 C0001129 GLOVINIA ST 27203 CITY STREET 1,695.40 P7791356 GLOWING WOOD TRL 27205 PRIVATE DRIVE 1,392.25 P7737394 GODNICK LN 27263 PRIVATE DRIVE 343.95 C0001130 GOLD HILL RD 27203 CITY STREET 4,888.65 S2183 GOLD HILL RD 27203 STATE ROAD 11,919.19 C0001131 GOLDA AVE 27203 CITY STREET 1,445.08 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-31 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7726467 GOLDEN EAGLE DR 27350 PRIVATE DRIVE 761.48 P7757307 GOLDEN LEAF LN 27317 PRIVATE DRIVE 583.17 S1317 GOLDEN MEADOW RD 27205 STATE ROAD 9,724.27 S2545 GOLDFIELD RD 27298 STATE ROAD 1,342.03 S2482 GOLDSTON RD 27316 STATE ROAD 2,103.10 P7659360 GOOD LUCK RD 27205 PRIVATE DRIVE 2,649.01 C0002073 GOODMAN ST 27263 CITY STREET 1,889.78 S1366 GOPHER WOODS RD 27205 STATE ROAD 3,830.66 P7781260 GOSPEL CHAPEL DR 27205 PRIVATE DRIVE 602.80 S3189 GRA LAN DR 27360 STATE ROAD 1,461.04 S2722 GRACELAND DR 27205 STATE ROAD 2,629.92 S2622 GRACEWOOD RD 27316 STATE ROAD 794.64 P7628524 GRADY WILLIAMS DR 27205 PRIVATE DRIVE 900.37 S1263 GRAHAM DAVIS RD 27239 STATE ROAD 2,308.25 P6684130 GRAHAM DAVIS RD EXT 27239 PRIVATE DRIVE 2,597.21 C0008012 GRAHAM ST 27355 CITY STREET 832.44 P8736160 GRAHAM ST EXT 27298 PRIVATE DRIVE 1,560.65 S1172 GRANGE HALL RD 27205 STATE ROAD 5,124.59 P7629501 GRANITE RDG 27205 PRIVATE DRIVE 1,158.38 P7710102 GRANITE ROCK DR 27239 PRIVATE DRIVE 2,665.82 P7753169 GRANT TRL 27317 PRIVATE DRIVE 437.54 S2614 GRANTVILLE LN 27205 STATE ROAD 26,437.15 S2614 GRANTVILLE LN 27248 STATE ROAD 1,420.89 P7798406 GRAPEVINE DR 27233 PRIVATE DRIVE 627.36 S1183 GRAVEL HILL RD 27239 STATE ROAD 15,412.53 S2854 GRAVES CTRY RD 27341 STATE ROAD 3,992.73 S2534 GRAVES THOMAS RD 27316 STATE ROAD 957.45 S2067 GRAY FARM RD 27350 STATE ROAD 4,805.30 P8734515 GRAY FOX LN 27355 PRIVATE DRIVE 1,375.91 P7638231 GRAY OWL RD 27205 PRIVATE DRIVE 4,661.06 S1403 GRAY ROCK RD N 27370 STATE ROAD 4,065.45 S1403 GRAY ROCK RD S 27370 STATE ROAD 3,322.09 S2447 GRAYS CHAPEL SCHOOL RD 27248 STATE ROAD 519.00 P7708162 GREEN ACRES DR 27263 PRIVATE DRIVE 781.57 S1415 GREEN FARM RD 27205 STATE ROAD 5,300.10 S3183 GREEN GLADE RD 27350 STATE ROAD 1,387.91 P7783131 GREEN LEAF LN 27248 PRIVATE DRIVE 1,167.50 P7659443 GREEN MTN DR 27205 PRIVATE DRIVE 421.59 C0007010 GREEN ST 27341 CITY STREET 1,023.40 S1864 GREEN TREE RD 27360 STATE ROAD 1,644.83 C0011051 GREEN VALLEY DR 27370 CITY STREET 849.18 S2601 GREEN VALLEY RD 27205 STATE ROAD 3,278.82 S3240 GREENBROOK RD 27370 STATE ROAD 1,863.26 S2711 GREENBRUSH RD 27205 STATE ROAD 1,553.56 S1363 GREENCASTLE RD 27205 STATE ROAD 1,067.53 S2003 GREENDALE RD 27263 STATE ROAD 1,255.74 P7747078 GREENDALE RD EXT 27263 PRIVATE DRIVE 1,527.67 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-32 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1348 GREENE OAK RD 27205 STATE ROAD 3,217.52 C0001132 GREENFIELD ST 27203 CITY STREET 887.07 P8711342 GREENFIELD ST 27316 PRIVATE DRIVE 457.18 S2310 GREENFOREST RD 27317 STATE ROAD 1,027.89 C0002074 GREENHAVEN DR 27263 CITY STREET 834.42 S2617 GREENHILL RD 27316 STATE ROAD 1,313.11 P7747079 GREENHILL TRL 27317 PRIVATE DRIVE 1,172.57 C0001133 GREENLAWN DR 27203 CITY STREET 908.29 S1258 GREENLEAF ACRES DR 27205 STATE ROAD 1,831.88 S1871 GREENMONT DR 27205 STATE ROAD 1,839.39 C0002075 GREENOAK DR 27263 CITY STREET 570.03 C0001134 GREENSBORO ST 27203 CITY STREET 2,691.59 C0001512 GREENTREE CT 27203 CITY STREET 811.70 C0001135 GREENVALE RD 27203 CITY STREET 2,363.12 S2965 GREENVIEW DR 27205 STATE ROAD 833.45 S2963 GREENVIEW DR 27205 STATE ROAD 2,608.48 S1742 GREENWAY DR 27370 STATE ROAD 884.57 C0001136 GREENWOOD RD 27203 CITY STREET 1,203.44 S2402 GREESON CTRY RD 27233 STATE ROAD 5,552.94 C0002076 GREGG ST 27263 CITY STREET 3,357.09 P7721420 GREGORY CT 27205 PRIVATE DRIVE 1,947.33 S2105 GREGSON RD 27313 STATE ROAD 4,713.57 S1836 GREY DR 27350 STATE ROAD 2,353.95 S1860 GREY OAKS RD 27370 STATE ROAD 997.72 P7638236 GREY RABBIT RUN 27205 PRIVATE DRIVE 241.78 C0001137 GREYSTONE RD 27203 CITY STREET 2,235.50 S2556 GRIFFIN DR 27316 STATE ROAD 1,040.13 P7744010 GROOM RD 27350 PRIVATE DRIVE 2,744.64 S1654 GROVE ST 27370 STATE ROAD 761.69 C0011042 GROVE ST 27370 CITY STREET 615.73 P8722185 GUESS RD 27316 PRIVATE DRIVE 1,334.22 S2382 GUILFORD WAY 27248 STATE ROAD 1,275.23 C0001581 GUM ST 27317 CITY STREET 1,683.34 S1874 GUM TREE RD 27205 STATE ROAD 1,036.60 S1555 GUMWOOD RD 27360 STATE ROAD 1,706.53 P8728304 GYPSY ROSE DR 27298 PRIVATE DRIVE 1,800.56 P7706470 HABITAT DR 27370 PRIVATE DRIVE 1,589.71 P7706471 HABITAT DR EXT 27370 PRIVATE DRIVE 1,508.18 P7796497 HACKETT LN 27233 PRIVATE DRIVE 1,860.35 P7782224 HAITHCOCK RD 27248 PRIVATE DRIVE 984.41 S2935 HALIFAX ST 27205 STATE ROAD 417.39 S2956 HALIFAX ST 27205 STATE ROAD 833.58 S2823 HALL DR 27205 STATE ROAD 751.30 S2141 HALL RD 27248 STATE ROAD 7,996.77 S1345 HALTOM RD 27292 STATE ROAD 1,576.75 C0004034 HAMILTON DR 27298 CITY STREET 1,783.86 S1439 HAMILTON ST 27205 STATE ROAD 160.41 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-33 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0001138 HAMLIN ST 27203 CITY STREET 1,660.86 C0001139 HAMMER AVE 27203 CITY STREET 2,537.94 S1688 HAMMOND RD 27350 STATE ROAD 1,660.40 C0006030 HAMMOND ST 27317 CITY STREET 784.60 S2699 HAMPTON CT 27205 STATE ROAD 400.60 C0001423 HAMPTON RD 27203 CITY STREET 1,620.30 O9999 HANCOCK LN 27360 OUT OF COUNTY 171.47 C0006031 HANCOCK ST 27317 CITY STREET 666.95 O9999 HANDY RD 27239 OUT OF COUNTY 619.52 P7726544 HANGAR RUN 27350 PRIVATE DRIVE 859.28 P7639443 HANNAH DR 27205 PRIVATE DRIVE 976.96 O8888 HANNAH MAC RD 27355 OUT OF COUNTY DRIVE 175.37 C0002261 HANNER CT 27263 CITY STREET 171.98 P7722452 HANNER HILL RD 27205 PRIVATE DRIVE 1,304.28 S1968 HANNER RD 27317 STATE ROAD 1,597.36 P7757403 HANNER RD EXT 27317 PRIVATE DRIVE 329.56 P8726459 HAPPY HILLS DR 27355 PRIVATE DRIVE 1,821.86 S2843 HAPPY HOLLOW RD 27205 STATE ROAD 16,074.18 P7667335 HAPPY LN 27205 PRIVATE DRIVE 3,260.91 C0004100 HARDIN CT 27298 CITY STREET 336.36 S2455 HARDIN ELLISON RD 27248 STATE ROAD 10,443.52 C0002077 HARDIN ST 27263 CITY STREET 464.26 S1535 HARDINS FARM RD 27350 STATE ROAD 4,815.09 P7731406 HARDWOOD TRL 27205 PRIVATE DRIVE 424.02 O9999 HARLOW DR 27263 OUT OF COUNTY 112.76 S1926 HARLOW RD 27263 STATE ROAD 15,835.97 S1492 HARMONY TRL 27205 STATE ROAD 910.62 S2404 HAROLD MEADOW RD 27283 STATE ROAD 3,687.68 P8708016 HAROLD MEADOW RD EXT 27283 PRIVATE DRIVE 1,192.28 S1872 HARPER RD 27205 STATE ROAD 934.12 C0002078 HARRIET ST 27263 CITY STREET 430.56 P7714112 HARRIS CT 27370 PRIVATE DRIVE 307.33 P7619156 HARRIS FAMILY LN 27205 PRIVATE DRIVE 2,034.02 S1407 HARRIS RD 27370 STATE ROAD 1,088.40 C0001140 HARRISON ST 27203 CITY STREET 265.71 P7755389 HARRISON TRL 27350 PRIVATE DRIVE 1,142.78 P7755389 HARRISON TRL 27317 PRIVATE DRIVE 329.05 P7754176 HARSHAW DR 27317 PRIVATE DRIVE 1,111.06 P7706479 HARTSELL DR 27370 PRIVATE DRIVE 1,131.98 S1187 HARVELL RD 27205 STATE ROAD 3,827.65 S1266 HARVELL ST 27205 STATE ROAD 727.27 C0001141 HARVELL ST 27205 CITY STREET 1,034.56 S1241 HARVELL ST EXT 27205 STATE ROAD 534.73 S2272 HARVEST CIR 27203 STATE ROAD 2,466.80 S1867 HARVEST DR 27360 STATE ROAD 1,313.51 P7776231 HARVEST VIEW DR 27317 PRIVATE DRIVE 910.63 C0001142 HASTY ST 27203 CITY STREET 324.76 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-34 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0002079 HATTIE ST 27263 CITY STREET 432.14 C0002080 HAVENWOOD DR 27263 CITY STREET 3,608.31 P8711518 HAWK FARM RD 27316 PRIVATE DRIVE 2,162.38 P6782252 HAWK NEST DR 27292 PRIVATE DRIVE 1,383.33 P7771434 HAWK WATCH RD 27205 PRIVATE DRIVE 1,060.81 S2137 HAWKSVIEW RD 27248 STATE ROAD 7,941.19 P7766465 HAWTHORNE CT 27317 PRIVATE DRIVE 302.22 S2819 HAWTHORNE DR 27205 STATE ROAD 3,454.77 S2952 HAYES DR 27205 STATE ROAD 1,016.86 P8606559 HAYES FARM RD 27341 PRIVATE DRIVE 2,378.98 S2726 HAYFIELD DR 27205 STATE ROAD 1,733.13 P8705324 HAYSTACK LN 27248 PRIVATE DRIVE 430.64 P7708472 HAYWOOD RD 27370 PRIVATE DRIVE 902.53 C0002081 HAYWORTH ST 27263 CITY STREET 480.85 C0002082 HAZEL AVE 27263 CITY STREET 465.93 C0006111 HAZEL HULL LN 27317 CITY STREET 374.07 S2018 HAZELWOOD LN 27263 STATE ROAD 1,106.20 C0001143 HAZELWOOD ST 27205 CITY STREET 692.15 P8725117 HEADEN CTRY TRL 27355 PRIVATE DRIVE 2,041.23 P7714346 HEARTHSIDE DR 27370 PRIVATE DRIVE 2,616.89 P7724276 HEARTHWOOD RD 27350 PRIVATE DRIVE 2,401.33 P7748445 HEARTLAND DR 27263 PRIVATE DRIVE 876.05 P6695218 HEARTLEAF TRL 27239 PRIVATE DRIVE 1,164.47 S1511 HEATH DAIRY RD 27317 STATE ROAD 13,037.59 C0001144 HEATHER CT 27203 CITY STREET 134.87 S2033 HEATHER DR 27317 STATE ROAD 512.46 P7752571 HEATHER GLENN PL 27205 PRIVATE DRIVE 603.82 S1765 HEATHWOOD DR 27370 STATE ROAD 1,562.86 C0001145 HEATHWOOD RD 27317 CITY STREET 1,385.44 P7777339 HEBLER LN 27317 PRIVATE DRIVE 709.02 P8707101 HEDGEBERRY LN 27298 PRIVATE DRIVE 1,684.66 S1935 HEDGECOCK RD 27317 STATE ROAD 1,519.78 C0001146 HEMLOCK DR 27205 CITY STREET 595.62 S2215 HENLEY CTRY RD 27203 STATE ROAD 13,024.73 S2215 HENLEY CTRY RD 27317 STATE ROAD 5,605.59 S2700 HENLEY DR 27205 STATE ROAD 2,045.29 P7700226 HENRY DELK RD 27239 PRIVATE DRIVE 3,000.93 P7741597 HENRY PARRISH RD 27205 PRIVATE DRIVE 934.84 S1423 HENRY PARRISH RD 27205 STATE ROAD 2,483.80 S1427 HENRY RD 27205 STATE ROAD 1,274.37 C0001148 HENSON RD 27203 CITY STREET 408.29 C0001149 HERITAGE CT 27203 CITY STREET 794.22 C0006109 HERITAGE DR 27317 CITY STREET 1,205.29 S2011 HERITAGE LN 27317 STATE ROAD 732.89 P7764439 HERITAGE MTN TRL 27317 PRIVATE DRIVE 2,282.09 S2050 HERITAGE VIEW LN 27360 STATE ROAD 2,692.45 S2441 HERMAN HUSBAND RD 27298 STATE ROAD 2,195.12 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-35 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2894 HERRINGTON CTRY RD 27316 STATE ROAD 6,883.17 C0001570 HICKORY CREEK TRL 27205 CITY STREET 524.31 S2962 HICKORY DR 27205 STATE ROAD 4,149.25 C0001549 HICKORY FOREST DR 27203 CITY STREET 3,666.54 P6795158 HICKORY HILL DR 27370 PRIVATE DRIVE 890.17 P8725116 HICKORY WAY 27355 PRIVATE DRIVE 537.22 S2006 HICKORY WOOD LN 27317 STATE ROAD 464.40 P8725505 HICKS CTRY LN 27355 PRIVATE DRIVE 1,410.65 S2474 HICKS FARM RD 27355 STATE ROAD 11,228.42 S2061 HIDDEN CT 27205 STATE ROAD 523.15 S2302 HIDDEN LN 27313 STATE ROAD 595.73 P7768260 HIDDEN LN EXT 27313 PRIVATE DRIVE 667.06 S1358 HIDDEN SPRINGS RD 27239 STATE ROAD 1,805.70 P6795516 HIDEAWAY LN 27370 PRIVATE DRIVE 2,004.45 P7675388 HIGH KNOB TRL 27341 PRIVATE DRIVE 3,372.08 P7638237 HIGH MEADOW DR 27205 PRIVATE DRIVE 1,730.97 S1143 HIGH PINE CHURCH RD 27205 STATE ROAD 63,407.52 S1143 HIGH PINE CHURCH RD 27239 STATE ROAD 7,636.42 C0006032 HIGH POINT ST 27317 CITY STREET 7,868.34 S2422 HIGHFILL ST 27298 STATE ROAD 1,146.61 C0001150 HIGHLAND CT 27203 CITY STREET 407.10 C0001151 HIGHLAND ST 27203 CITY STREET 1,312.44 P7618002 HIGHLANDS LN 27205 PRIVATE DRIVE 1,244.59 S1435 HIGHRIDGE ST 27205 STATE ROAD 849.89 P7770121 HIGHT ST 27205 PRIVATE DRIVE 701.06 P7766466 HIGHTOWER DR 27317 PRIVATE DRIVE 718.15 C0001152 HIGHWOOD DR 27205 CITY STREET 926.38 P7737393 HILL FARM RD 27263 PRIVATE DRIVE 1,052.13 P7614394 HILL HARDISTER RD 27371 PRIVATE DRIVE 1,037.13 C0001153 HILL ST 27203 CITY STREET 996.94 C0007011 HILL ST 27341 CITY STREET 971.35 S2229 HILL TOP HOME RD 27248 STATE ROAD 1,050.48 S2984 HILLARY CT 27205 STATE ROAD 2,340.60 P7750386 HILLBROOK DR 27205 PRIVATE DRIVE 934.50 C0001154 HILLCREST CIR 27203 CITY STREET 520.24 S1779 HILLCREST CT 27350 STATE ROAD 1,769.92 C0006034 HILLCREST DR 27317 CITY STREET 1,169.20 C0002083 HILLCREST LN 27263 CITY STREET 546.42 S3111 HILLCREST LN 27370 STATE ROAD 572.15 P7766365 HILLIARD LN 27317 PRIVATE DRIVE 347.94 C0006033 HILLIARY ST 27317 CITY STREET 438.69 C0008013 HILLSBORO ST 27355 CITY STREET 451.38 P7722450 HILLSDALE CT 27205 PRIVATE DRIVE 1,281.61 P7761179 HILLSDALE DR 27203 PRIVATE DRIVE 1,297.02 S1844 HILLSDALE PARK DR 27350 STATE ROAD 2,016.59 C0002246 HILLSIDE CT 27263 CITY STREET 236.63 S1004 HILLSVILLE RD 27370 STATE ROAD 5,005.84 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-36 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1004 HILLSVILLE RD 27350 STATE ROAD 4,179.76 S1606 HILLTOP AVE 27370 STATE ROAD 992.93 P7669120 HILLTOP CHURCH RD 27205 PRIVATE DRIVE 785.93 S2026 HILLTOP DR 27263 STATE ROAD 2,040.43 S1851 HILLVIEW CT 27370 STATE ROAD 389.39 C0001155 HILLVIEW ST 27205 CITY STREET 219.97 P7698123 HILTON TRL 27205 PRIVATE DRIVE 411.01 P7675387 HINESLEY RD 27341 PRIVATE DRIVE 425.83 S2426 HINSHAW CTRY RD 27298 STATE ROAD 6,151.58 P7797411 HINSHAW FARM RD 27233 PRIVATE DRIVE 4,647.38 C0006035 HINSHAW ST 27317 CITY STREET 1,152.20 C0001156 HINSHAW ST 27203 CITY STREET 619.69 S2656 HINSHAW TOWN RD 27316 STATE ROAD 24,242.59 S2656 HINSHAW TOWN RD 27205 STATE ROAD 220.21 S2104 HOCKETT CTRY LN 27313 STATE ROAD 2,649.46 S1938 HOCKETT DAIRY RD 27317 STATE ROAD 10,288.03 P7757206 HOCKETT TRL 27317 PRIVATE DRIVE 3,780.27 S2131 HODGE RD 27317 STATE ROAD 2,668.18 S3221 HOFFMAN ST 27350 STATE ROAD 460.41 S1529 HOG SLIDE RD 27350 STATE ROAD 3,987.17 P6695561 HOGAN FARM TRL 27239 PRIVATE DRIVE 4,131.71 S2034 HOHN DAVIS RD 27263 STATE ROAD 3,842.99 P7738485 HOHN RD 27263 PRIVATE DRIVE 1,483.27 P8706280 HOLDER FARM RD 27298 PRIVATE DRIVE 4,223.37 S1988 HOLDER INMAN RD 27317 STATE ROAD 4,628.44 S1988 HOLDER INMAN RD EXT 27317 STATE ROAD 2,037.79 C0006036 HOLDER ST 27317 CITY STREET 2,002.20 C0001157 HOLLAND ST 27203 CITY STREET 1,029.12 S1267 HOLLINGS RD 27205 STATE ROAD 562.42 P7745173 HOLLINGSWORTH FARM DR 27350 PRIVATE DRIVE 750.02 S1646 HOLLINGSWORTH RD 27317 STATE ROAD 1,202.69 P7754190 HOLLINGSWORTH RD EXT 27317 PRIVATE DRIVE 1,235.61 S2406 HOLLOW HILL RD 27298 STATE ROAD 8,583.42 P8706121 HOLLOW TREE DR 27298 PRIVATE DRIVE 2,237.85 S2942 HOLLY DR 27205 STATE ROAD 1,029.90 S2036 HOLLY GROVE CT 27317 STATE ROAD 485.75 S2035 HOLLY GROVE DR 27317 STATE ROAD 3,368.96 C0005024 HOLLY HILL ST 27316 CITY STREET 2,130.38 S2709 HOLLY LEAF RD 27316 STATE ROAD 922.94 P8701518 HOLLY LEAF RD 27316 PRIVATE DRIVE 820.50 P8701317 HOLLY LEAF RD EXT 27316 PRIVATE DRIVE 275.98 P7777137 HOLLY OAK DR 27317 PRIVATE DRIVE 1,179.24 S1003 HOLLY SPRING RD 27316 STATE ROAD 21,683.45 S2658 HOLLY SPRINGS CHURCH RD 27316 STATE ROAD 4,522.96 C0003014 HOLLY ST 27248 CITY STREET 1,736.43 C0001158 HOLLY ST 27203 CITY STREET 2,820.76 S1772 HOLLYRIDGE DR 27370 STATE ROAD 563.51 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-37 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P8736155 HOLT ST 27298 PRIVATE DRIVE 484.42 C0001159 HOME AVE 27203 CITY STREET 1,043.28 C0001598 HOMEPLACE DR 27317 CITY STREET 1,793.66 P7628526 HOMEPLACE TRL 27205 PRIVATE DRIVE 222.04 P7764173 HOMER LN 27317 PRIVATE DRIVE 828.77 P6792100 HOMESTEAD RD 27370 PRIVATE DRIVE 2,708.04 P7785579 HOMEWARD TRL 27248 PRIVATE DRIVE 2,024.11 P7646191 HONEY LOCUST RD 27205 PRIVATE DRIVE 4,578.29 C0006037 HONEYCUTT ST 27317 CITY STREET 785.02 S2293 HONEYSUCKLE RD 27203 STATE ROAD 1,274.96 P7781562 HONEYSUCKLE RDG 27205 PRIVATE DRIVE 1,304.00 P8717482 HOOTS HOLLOW RD 27298 PRIVATE DRIVE 3,334.93 S1315 HOOVER GROVE RD 27239 STATE ROAD 522.16 P7700228 HOOVER GROVE RD 27239 PRIVATE DRIVE 2,738.02 S3204 HOOVER HILL CT 27370 STATE ROAD 720.60 S1408 HOOVER HILL RD 27370 STATE ROAD 26,549.22 S1408 HOOVER HILL RD 27205 STATE ROAD 16,243.18 C0001161 HOOVER ST 27203 CITY STREET 3,023.40 C0002237 HOPE CT 27263 CITY STREET 285.39 C0002204 HOPE VALLEY DR 27263 CITY STREET 1,452.79 S3252 HOPEWELL CHURCH RD 27370 STATE ROAD 14,568.85 S1142 HOPEWELL FRIENDS RD 27205 STATE ROAD 16,912.06 C0001162 HOPEWELL ST 27203 CITY STREET 696.87 S1508 HOPEWOOD RD 27317 STATE ROAD 1,451.13 P7604105 HOPKINS DR 27239 PRIVATE DRIVE 940.99 P7649443 HORSE CANYON RD 27205 PRIVATE DRIVE 450.58 C0001553 HORSE CARRIAGE LN 27205 CITY STREET 1,173.52 S2979 HORSE MOUNTAIN DR 27205 STATE ROAD 1,312.35 C0001528 HORSESHOE BEND RD 27317 CITY STREET 1,861.18 S1135 HOWARD AUMAN RD 27205 STATE ROAD 2,753.25 P7646490 HOWARD AUMAN RD EXT 27205 PRIVATE DRIVE 737.52 S2818 HOWARD AVE 27205 STATE ROAD 1,836.34 S1611 HOWARD CIR 27263 STATE ROAD 2,038.35 S2877 HOWARD MILL RD 27208 STATE ROAD 13,829.93 S2877 HOWARD MILL RD 27325 STATE ROAD 3,662.37 P7737104 HOWARD RUSSELL RD 27263 PRIVATE DRIVE 1,508.30 P7665293 HOYLE DR 27205 PRIVATE DRIVE 748.06 C0007012 HOYT DR 27341 CITY STREET 2,186.81 C0001163 HUB MORRIS RD 27317 CITY STREET 5,769.77 C0001163 HUB MORRIS RD 27203 CITY STREET 3,517.82 P7758526 HUBBARD LN 27317 PRIVATE DRIVE 1,101.96 P7792452 HUCK ST 27316 PRIVATE DRIVE 597.38 S3257 HUCKLEBERRY LN 27370 STATE ROAD 1,516.35 P7772163 HUDSON LN 27203 PRIVATE DRIVE 827.67 C0002084 HUDSON ST 27263 CITY STREET 486.84 P7766464 HUFF CT 27317 PRIVATE DRIVE 230.44 P8712306 HUFF CTRY TRL 27316 PRIVATE DRIVE 1,971.94 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-38 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0002085 HUFF RD 27263 CITY STREET 2,501.40 S1915 HUFF RD 27263 STATE ROAD 3,215.83 P7732228 HUGHES DR 27350 PRIVATE DRIVE 3,504.89 S2066 HUGHES FARM RD 27263 STATE ROAD 4,848.48 S1400 HUGHES GROVE RD 27360 STATE ROAD 5,790.91 C0001164 HUGHES ST 27203 CITY STREET 1,894.98 S1342 HULIN MCDOWELL RD 27239 STATE ROAD 9,827.39 C0001573 HUMBLE HOLLOW DR 27203 CITY STREET 902.20 C0001165 HUMBLE ST 27203 CITY STREET 2,009.78 P8737453 HUMMINGBIRD LN 27298 PRIVATE DRIVE 778.83 S1351 HUNT DELK RD 27239 STATE ROAD 3,032.93 S1394 HUNT MASTER TRL 27205 STATE ROAD 2,774.53 S1177 HUNT RD 27239 STATE ROAD 6,575.61 S3259 HUNT RIDGE CT 27370 STATE ROAD 1,247.75 S1395 HUNTER CT 27205 STATE ROAD 419.90 C0011013 HUNTERS CLUB DR 27370 CITY STREET 1,862.07 C0006104 HUNTERS RIDGE RD 27317 CITY STREET 3,281.55 S3228 HUNTERS RUN 27370 STATE ROAD 1,828.40 S3266 HUNTERS WOODS DR 27370 STATE ROAD 1,993.30 S2109 HUNTING LODGE RD 27313 STATE ROAD 3,914.44 S2109 HUNTING LODGE RD 27233 STATE ROAD 5,068.47 S3258 HUNTINGTON DR 27370 STATE ROAD 505.20 S3258 HUNTINGTON DR 27370 STATE ROAD 893.34 C0005058 HUNTINGWOOD RD 27316 CITY STREET 2,188.83 P6798498 HUNTS KNOLL LN 27263 PRIVATE DRIVE 730.92 P8624154 HUSSEY CTRY TRL 27341 PRIVATE DRIVE 4,395.12 P7694301 HUSSEY WILLIAMS RD 27341 PRIVATE DRIVE 1,607.08 S2270 HWY 311 EXT 27317 STATE ROAD 3,179.49 P7768458 HYATT DR 27317 PRIVATE DRIVE 504.43 P7748351 HYDE AWAY LN 27263 PRIVATE DRIVE 1,835.43 C0001166 IDEAL DR 27203 CITY STREET 1,220.93 S1261 IDLEBROOK TRL 27205 STATE ROAD 1,236.01 S3264 IDLEWILD DR 27317 STATE ROAD 2,543.56 S3264 IDLEWILD DR EXT 27317 STATE ROAD 774.84 C0001167 IDLEWOOD DR 27205 CITY STREET 1,048.24 S2995 INDEPENDENCE AVE 27205 STATE ROAD 1,606.99 C0001168 INDEPENDENCE DR 27203 CITY STREET 579.59 P7703281 INDIAN CREEK DR 27370 PRIVATE DRIVE 1,104.94 S2672 INDIAN SPRINGS RD 27205 STATE ROAD 2,550.95 S3227 INDIAN TRL 27350 STATE ROAD 700.93 P7669360 INDIAN WELLS LOOP 27205 PRIVATE DRIVE 747.26 P7791351 INDIGO TRL 27205 PRIVATE DRIVE 1,319.93 C0001169 INDUSTRIAL PARK AVE 27205 CITY STREET 3,732.40 S1191 INDUSTRIAL PARK AVE 27205 STATE ROAD 700.59 C0003056 INFINITE WAY 27248 CITY STREET 523.07 C0003055 INFINITE WAY EXT 27248 CITY STREET 173.92 P7766151 INGOLD DR 27317 PRIVATE DRIVE 437.92 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-39 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2292 INGRAM DR 27203 STATE ROAD 2,723.95 C0002086 INTERSTATE DR 27263 CITY STREET 3,035.45 I 73 INTERSTATE HWY 73 27317 INTERSTATE HIGHWAY 95,321.32 I 73/74 INTERSTATE HWY 73/74 27203 INTERSTATE HIGHWAY 60,474.02 I 73/74 INTERSTATE HWY 73/74 27205 INTERSTATE HIGHWAY 104,149.94 I 73/74 INTERSTATE HWY 73/74 27317 INTERSTATE HIGHWAY 11,837.18 I 73/74 INTERSTATE HWY 73/74 27341 INTERSTATE HIGHWAY 31,725.96 I 74 INTERSTATE HWY 74 27263 INTERSTATE HIGHWAY 45,316.96 I 74 INTERSTATE HWY 74 27350 INTERSTATE HIGHWAY 53,158.82 I 74 INTERSTATE HWY 74 27317 INTERSTATE HIGHWAY 16,020.58 I 85 INTERSTATE HWY 85 27263 INTERSTATE HIGHWAY 26,645.22 I 85 INTERSTATE HWY 85 27370 INTERSTATE HIGHWAY 44,940.16 I 85 INTERSTATE HWY 85 27360 INTERSTATE HIGHWAY 5,527.83 S2825 INWOOD RD 27205 STATE ROAD 6,106.29 P7745489 INWOOD VIEW DR 27350 PRIVATE DRIVE 619.89 P8700110 IRA MCGEE RD 27316 PRIVATE DRIVE 897.19 P6698223 IRISH MEADOW TRL 27239 PRIVATE DRIVE 636.92 P7781351 IRON LOOP DR 27205 PRIVATE DRIVE 1,105.88 S2605 IRON MOUNTAIN RD 27205 STATE ROAD 21,043.25 S2609 IRON MOUNTAIN VIEW RD 27205 STATE ROAD 5,760.60 P7776230 IRVIN CTRY RD 27317 PRIVATE DRIVE 2,925.06 P6797206 IRWIN ST 27370 PRIVATE DRIVE 898.26 P8736355 ISAAC DR 27298 PRIVATE DRIVE 2,506.43 P7774402 ISABEL DR 27248 PRIVATE DRIVE 1,089.63 C0006103 ISLAND FORD RD 27317 CITY STREET 3,864.84 C0006103 ISLAND FORD RD 27350 CITY STREET 1,354.11 S1951 ISLAND FORD RD 27317 STATE ROAD 2,899.76 C0006103 ISLAND FORD RD 27350 CITY STREET 371.38 P8737142 ISLAND OAK DR 27298 PRIVATE DRIVE 2,466.59 P8713369 ISLEY LN 27316 PRIVATE DRIVE 210.97 P8701113 ISOM RD 27316 PRIVATE DRIVE 922.24 C0001608 ITASCA CT 27203 CITY STREET 205.54 S1773 IVEY LN 27370 STATE ROAD 608.64 S3009 IVEYDALE DR 27205 STATE ROAD 1,240.14 P7734201 IVORY LN 27350 PRIVATE DRIVE 1,012.44 C0001546 IVY CREEK DR 27317 CITY STREET 618.75 P7764450 IVY ROCK CT 27317 PRIVATE DRIVE 271.75 S2475 J C TEAGUE RD 27355 STATE ROAD 3,984.15 S2475 J C TEAGUE RD EXT 27355 STATE ROAD 3,423.09 S2936 JABO HUSSEY RD 27325 STATE ROAD 1,549.56 P8624002 JABO HUSSEY RD EXT 27325 PRIVATE DRIVE 4,254.96 P7738301 JACK WALL LN 27263 PRIVATE DRIVE 963.30 C0002088 JACKIE AVE 27263 CITY STREET 679.80 S1314 JACKSON CREEK RD 27239 STATE ROAD 35,820.73 S1329 JACKSON RD 27205 STATE ROAD 345.76 S2075 JACKSON WAY 27350 STATE ROAD 471.49 C0002193 JACOB CT 27263 CITY STREET 195.70 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-40 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P6794422 JADES WAY 27360 PRIVATE DRIVE 1,412.10 S1272 JAECO CAUDILL DR 27205 STATE ROAD 2,373.14 P7775174 JAKE PUGH DR 27248 PRIVATE DRIVE 931.30 S3104 JAMES AVE 27370 STATE ROAD 459.70 P7707225 JAMES AVE 27370 PRIVATE DRIVE 716.83 P7786105 JAMES BEESON RD 27233 PRIVATE DRIVE 5,640.74 P7782166 JAMES RAY DR 27317 PRIVATE DRIVE 555.22 C0001171 JAMES ST 27203 CITY STREET 136.74 P7734023 JAMIE DAVIS RD 27350 PRIVATE DRIVE 1,506.51 P6792102 JAN DAN DR 27370 PRIVATE DRIVE 2,789.50 P7689429 JANICE ACRES ST 27205 PRIVATE DRIVE 1,173.95 S1644 JARRELL DR 27205 STATE ROAD 529.00 S1411 JARVIS MILLER RD 27205 STATE ROAD 10,175.35 P8618234 JASMINE LN 27316 PRIVATE DRIVE 1,236.69 S1160 JASON HOOVER RD 27205 STATE ROAD 3,941.42 S2027 JASPER DR 27263 STATE ROAD 1,457.89 P6797105 JAY MAC CT 27360 PRIVATE DRIVE 386.32 C0002234 JEFFERSON CT 27263 CITY STREET 145.27 P7751117 JEFFERSON ST 27205 PRIVATE DRIVE 444.24 S3149 JENNIFER CT 27263 STATE ROAD 3,611.73 S2305 JENNIFER DR 27313 STATE ROAD 476.14 S3248 JENNIFER LYNN DR 27370 STATE ROAD 1,355.56 S2721 JENNIFER VIEW DR 27205 STATE ROAD 2,152.60 P7732325 JENNINGS CTRY DR 27205 PRIVATE DRIVE 1,768.83 S2220 JENNINGS RD 27317 STATE ROAD 2,946.46 P7723524 JERICHO BUTLER DR 27205 PRIVATE DRIVE 1,419.77 S1412 JERICO RD 27205 STATE ROAD 16,815.28 C0002225 JERNIGAN PL 27370 CITY STREET 505.74 P7750513 JERRY HUGHES ST 27205 PRIVATE DRIVE 715.91 S1885 JERRY ST 27370 STATE ROAD 2,902.81 C0006116 JESS FERREE CT 27317 CITY STREET 348.30 S2446 JESS HACKETT RD 27233 STATE ROAD 8,104.10 S1540 JESS SMITH RD 27350 STATE ROAD 10,459.04 S1961 JESSE SMALL RD 27317 STATE ROAD 4,162.86 P6798360 JESSICA DR 27263 PRIVATE DRIVE 2,243.01 S3238 JILL DR 27370 STATE ROAD 1,022.70 P7659545 JIM LEWALLEN RD 27205 PRIVATE DRIVE 161.58 S1338 JIM PIERCE RD 27370 STATE ROAD 5,099.53 P7794183 JIM WALKER RD 27248 PRIVATE DRIVE 1,478.15 S2881 JIMMY COX RD 27208 STATE ROAD 7,467.46 P7786457 JIMMY SCOTT RD 27233 PRIVATE DRIVE 1,621.00 S1737 JOAN DR 27263 STATE ROAD 1,599.80 S2646 JOE BRANSON RD 27208 STATE ROAD 7,254.59 P8710182 JOE DEAN TRL 27316 PRIVATE DRIVE 780.35 P7666199 JOE FARLOW RD 27205 PRIVATE DRIVE 2,462.74 P6797213 JOE HOFFMAN DR 27263 PRIVATE DRIVE 945.65 P6687235 JOE LOFLIN TRL 27239 PRIVATE DRIVE 842.97 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-41 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2891 JOEL JESSUP RD 27341 STATE ROAD 10,303.80 P7707226 JOHN DR 27370 PRIVATE DRIVE 613.47 P7755388 JOHN GLENN DR 27350 PRIVATE DRIVE 832.66 S2463 JOHN MARSH RD 27298 STATE ROAD 2,891.60 C0001589 JOHNNYS WAY 27203 CITY STREET 1,007.67 P7628527 JOHNS RIDGE DR 27205 PRIVATE DRIVE 1,193.79 S1262 JOHNSON FARM RD 27239 STATE ROAD 7,662.07 P7747102 JOHNSON OAK DR 27317 PRIVATE DRIVE 399.82 S1530 JOHNSON ST 27263 STATE ROAD 817.47 P7737342 JOHNSON ST EXT 27263 PRIVATE DRIVE 430.68 S2355 JOHNSTON CT 27233 STATE ROAD 1,810.08 P7678424 JONES CTRY TRL 27205 PRIVATE DRIVE 1,456.64 S1735 JONES RD 27205 STATE ROAD 2,536.71 C0001172 JONES ST 27203 CITY STREET 764.72 S2616 JONES ST EXT 27248 STATE ROAD 3,887.75 S2616 JONES ST EXT 27316 STATE ROAD 3,590.72 C0001173 JORDAN AVE 27203 CITY STREET 604.63 U 64E JORDAN RD 27316 US HIGHWAY 8,174.13 P6797498 JORDAN ST 27370 PRIVATE DRIVE 1,654.65 C0001521 JORDAN ST 27203 CITY STREET 181.42 S1539 JORDAN VALLEY RD 27370 STATE ROAD 5,870.74 P8637009 JOSE RD 27208 PRIVATE DRIVE 1,093.46 S3254 JOSH CT 27360 STATE ROAD 434.48 C0001174 JOYCE ST 27203 CITY STREET 417.83 S2867 JUGTOWN RD 27341 STATE ROAD 5,094.51 S2502 JULIAN AIRPORT RD 27298 STATE ROAD 5,119.11 C0002089 JULIAN AVE 27263 CITY STREET 3,469.59 C0003016 JULIAN RD 27248 CITY STREET 1,331.49 S2528 JULIAN ST 27233 STATE ROAD 992.87 P8724204 JUNE TRL 27298 PRIVATE DRIVE 2,811.29 C0001550 JUNIPER CT 27203 CITY STREET 312.31 C0001522 KAMERIN ST 27317 CITY STREET 3,224.59 C0001417 KARLA DR 27205 CITY STREET 784.99 S1869 KATRINA DR 27360 STATE ROAD 2,091.99 S1783 KAY DR 27370 STATE ROAD 457.41 S1800 KAY LYNN DR 27370 STATE ROAD 964.01 C0002090 KAYE ST 27263 CITY STREET 1,512.13 P8708415 KEELY LN 27233 PRIVATE DRIVE 2,083.35 C0004036 KEETER CT 27298 CITY STREET 556.39 P8618396 KEITH DR 27316 PRIVATE DRIVE 1,493.35 P7708392 KELLO RD 27263 PRIVATE DRIVE 949.12 C0001518 KELLY CIR 27203 CITY STREET 437.76 S2352 KELLY COLTRANE DR 27317 STATE ROAD 3,240.39 C0001502 KEMP BLVD 27203 CITY STREET 517.22 S2911 KEMP MILL RD 27205 STATE ROAD 10,620.36 S2986 KEN LEE CT 27205 STATE ROAD 1,093.75 C0001176 KENMORE ST 27203 CITY STREET 955.30 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-42 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0001176 KENMORE ST 27205 CITY STREET 252.93 S1868 KENNEDY CT 27370 STATE ROAD 1,137.44 S2671 KENNEDY CTRY DR 27205 STATE ROAD 2,147.03 S1401 KENNEDY FARM RD N 27360 STATE ROAD 15,266.05 S1401 KENNEDY FARM RD N 27370 STATE ROAD 6,606.27 S1401 KENNEDY FARM RD S 27370 STATE ROAD 4,782.84 S3106 KENNEDY RD 27370 STATE ROAD 23,947.18 C0001177 KENNELWOOD DR 27203 CITY STREET 763.86 P7727584 KENTLAND DR 27370 PRIVATE DRIVE 1,109.57 C0010008 KENTUCKY LN 27360 CITY STREET 304.94 S1414 KERMIT HUNT RD 27205 STATE ROAD 563.48 S2350 KERR DR 27317 STATE ROAD 3,608.14 C0001178 KERRY ST 27203 CITY STREET 746.74 C0002091 KERSEY DR 27263 CITY STREET 1,468.49 P7720488 KEYAUEE DR 27205 PRIVATE DRIVE 1,896.31 P7722248 KEYAUWEE RIDGE RD 27205 PRIVATE DRIVE 1,766.12 S2247 KEYSTONE DR 27203 STATE ROAD 1,867.73 P7761317 KIDD DR 27203 PRIVATE DRIVE 1,156.78 P8629008 KIDD FARM TRL 27344 PRIVATE DRIVE 892.14 P8704176 KIDDS LN 27248 PRIVATE DRIVE 718.46 S2453 KIDDS MILL RD 27248 STATE ROAD 13,242.68 S 2453 KIDDS MILL RD 27248 STATE ROAD 2,841.57 S2453 KIDDS MILL RD 27298 STATE ROAD 2,167.26 S1104 KIDDS MTN RD 27239 STATE ROAD 3,681.53 C0001179 KILDARE RD 27203 CITY STREET 1,758.07 S2630 KILDEE CHURCH RD 27316 STATE ROAD 17,158.40 P7658266 KILOWATT DR 27205 PRIVATE DRIVE 1,069.01 S2951 KIMBERLY DR 27205 STATE ROAD 1,286.33 C0011039 KIMBERLY LN 27370 CITY STREET 3,981.29 P7796394 KIME FARM RD 27233 PRIVATE DRIVE 1,583.39 P7796195 KIME FARM RD EXT 27233 PRIVATE DRIVE 1,086.39 P8718408 KIMREY LN 27298 PRIVATE DRIVE 1,167.36 C0005026 KIMREY ST 27316 CITY STREET 2,618.34 S2665 KINDLEY FARM RD 27205 STATE ROAD 3,717.57 P7791349 KINDLEY FARM RD EXT 27205 PRIVATE DRIVE 978.01 S1807 KINDLEY RD 27205 STATE ROAD 1,330.41 O9999 KINDLEY RD 27360 OUT OF COUNTY 2,265.72 P7791355 KINDLEY TRL 27205 PRIVATE DRIVE 1,454.49 C0001516 KING CT 27203 CITY STREET 975.46 S1108 KING MTN RD 27371 STATE ROAD 7,019.05 S1108 KING MTN RD 27205 STATE ROAD 6,127.87 S2488 KING RD 27316 STATE ROAD 2,508.39 O9999 KING RD 27341 OUT OF COUNTY 22.07 S1123 KING VIEW RD 27205 STATE ROAD 4,542.84 S2277 KINGS RIDGE RD 27317 STATE ROAD 1,324.51 S2449 KINGS WAY RD 27248 STATE ROAD 2,821.59 C0002201 KINGSFIELD CT 27263 CITY STREET 255.35 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-43 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0002248 KINGSFIELD FOREST DR 27263 CITY STREET 1,372.22 S1788 KINGSTON CT 27360 STATE ROAD 644.84 S1787 KINGSTON RD 27360 STATE ROAD 2,819.11 C0001180 KINGSWAY RD 27203 CITY STREET 842.22 S2030 KINLEY TRL 27263 STATE ROAD 1,223.49 P6793347 KINNEY WOODS WAY 27370 PRIVATE DRIVE 1,159.82 S2427 KINRO RD 27298 STATE ROAD 2,622.32 C0002092 KINVIEW DR 27263 CITY STREET 1,694.60 C0002250 KIRKMAN CT 27263 CITY STREET 156.36 P7764174 KIRKMAN PL 27317 PRIVATE DRIVE 546.33 S2429 KIRKMAN ST EXT 27298 STATE ROAD 2,031.44 S2872 KISER RD 27341 STATE ROAD 2,727.40 S2503 KIVETT COUNCIL RD 27298 STATE ROAD 4,489.47 P8733001 KIVETT FARM RD 27355 PRIVATE DRIVE 2,162.25 C0008014 KIVETT ST 27355 CITY STREET 773.60 S2032 KNOLL DR 27317 STATE ROAD 1,540.54 S1835 KNOLLVIEW DR 27350 STATE ROAD 1,984.32 C0002093 KNOLLWOOD DR 27263 CITY STREET 3,875.53 P7724278 KOLBY CT 27350 PRIVATE DRIVE 410.57 S3206 KOONCE CT 27370 STATE ROAD 1,067.83 S3161 KOONCE DR 27370 STATE ROAD 3,065.85 S1809 KREAMER DR 27263 STATE ROAD 1,086.25 P7776549 KYLES LN 27317 PRIVATE DRIVE 839.85 S1805 KYNWOOD DR 27370 STATE ROAD 2,534.72 P7758460 LABRADOR DR 27317 PRIVATE DRIVE 1,730.16 P7766463 LACEWOOD CT 27317 PRIVATE DRIVE 413.55 P7705209 LACEY CT 27370 PRIVATE DRIVE 2,942.29 S2507 LACKEY RD 27355 STATE ROAD 2,837.42 P7765257 LACY DR 27317 PRIVATE DRIVE 792.17 P7744231 LACY HODGE DR 27350 PRIVATE DRIVE 1,834.22 S3209 LAKE CT 27370 STATE ROAD 291.06 P7714110 LAKE CT 27370 PRIVATE DRIVE 433.19 S3159 LAKE CTRY DR 27205 STATE ROAD 1,559.01 P7742227 LAKE CTRY DR EXT 27205 PRIVATE DRIVE 6,109.88 S1653 LAKE DARR RD 27370 STATE ROAD 1,914.03 C0002094 LAKE DR 27263 CITY STREET 4,536.80 C0001181 LAKE DR 27205 CITY STREET 678.93 S2414 LAKE JUNO RD 27298 STATE ROAD 2,573.02 S1518 LAKE LUCAS RD 27350 STATE ROAD 11,755.51 S1518 LAKE LUCAS RD 27205 STATE ROAD 5,601.50 S1409 LAKE PARK RD 27205 STATE ROAD 1,937.91 P8703314 LAKE RIDGE CT 27316 PRIVATE DRIVE 2,564.33 S2196 LAKECREST RD 27203 STATE ROAD 600.67 S1832 LAKESIDE DR 27350 STATE ROAD 1,373.40 C0002095 LAKESIDE DR 27263 CITY STREET 1,194.71 S2208 LAKESIDE PARK RD 27248 STATE ROAD 1,740.28 S1841 LAKEVIEW CT 27360 STATE ROAD 470.12 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-44 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0001182 LAKEVIEW RD 27203 CITY STREET 1,907.33 S1313 LAKEWAY RD 27239 STATE ROAD 2,079.17 S1740 LAKEWOOD CIR 27370 STATE ROAD 2,417.65 S1744 LAKEWOOD CT 27370 STATE ROAD 503.18 S1745 LAKEWOOD CT EXT 27370 STATE ROAD 450.37 C0001183 LAMAR DR 27203 CITY STREET 1,368.97 S1516 LAMB CTRY RD 27205 STATE ROAD 3,254.97 P7765153 LAMB ST 27317 PRIVATE DRIVE 1,517.90 C0003017 LAMBE LN 27248 CITY STREET 218.28 S1157 LAMBERT DR 27205 STATE ROAD 5,298.24 P7750332 LAMBERT MINE ST 27205 PRIVATE DRIVE 297.04 P8702233 LAMBERT TRL 27316 PRIVATE DRIVE 607.12 S2641 LAMBETH MILL RD 27208 STATE ROAD 9,670.19 S2641 LAMBETH MILL RD 27344 STATE ROAD 10,786.00 S2502 LAMINA LN 27298 STATE ROAD 1,136.80 S2363 LAMPLIGHT DR 27317 STATE ROAD 1,984.99 P7798422 LANCASTER LN 27233 PRIVATE DRIVE 915.02 P8703315 LANCELOT DR 27316 PRIVATE DRIVE 1,438.16 S1776 LANCER DR 27263 STATE ROAD 2,255.76 S3242 LAND DALE DR 27263 STATE ROAD 485.95 P8714212 LAND ESTATES DR 27355 PRIVATE DRIVE 1,935.20 C0001592 LANDIS CT 27203 CITY STREET 383.57 C0002096 LANE DR 27370 CITY STREET 4,352.01 S1005 LANES MILL RD 27316 STATE ROAD 10,017.37 S1005 LANES MILL RD 27208 STATE ROAD 6,628.54 S1005 LANES MILL RD 27344 STATE ROAD 4,821.57 S2547 LANGLEY LOOP 27355 STATE ROAD 2,887.93 P8733000 LANGLEY MEADOW RD 27355 PRIVATE DRIVE 1,092.09 S2471 LANGLEY RD 27355 STATE ROAD 10,500.13 C0001185 LANIER AVE 27203 CITY STREET 1,628.98 S1180 LANIER HILL RD 27239 STATE ROAD 5,253.65 S1112 LANIER RD 27205 STATE ROAD 10,247.94 S2370 LANSDOWNE LAKES LN 27203 STATE ROAD 890.98 S1856 LANSDOWNE PL 27360 STATE ROAD 1,981.87 S2294 LANSDOWNE RD 27203 STATE ROAD 1,233.61 S2684 LANTERN DR 27205 STATE ROAD 2,063.15 P7717336 LANVALE AVE 27370 PRIVATE DRIVE 1,839.47 S1846 LANVALE AVE 27370 STATE ROAD 915.71 S1371 LARK DR 27239 STATE ROAD 2,056.84 C0001186 LARKWOOD AVE 27205 CITY STREET 366.18 S3003 LASSITER LN 27205 STATE ROAD 1,457.50 S1107 LASSITER MILL RD 27205 STATE ROAD 46,028.20 S1107 LASSITER MILL RD 27371 STATE ROAD 16,656.14 P7679420 LATHAM HARVELL RD 27205 PRIVATE DRIVE 2,602.00 S2233 LAUGHLIN RD 27317 STATE ROAD 2,820.75 P7773469 LAUGHLIN RD EXT 27317 PRIVATE DRIVE 963.93 C0002097 LAURA AVE 27263 CITY STREET 641.91 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-45 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0006038 LAURA CT 27317 CITY STREET 246.49 S3202 LAURA CT 27205 STATE ROAD 1,271.21 C0001414 LAUREL DR 27205 CITY STREET 1,646.84 S2328 LAUREL LN 27317 STATE ROAD 757.48 P7639237 LAURELWOOD PL 27205 PRIVATE DRIVE 442.39 S3231 LAUREN TAYLOR DR 27370 STATE ROAD 1,202.56 S2992 LAWRENCE DR 27205 STATE ROAD 1,482.45 C0002098 LAWRENCE DR 27263 CITY STREET 671.36 S2351 LAWRENCE FARM LN 27317 STATE ROAD 4,850.90 P7674421 LAWRENCE FARM RD 27341 PRIVATE DRIVE 1,025.39 S2680 LAWRENCE HEIGHTS AVE 27205 STATE ROAD 579.59 P7767311 LAWRENCE SMITH DR 27317 PRIVATE DRIVE 372.55 C0001539 LAWSON CT 27317 CITY STREET 1,314.69 P7706277 LAWSON DR 27370 PRIVATE DRIVE 587.90 S3004 LAZELL AVE 27205 STATE ROAD 1,507.15 P6781530 LAZY LN 27239 PRIVATE DRIVE 2,004.93 S3137 LAZY PINE RD 27317 STATE ROAD 2,605.05 S2905 LEACH MEADOW RD 27341 STATE ROAD 4,183.54 P7708546 LEACH ST 27370 PRIVATE DRIVE 354.82 S3246 LEAH JUSTINE DR 27370 STATE ROAD 2,898.85 S2858 LEATHER RD 27341 STATE ROAD 1,457.48 S2401 LEDBETTER RD 27233 STATE ROAD 1,635.00 S2937 LEDWELL RD 27205 STATE ROAD 1,277.22 S2626 LEE LAYNE RD 27316 STATE ROAD 17,219.13 C0001188 LEE ST 27203 CITY STREET 3,475.65 C0006039 LEE ST 27317 CITY STREET 393.23 P7669527 LEE VALLEY RD 27205 PRIVATE DRIVE 817.20 S3110 LEESVILLE ST 27370 STATE ROAD 814.80 S2814 LEGEND DR 27205 STATE ROAD 1,988.13 P7746397 LEIGH LN 27350 PRIVATE DRIVE 1,835.44 S2841 LEO CRANFORD RD 27205 STATE ROAD 1,457.14 C0001620 LEO LN 27203 CITY STREET 1,621.25 S2383 LEONAE DR 27317 STATE ROAD 2,207.13 S2390 LEONAE DR 27317 STATE ROAD 989.56 P7763136 LEONAE DR 27317 PRIVATE DRIVE 381.11 P8725504 LEONARD DR 27355 PRIVATE DRIVE 412.55 S2541 LEONARD MEADOW RD 27316 STATE ROAD 415.69 P8713419 LEONARD MEADOW RD EXT 27316 PRIVATE DRIVE 403.02 C0005027 LEONARD PARK ST 27316 CITY STREET 957.58 C0005028 LEONARD ST 27316 CITY STREET 314.53 P7773481 LEONARD YORK DR 27317 PRIVATE DRIVE 927.60 P7766123 LEROY SMITH DR 27317 PRIVATE DRIVE 335.58 P7639440 LESLIE ST 27205 PRIVATE DRIVE 711.10 P7694266 LESTER FARM RD 27341 PRIVATE DRIVE 614.18 P7782269 LESTER RD 27248 PRIVATE DRIVE 2,504.38 P7658473 LESTER RUSSELL DR 27205 PRIVATE DRIVE 1,297.11 C0001187 LEVANCE ST 27203 CITY STREET 1,352.72 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-46 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1543 LEVEL PLAINS RD 27350 STATE ROAD 3,755.46 S1446 LEWALLEN RD 27205 STATE ROAD 4,934.33 S2645 LEWIS BROWN RD 27208 STATE ROAD 12,067.86 P7657484 LEWIS CTRY DR 27205 PRIVATE DRIVE 625.59 S1933 LEWIS DAVIS RD 27317 STATE ROAD 5,184.02 C0001189 LEWIS ST 27203 CITY STREET 609.18 S2954 LEWIS THOMAS RD 27205 STATE ROAD 3,676.14 C0001556 LEXINGTON COMMONS DR 27205 CITY STREET 919.29 C0001567 LEXINGTON PL 27205 CITY STREET 422.51 C0001190 LEXINGTON RD 27205 CITY STREET 5,134.40 C0002263 LEYLAND TER 27370 CITY STREET 2,154.36 S1859 LIBBY RD 27370 STATE ROAD 944.53 P7706275 LIBERTY CHURCH DR 27370 PRIVATE DRIVE 875.60 P7669357 LIBERTY CIR 27205 PRIVATE DRIVE 239.96 P7669359 LIBERTY CIR EXT 27205 PRIVATE DRIVE 515.87 S2417 LIBERTY GROVE RD 27298 STATE ROAD 10,612.07 C0004094 LIBERTY PARK AVE 27298 CITY STREET 697.78 C0002191 LIBERTY PL 27263 CITY STREET 299.47 C0004090 LIBERTY PLZ 27298 CITY STREET 498.52 N 62 LIBERTY RD 27263 NC HIGHWAY 3,054.38 C0001191 LIBERTY ST 27203 CITY STREET 1,756.36 C0005029 LIBERTY ST 27316 CITY STREET 2,763.14 S3214 LIBERTYS RUN DR 27350 STATE ROAD 2,824.63 S2330 LIBRA PL 27317 STATE ROAD 1,215.60 P7658480 LILAC LN 27205 PRIVATE DRIVE 816.67 P8606160 LILLIAN TRL 27341 PRIVATE DRIVE 1,398.65 P8615355 LILLIE LN 27341 PRIVATE DRIVE 4,337.61 P7795290 LILLIEWOOD LN 27233 PRIVATE DRIVE 2,206.50 S1747 LILLY FLOWER RD 27263 STATE ROAD 764.45 C0001192 LINCOLN AVE 27205 CITY STREET 108.39 S1458 LINCOLN AVE 27205 STATE ROAD 2,380.89 C0002100 LINDA DR 27263 CITY STREET 3,165.50 S3118 LINDA LN 27205 STATE ROAD 2,828.09 S2948 LINDALE DR 27205 STATE ROAD 1,002.33 C0003018 LINDLEY ST 27248 CITY STREET 313.19 C0002232 LINDSAY DR 27263 CITY STREET 935.89 C0001194 LINDSEY AVE 27203 CITY STREET 2,219.18 P7796496 LINEBERRY LN 27233 PRIVATE DRIVE 962.60 C0001195 LINEBERRY ST 27203 CITY STREET 1,030.80 C0005030 LINEBERRY ST 27316 CITY STREET 911.46 P7707420 LINK CT 27370 PRIVATE DRIVE 370.58 P7707423 LINK RD 27370 PRIVATE DRIVE 853.16 S2727 LINNIE CT 27205 STATE ROAD 974.85 S2837 LIONS REST RD 27205 STATE ROAD 6,286.06 S1217 LISBON RD 27205 STATE ROAD 785.93 S2900 LITTLE BEANE STORE RD 27341 STATE ROAD 11,140.14 S2907 LITTLE BEANE STORE RD 27341 STATE ROAD 5,656.91 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-47 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2900 LITTLE BEANE STORE RD 27316 STATE ROAD 3,971.56 S2868 LITTLE BROOK RD 27341 STATE ROAD 3,358.19 P6796593 LITTLE CREEK DR 27360 PRIVATE DRIVE 1,926.54 S1958 LITTLE FOX RD 27317 STATE ROAD 2,543.85 S1479 LITTLE GATE DR 27203 STATE ROAD 2,417.86 P8713372 LITTLE GOLDEN TRL 27316 PRIVATE DRIVE 318.87 P7742410 LITTLE LAKES TRL 27205 PRIVATE DRIVE 2,409.98 S2145 LITTLE POINT RD 27317 STATE ROAD 2,583.64 C0008030 LITTLE RD 27355 CITY STREET 520.48 S1119 LITTLE RIVER RD 27205 STATE ROAD 18,365.83 N 705 LITTLE RIVER RD 27341 NC HIGHWAY 2,799.44 S1119 LITTLE RIVER RD 27341 STATE ROAD 728.18 S1402 LITTLE UWHARRIE RD 27360 STATE ROAD 4,916.01 P7784136 LITTLES DR 27248 PRIVATE DRIVE 1,137.35 S1793 LLOYD ST 27205 STATE ROAD 850.56 C0001196 LOACH ST 27203 CITY STREET 2,335.06 S1816 LOBLOLLY DR 27350 STATE ROAD 1,932.19 P7797409 LOCK HIGHLAND CT 27233 PRIVATE DRIVE 796.97 C0002101 LOCKHART ST 27263 CITY STREET 1,045.24 P7785177 LOCUST GROVE DR 27248 PRIVATE DRIVE 2,399.30 P7711461 LOCUST MTN TRL 27205 PRIVATE DRIVE 1,129.76 S2690 LOE FALL AVE 27205 STATE ROAD 1,644.76 S1946 LOFLIN DAIRY RD 27350 STATE ROAD 919.20 S3279 LOFLIN FARLOW LN 27350 STATE ROAD 1,169.55 S1341 LOFLIN HILL RD 27370 STATE ROAD 10,294.88 S2221 LOFLIN POND RD 27203 STATE ROAD 10,420.52 S2893 LOG CABIN RD 27316 STATE ROAD 14,015.19 C0004091 LOGAN LN 27298 CITY STREET 2,618.45 S3114 LOIS LN 27263 STATE ROAD 946.18 C0001627 LONDELLE LN 27205 CITY STREET 450.46 P8738100 LONG MEADOW DR 27298 PRIVATE DRIVE 2,341.38 S3179 LONGVIEW AVE 27370 STATE ROAD 662.14 C0002102 LONGVIEW DR 27263 CITY STREET 1,652.05 C0002103 LONITA ST 27263 CITY STREET 1,162.46 S1797 LORD RANDOLPH CIR 27205 STATE ROAD 397.28 S2525 LORENE AVE 27298 STATE ROAD 998.01 P7748245 LORIEN CHARTER DR 27317 PRIVATE DRIVE 1,349.79 P7679425 LOTUS LN 27205 PRIVATE DRIVE 122.90 S1179 LOU CRANFORD RD 27239 STATE ROAD 15,699.22 P7765251 LOU MYERS LN 27317 PRIVATE DRIVE 669.07 P7774499 LOVELL DR 27317 PRIVATE DRIVE 1,059.39 S2481 LOW BRIDGE RD 27316 STATE ROAD 4,116.35 S2481 LOW BRIDGE RD 27248 STATE ROAD 3,236.59 S2481 LOW BRIDGE RD 27298 STATE ROAD 12,807.60 S2916 LOWDERMILK RD 27205 STATE ROAD 1,290.46 S1419 LOWE CTRY RD 27205 STATE ROAD 3,386.38 S2282 LOWE DR 27317 STATE ROAD 1,133.24 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-48 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1767 LOWERYWOOD CIR 27370 STATE ROAD 2,105.03 C0007013 LUCK DR 27341 CITY STREET 562.04 C0002104 LUCK DR 27263 CITY STREET 1,026.13 S2604 LUCK RD 27205 STATE ROAD 14,853.76 P7639333 LUCY LN 27205 PRIVATE DRIVE 773.19 P7649441 LUDLUM LN 27205 PRIVATE DRIVE 2,562.56 S2071 LULA RAY RD 27317 STATE ROAD 968.15 C0002105 LUNAR DR 27263 CITY STREET 1,639.91 P7639442 LUTHER CTRY LN 27205 PRIVATE DRIVE 1,020.08 P7624293 LUTHER HURLEY RD 27371 PRIVATE DRIVE 1,861.80 C0001610 LUXURY LN 27205 CITY STREET 992.26 C0002106 LYNBROOK DR 27263 CITY STREET 907.50 P7745394 LYNDON LN 27350 PRIVATE DRIVE 596.48 P6795368 LYNN CIR E 27370 PRIVATE DRIVE 1,210.82 P6795367 LYNN CIR W 27370 PRIVATE DRIVE 1,234.85 C0002107 LYNN DR 27263 CITY STREET 1,103.59 S3188 LYNN OAKS DR 27370 STATE ROAD 854.04 S1784 LYNN VIEW DR 27370 STATE ROAD 793.15 P7764444 LYNNWAY DR 27317 PRIVATE DRIVE 935.81 P8606257 MAC CRISCOE RD 27341 PRIVATE DRIVE 1,102.95 C0001204 MACARTHUR ST 27203 CITY STREET 693.98 S2409 MACEDONIA LOOP RD 27298 STATE ROAD 1,264.70 S2504 MACEDONIA LOOP RD 27298 STATE ROAD 2,814.44 C0001564 MACHALA DR 27317 CITY STREET 511.43 S2138 MACK LINEBERRY RD 27233 STATE ROAD 9,726.13 S2138 MACK LINEBERRY RD 27248 STATE ROAD 17,161.79 S1144 MACK RD 27205 STATE ROAD 23,583.46 C0001616 MACK RD 27205 CITY STREET 1,363.92 C0001197 MACKIE AVE 27205 CITY STREET 1,661.19 C0002108 MACON DR 27263 CITY STREET 1,634.64 S2654 MACON FARM RD 27316 STATE ROAD 8,766.85 C0001198 MACON ST 27203 CITY STREET 1,379.16 S2063 MADDY LN 27263 STATE ROAD 430.02 S2725 MADISON CIR 27205 STATE ROAD 2,261.37 C0002207 MAE MATILDA CT 27263 CITY STREET 157.57 C0006040 MAGNOLIA DR 27317 CITY STREET 855.77 S2009 MAGNOLIA LN 27317 STATE ROAD 914.50 C0002224 MAGNOLIA LN 27263 CITY STREET 1,122.48 C0005031 MAIN ST 27316 CITY STREET 1,852.57 P7765267 MAJESTIC OAK DR 27317 PRIVATE DRIVE 1,427.42 P7766468 MALLARD DR 27317 PRIVATE DRIVE 1,711.74 S2136 MAMIE MAY RD 27248 STATE ROAD 16,279.39 S2198 MAMIE MAY RD 27248 STATE ROAD 6,026.92 P7766471 MANDARIN CT 27317 PRIVATE DRIVE 456.88 C0001578 MANDOVER CT 27205 CITY STREET 298.27 P7699324 MANESS COBLE DR 27205 PRIVATE DRIVE 847.85 C0006112 MANESS DR 27317 CITY STREET 589.21 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-49 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2871 MANESS RD 27341 STATE ROAD 6,392.25 C0001199 MANOR CIR 27205 CITY STREET 488.97 P7726369 MANOR PARK DR 27350 PRIVATE DRIVE 467.65 S1755 MANOR RIDGE DR 27263 STATE ROAD 1,274.51 S2636 MANOR ROCK RD 27344 STATE ROAD 7,238.74 O9999 MANOR ROCK RD 27344 OUT OF COUNTY 30.31 S2977 MANORVIEW RD 27205 STATE ROAD 4,927.70 C0001200 MAPLE AVE 27203 CITY STREET 1,850.83 C0002226 MAPLE GROVE CT 27263 CITY STREET 552.57 P7628529 MAPLE HILL CT 27205 PRIVATE DRIVE 384.86 P6795256 MAPLE LEAF CT 27370 PRIVATE DRIVE 325.01 P6797210 MAPLE OAK DR 27263 PRIVATE DRIVE 484.17 P7783230 MAPLE RIDGE DR 27248 PRIVATE DRIVE 1,050.00 S2326 MAPLE RIDGE RD 27203 STATE ROAD 971.24 P7767484 MAPLE RUN DR 27317 PRIVATE DRIVE 769.71 S1125 MAPLE SPRINGS RD 27341 STATE ROAD 10,006.56 P8725114 MAPLE WAY 27355 PRIVATE DRIVE 529.51 P7778541 MAPLEGATE LN 27313 PRIVATE DRIVE 2,084.21 C0004038 MAPLEWOOD CIR 27298 CITY STREET 843.13 C0002110 MAPLEWOOD CT 27370 CITY STREET 212.64 P7796498 MAPLEWOOD LN 27233 PRIVATE DRIVE 2,925.10 S2735 MARATHON DR 27205 STATE ROAD 2,445.58 S3168 MARCAL CIR 27350 STATE ROAD 2,881.61 S2288 MARCLIF RD 27248 STATE ROAD 1,693.20 S2462 MARGARET CHAPEL RD 27355 STATE ROAD 1,257.93 P7706478 MARIE DR 27370 PRIVATE DRIVE 3,582.98 P7720486 MARIGOLD LN 27205 PRIVATE DRIVE 1,689.93 C0001201 MARK AVE 27205 CITY STREET 1,199.36 C0004088 MARKET AVE 27298 CITY STREET 263.82 S2025 MARKET DR 27350 STATE ROAD 1,274.99 C00001629 MARKWOOD ST 27203 CITY STREET 185.52 S1527 MARLBORO CHURCH RD 27350 STATE ROAD 6,815.96 S 1527 MARLBORO CHURCH RD 27350 STATE ROAD 582.67 S1774 MARLBROOK CT 27370 STATE ROAD 3,206.94 S2536 MARLEY CIR 27355 STATE ROAD 909.94 P8607100 MARLEY FARM RD 27341 PRIVATE DRIVE 3,409.03 C0001202 MARMADUKE CIR 27203 CITY STREET 599.49 C0002270 MARQUISE CT 27370 CITY STREET 406.05 S1993 MARSH CTRY LN 27317 STATE ROAD 876.21 S1523 MARSH MTN RD 27350 STATE ROAD 6,894.83 P7781155 MARSHALL LN 27205 PRIVATE DRIVE 1,864.47 C0002111 MARSHALL ST 27263 CITY STREET 814.83 C0006114 MARTHA CT 27317 CITY STREET 167.65 P6689531 MARTHA DR 27239 PRIVATE DRIVE 1,681.63 S1257 MARTIN HILL AVE 27205 STATE ROAD 1,384.44 C0001247 MARTIN LUTHER KING JR DR 27203 CITY STREET 3,645.53 S2189 MARTIN LUTHER KING JR DR 27203 STATE ROAD 2,485.97 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-50 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7786440 MARY ROBBINSON RD 27233 PRIVATE DRIVE 835.06 P7735020 MARY VIOLA DR 27350 PRIVATE DRIVE 2,074.91 C0010006 MARYLAND DR 27360 CITY STREET 1,737.02 S2342 MASON CIR 27317 STATE ROAD 2,548.92 P7790312 MASONS DR 27205 PRIVATE DRIVE 673.85 C0003019 MATTHEWS ST 27248 CITY STREET 1,808.46 S2013 MAULDIN DR 27263 STATE ROAD 659.99 P7740325 MAURINE DR 27205 PRIVATE DRIVE 971.47 P7740326 MAYBERRY LN 27205 PRIVATE DRIVE 831.88 S2337 MAYFLOWER DR 27313 STATE ROAD 1,089.23 C0002112 MAYNARD DR 27370 CITY STREET 1,001.28 C0001203 MCALISTER ST 27203 CITY STREET 596.88 S2110 MCCLINTOCK RD 27233 STATE ROAD 2,219.31 P7764446 MCCOLLUM FARM RD 27317 PRIVATE DRIVE 884.86 C0006041 MCCOLLUM ST 27317 CITY STREET 371.90 S1956 MCCOLLUM ST 27317 STATE ROAD 2,377.19 S2821 MCCRANFORD RD 27205 STATE ROAD 2,274.66 P7664221 MCCRARY CTRY LN 27341 PRIVATE DRIVE 499.97 S1373 MCDANIEL DR 27205 STATE ROAD 2,143.71 S1164 MCDANIEL RD 27205 STATE ROAD 1,136.30 S2815 MCDERMOTT ST 27205 STATE ROAD 4,397.68 P7782165 MCDOWELL CTRY TRL 27203 PRIVATE DRIVE 4,496.53 S1150 MCDOWELL RD 27205 STATE ROAD 2,829.89 C0001206 MCDOWELL RD 27205 CITY STREET 3,189.16 P7694463 MCKAY RD 27341 PRIVATE DRIVE 471.97 C0001207 MCKNIGHT ST 27203 CITY STREET 3,128.35 P7679430 MCLAREN LN 27205 PRIVATE DRIVE 373.62 C0001625 MCLARKLING LN 27205 CITY STREET 255.16 C0001208 MCLAURIN DR 27203 CITY STREET 551.70 S1489 MCMASTERS ST 27203 STATE ROAD 881.81 C0001209 MCMASTERS ST 27203 CITY STREET 442.84 S1488 MCNEAL ST 27203 STATE ROAD 293.03 S1976 MCNEILL RD 27263 STATE ROAD 894.85 P8727511 MCPHERSON FARM DR 27298 PRIVATE DRIVE 1,155.97 C0001210 MCPHERSON ST 27203 CITY STREET 632.44 S2511 MCQUEEN RD 27316 STATE ROAD 256.17 S2511 MCQUEEN RD 27316 STATE ROAD 960.04 P6797103 MCWAY CT 27360 PRIVATE DRIVE 558.08 S1750 MEADE DR 27370 STATE ROAD 599.19 S3177 MEADOW ACRES LN 27350 STATE ROAD 1,323.24 S3199 MEADOW CT 27370 STATE ROAD 632.68 S3198 MEADOW DR 27370 STATE ROAD 895.70 P7745392 MEADOW LAKE LN 27350 PRIVATE DRIVE 1,001.30 S1818 MEADOW LARK LN 27350 STATE ROAD 2,326.96 S2685 MEADOW RD 27205 STATE ROAD 1,778.04 P7790424 MEADOW RIDGE CT 27205 PRIVATE DRIVE 599.97 S2869 MEADOWBRANCH RD 27341 STATE ROAD 14,003.10 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-51 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1564 MEADOWBROOK DR 27370 STATE ROAD 21,276.48 C0001212 MEADOWBROOK RD 27203 CITY STREET 5,933.78 C0001212 MEADOWBROOK RD EXT 27203 CITY STREET 681.98 S1786 MEADOWBROOK VIEW RD 27360 STATE ROAD 1,281.17 S1768 MEADOWDALE LN 27370 STATE ROAD 1,001.77 C0001545 MEADOWGATE DR 27317 CITY STREET 533.28 P7646535 MEADOWLANDS DR 27205 PRIVATE DRIVE 8,121.47 S2353 MEADOWLARK CT 27317 STATE ROAD 905.76 S3205 MEADOWOOD CT 27370 STATE ROAD 235.61 C0005032 MEADOWOOD DR 27316 CITY STREET 439.90 P7795532 MEADOWS CTRY LN 27248 PRIVATE DRIVE 1,406.54 S1170 MECHANIC RD 27205 STATE ROAD 3,535.92 S2703 MEDFIELD CIR 27205 STATE ROAD 457.07 C0005057 MEGAN DR 27316 CITY STREET 719.30 P7728547 MELISSA CT 27263 PRIVATE DRIVE 145.41 P8628010 MELLIE RD 27316 PRIVATE DRIVE 3,120.31 P7764175 MELODY LN 27317 PRIVATE DRIVE 472.99 C0001213 MEMORIAL ST 27203 CITY STREET 502.15 P7782497 MEMORY LN 27203 PRIVATE DRIVE 609.63 S1615 MENDENHALL PL 27263 STATE ROAD 521.31 S1610 MENDENHALL RD 27263 STATE ROAD 11,688.97 S1599 MENDENHALL RD EXT 27263 STATE ROAD 2,778.10 S1599 MENDENHALL RD EXT 27370 STATE ROAD 449.86 P8706286 MEREDELL FARM RD 27298 PRIVATE DRIVE 948.66 S1136 MEREDITH CTRY RD 27205 STATE ROAD 3,299.14 C0002113 MEREDITH DR 27263 CITY STREET 790.14 C0002113 MEREDITH DR 27370 CITY STREET 1,331.33 S1661 MERLE DR 27370 STATE ROAD 1,867.18 S1827 MEYERS ST 27263 STATE ROAD 883.23 P8721012 MICHAEL DR 27316 PRIVATE DRIVE 3,743.86 S1618 MIDDLE POINT RD 27263 STATE ROAD 1,853.30 C0001602 MIDDLETON CIR 27205 CITY STREET 884.66 S2939 MIDWAY ACRES RD 27205 STATE ROAD 3,734.88 P7758262 MIDWAY FORREST DR 27317 PRIVATE DRIVE 559.75 P7764169 MIDWAY VIEW DR 27317 PRIVATE DRIVE 913.38 C0001600 MILBROOK DR 27205 CITY STREET 507.36 S2828 MILES MOFFITT RD 27205 STATE ROAD 4,529.74 S2657 MILL CREEK RD 27316 STATE ROAD 15,331.29 P7790426 MILL CREEK RDG 27205 PRIVATE DRIVE 1,087.40 P7782268 MILL HOUSE LN 27248 PRIVATE DRIVE 1,124.66 S3166 MILL POND DR 27350 STATE ROAD 1,000.23 P7743001 MILL POND DR EXT 27350 PRIVATE DRIVE 348.80 S3165 MILL RACE CT 27350 STATE ROAD 1,166.06 C0006042 MILL ST 27317 CITY STREET 1,066.95 S2122 MILLBORO RD 27248 STATE ROAD 9,632.17 P7741392 MILLER CTRY DR 27205 PRIVATE DRIVE 1,047.92 P7706469 MILLER FARM DR 27370 PRIVATE DRIVE 4,022.19 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-52 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1545 MILLERS MILL RD 27370 STATE ROAD 16,907.27 P7645529 MILLIE LN 27205 PRIVATE DRIVE 3,195.40 C0001215 MILLIKAN AVE 27203 CITY STREET 258.92 P7775326 MILLIKAN FARM RD 27248 PRIVATE DRIVE 2,460.26 S1522 MILLIKAN RD 27350 STATE ROAD 4,908.25 S2279 MILLIKAN WAY 27317 STATE ROAD 656.98 P7797207 MILTON DR 27233 PRIVATE DRIVE 410.72 P7694265 MILTON RD 27341 PRIVATE DRIVE 941.80 P7764453 MIMOSA CT 27317 PRIVATE DRIVE 755.53 P7720487 MIN LEE DR 27205 PRIVATE DRIVE 2,344.01 P8704478 MINT HILL DR 27298 PRIVATE DRIVE 1,577.47 C0005061 MISSION HTS 27316 CITY STREET 782.49 P6799394 MISSIONARY CHURCH DR 27260 PRIVATE DRIVE 311.02 S1364 MISTY DR 27360 STATE ROAD 2,486.85 P6783416 MISTY DR 27360 PRIVATE DRIVE 473.31 C0002215 MISTY LN 27263 CITY STREET 234.61 P7736335 MITCHELL ESTATES ST 27350 PRIVATE DRIVE 327.15 C0002114 MITCHELL ST 27263 CITY STREET 552.70 P7797218 MOBILE CT 27233 PRIVATE DRIVE 399.34 P7737303 MOBILE DR 27263 PRIVATE DRIVE 1,022.85 S2895 MOFFITT MILL RD 27316 STATE ROAD 7,023.93 S1321 MOFFITT RD 27205 STATE ROAD 3,112.52 P7730239 MOFFITT RD EXT 27205 PRIVATE DRIVE 256.27 C0005033 MOFFITT ST 27316 CITY STREET 805.61 P7752574 MONARCH LN 27205 PRIVATE DRIVE 1,233.74 P7797304 MONDA RD 27233 PRIVATE DRIVE 2,255.83 S1208 MONROE AVE 27205 STATE ROAD 3,203.38 P6797522 MONTANA DR 27360 PRIVATE DRIVE 860.96 S1216 MONTCLAIR CT 27205 STATE ROAD 1,387.26 S1256 MONTEREY RD 27205 STATE ROAD 8,167.33 S1253 MONTLEY VIEW DR 27205 STATE ROAD 745.22 C0001216 MOODY ST 27203 CITY STREET 520.72 P7617459 MOONLIGHT MEADOW RD 27205 PRIVATE DRIVE 604.85 O8888 MOONS CHAPEL RD 27344 OUT OF COUNTY DRIVE 107.73 C0006043 MOORE AVE 27317 CITY STREET 1,626.44 S1318 MOORE RD 27205 STATE ROAD 19,728.03 P7676188 MORAN DR 27205 PRIVATE DRIVE 1,784.03 P8619271 MORELAND RD 27344 PRIVATE DRIVE 809.03 C0001217 MORGAN AVE 27205 CITY STREET 1,333.83 S2265 MORGAN CTRY RD 27203 STATE ROAD 2,489.82 C0011027 MORGAN ST 27370 CITY STREET 1,880.82 C0006044 MORGAN ST 27317 CITY STREET 332.45 S2312 MORNING GLORY RD 27317 STATE ROAD 3,411.32 P7763133 MORNING GLORY RD 27317 PRIVATE DRIVE 1,045.76 P7714555 MORNING SIDE LN 27370 PRIVATE DRIVE 1,670.04 P7675286 MORNING VIEW RD 27341 PRIVATE DRIVE 3,201.26 P7743009 MORNINGDEW DR 27350 PRIVATE DRIVE 2,065.87 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-53 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7745490 MORNINGSIDE RD 27317 PRIVATE DRIVE 1,197.18 S1557 MORRIS RD 27370 STATE ROAD 4,211.38 S2816 MORTON AVE 27205 STATE ROAD 1,383.27 P7728379 MOSE DR 27263 PRIVATE DRIVE 1,322.77 C0006045 MOUNTAIN AVE 27317 CITY STREET 1,141.95 S3200 MOUNTAIN BROOK RD 27205 STATE ROAD 2,161.33 P7722320 MOUNTAIN BROOK RD EXT 27205 PRIVATE DRIVE 456.24 P7646559 MOUNTAIN CREEK RD 27205 PRIVATE DRIVE 5,427.63 S2083 MOUNTAIN LAKE RD 27205 STATE ROAD 3,653.35 P7658476 MOUNTAIN LAUREL LN 27205 PRIVATE DRIVE 1,294.64 S2730 MOUNTAIN LN 27205 STATE ROAD 742.73 P7713381 MOUNTAIN MEADOW DR 27205 PRIVATE DRIVE 2,916.77 S2738 MOUNTAIN OAK VIEW DR 27205 STATE ROAD 2,518.37 P7783132 MOUNTAIN OAKS DR 27248 PRIVATE DRIVE 1,062.39 P7780436 MOUNTAIN OF FAITH RD 27205 PRIVATE DRIVE 1,940.80 C0001218 MOUNTAIN RD 27205 CITY STREET 3,120.60 P7722451 MOUNTAIN TER 27205 PRIVATE DRIVE 1,178.38 C0001571 MOUNTAIN TOP DR 27203 CITY STREET 1,003.97 S3282 MOUNTAIN VALLEY DR 27205 STATE ROAD 1,916.56 P7752569 MOUNTAIN VALLEY PL 27205 PRIVATE DRIVE 537.46 S3119 MOUNTAIN VIEW DR 27205 STATE ROAD 3,685.03 P7636354 MOUNTAIN VIEW RD 27205 PRIVATE DRIVE 1,273.86 S1866 MOUNTAIN VIEW WAY 27360 STATE ROAD 728.90 S1759 MOUNTAINVIEW ST 27370 STATE ROAD 2,371.27 C0001219 MT CROSS ST 27203 CITY STREET 888.70 S1542 MT GILEAD CHURCH RD 27350 STATE ROAD 8,561.44 S1111 MT LEBANON RD 27371 STATE ROAD 7,159.40 S1111 MT LEBANON RD 27205 STATE ROAD 10,482.65 S1536 MT OLIVE CHURCH RD 27350 STATE ROAD 5,761.58 S2480 MT OLIVET CHURCH RD 27298 STATE ROAD 1,967.79 S1410 MT SHEPHERD RD 27205 STATE ROAD 8,543.49 S1686 MT SHEPHERD RD EXT 27205 STATE ROAD 6,491.32 S2661 MT TABOR CHURCH RD 27205 STATE ROAD 4,487.27 S1413 MT VIEW CHURCH RD 27205 STATE ROAD 10,773.57 S1413 MT VIEW CHURCH RD 27350 STATE ROAD 1,153.00 S1922 MUDDY CREEK RD 27263 STATE ROAD 14,225.20 S2495 MULBERRY ACADEMY ST 27316 STATE ROAD 4,579.98 S2495 MULBERRY ACADEMY ST 27248 STATE ROAD 8,818.37 S1249 MURIEL LN 27205 STATE ROAD 1,073.66 C0002115 MURRAY CIR 27263 CITY STREET 1,762.71 P7684196 MUSTANG TRL 27341 PRIVATE DRIVE 1,680.78 P7750384 MYRTLE ST 27205 PRIVATE DRIVE 1,807.41 C0004042 N ASHEBORO ST 27298 CITY STREET 5,016.19 S2489 N BRADY ST 27316 STATE ROAD 541.13 U220ALT N BROAD ST 27341 US HIGHWAY 3,534.74 C0001221 N CHURCH ST 27203 CITY STREET 4,364.61 C0006046 N COBLE ST 27317 CITY STREET 660.24 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-54 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0001222 N COX ST 27203 CITY STREET 1,922.62 C0004007 N DEPOT ST 27298 CITY STREET 563.90 C0001223 N ELM ST 27203 CITY STREET 4,332.42 C0004027 N FAUST ST 27298 CITY STREET 927.78 C0004043 N FAYETTEVILLE ST 27298 CITY STREET 2,696.08 U220BUS N FAYETTEVILLE ST 27203 US HIGHWAY 26,259.04 C0004044 N FOSTER ST 27298 CITY STREET 2,505.47 C0004033 N GREENBRIAR ST 27298 CITY STREET 2,324.40 C0004045 N GREENSBORO ST 27298 CITY STREET 5,267.37 C0001225 N HIGH ST 27203 CITY STREET 538.17 C0004046 N KIRKMAN ST 27298 CITY STREET 766.93 U220BUS N MAIN ST 27317 US HIGHWAY 6,230.59 C0001226 N MAIN ST 27203 CITY STREET 1,692.11 S1009 N MAIN ST 27263 STATE ROAD 8,466.20 C0008015 N MAIN ST 27355 CITY STREET 4,366.18 C0001227 N MCCRARY ST 27203 CITY STREET 795.29 S1455 N MCCRARY ST 27205 STATE ROAD 2,087.41 C0001205 N MCCRARY ST 27205 CITY STREET 1,478.19 C0004041 N MYRTLE ST 27298 CITY STREET 429.75 P7740246 N OAKDALE ST 27205 PRIVATE DRIVE 1,067.53 C0001228 N PARK DR 27205 CITY STREET 237.82 S1476 N PARK DR 27205 STATE ROAD 313.62 C0001229 N PARK ST 27203 CITY STREET 2,420.16 C0001230 N RANDOLPH AVE 27203 CITY STREET 554.22 C0004054 N RANDOLPH ST 27298 CITY STREET 854.84 C0004047 N REECE ST 27298 CITY STREET 1,494.70 C0001231 N ROCKRIDGE RD 27205 CITY STREET 2,114.12 C0004048 N SMITH ST 27298 CITY STREET 3,480.72 C0004065 N STALEY ST 27298 CITY STREET 1,162.87 C0008016 N STALEY ST 27355 CITY STREET 3,194.89 C0006048 N STOUT ST 27317 CITY STREET 2,063.81 C0004067 N TIMBERLEA ST 27298 CITY STREET 1,324.69 C0001232 N TREMONT DR 27203 CITY STREET 990.82 S2530 NANCE CTRY DR 27233 STATE ROAD 2,093.44 S2225 NANCE RD 27248 STATE ROAD 4,426.48 P7783422 NANCE RD EXT 27248 PRIVATE DRIVE 750.26 P6795523 NANCY LN 27370 PRIVATE DRIVE 880.47 C0002203 NAOLA CT 27263 CITY STREET 593.18 S2119 NAOMI RD 27317 STATE ROAD 5,804.57 S2119 NAOMI RD 27248 STATE ROAD 3,626.12 S2842 NASSAU TRL 27205 STATE ROAD 4,540.22 P7694462 NATHAN LN 27341 PRIVATE DRIVE 1,205.70 P7648257 NATHANS TRL 27205 PRIVATE DRIVE 2,241.93 C0002118 NAVAJO DR 27263 CITY STREET 915.65 N 109 NC HWY 109 28127 NC HIGHWAY 2,784.05 N 134 NC HWY 134 27205 NC HIGHWAY 41,802.31 N 22/42 NC HWY 22 42 27208 NC HIGHWAY 17,656.14 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-55 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) N 22/42 NC HWY 22 42 27316 NC HIGHWAY 16,155.98 N 22N NC HWY 22 N 27233 NC HIGHWAY 30,212.36 N 22N NC HWY 22 N 27248 NC HIGHWAY 30,193.42 N 22N NC HWY 22 N 27316 NC HIGHWAY 6,517.99 N 22S NC HWY 22 S 27316 NC HIGHWAY 33,821.67 N 22S NC HWY 22 S 27344 NC HIGHWAY 912.09 N 42N NC HWY 42 N 27203 NC HIGHWAY 3,949.83 N 42S NC HWY 42 S 27205 NC HIGHWAY 43,223.75 N 42S NC HWY 42 S 27316 NC HIGHWAY 25,404.05 N 47 NC HWY 47 27239 NC HIGHWAY 9,649.44 N 49N NC HWY 49 N 27298 NC HIGHWAY 28,919.88 N 49N NC HWY 49 N 27316 NC HIGHWAY 21,054.66 N 49S NC HWY 49 S 27205 NC HIGHWAY 46,977.97 N 49S NC HWY 49 S 27239 NC HIGHWAY 34,031.09 N 62 NC HWY 62 27360 NC HIGHWAY 3,916.60 N 62 NC HWY 62 27370 NC HIGHWAY 20,657.81 N 705 NC HWY 705 27341 NC HIGHWAY 16,399.36 C0006049 NEAL ST 27317 CITY STREET 526.50 S2064 NEE NEE LN 27263 STATE ROAD 476.19 P7685506 NEEDHAMS TRL 27341 PRIVATE DRIVE 6,199.64 C0001233 NEELY DR 27205 CITY STREET 2,231.93 S1322 NEELY RD 27205 STATE ROAD 3,002.16 S1945 NELSON PARK RD 27350 STATE ROAD 3,035.36 P7774288 NELSON PL 27248 PRIVATE DRIVE 2,847.83 P7785580 NELSON POND DR 27248 PRIVATE DRIVE 915.89 P7725410 NELSON RD 27350 PRIVATE DRIVE 596.30 S1537 NELSON RD 27350 STATE ROAD 4,415.65 P7782223 NEVIT LN 27248 PRIVATE DRIVE 2,617.79 S2864 NEW CENTER CHURCH RD 27341 STATE ROAD 9,624.45 S1244 NEW CENTURY DR 27205 STATE ROAD 2,600.54 S1121 NEW HOPE CHURCH RD 27205 STATE ROAD 27,578.35 S1181 NEW HOPE RD 27239 STATE ROAD 41,059.37 S2116 NEW SALEM RD 27317 STATE ROAD 21,515.12 S2116 NEW SALEM RD 27233 STATE ROAD 15,981.14 C0010005 NEW YORK DR 27360 CITY STREET 1,520.64 P7745172 NEWB HILL RD 27350 PRIVATE DRIVE 2,235.60 C0001416 NEWBERN AVE 27205 CITY STREET 2,702.66 S2922 NEWBERN AVE 27205 STATE ROAD 3,117.85 C0001234 NEWELL ST 27203 CITY STREET 1,311.77 C0005034 NEWELL ST 27316 CITY STREET 519.67 P8701115 NEWELL ST EXT 27316 PRIVATE DRIVE 275.54 P7736029 NEWLIN FARM RD 27350 PRIVATE DRIVE 1,034.19 P7764443 NEWMAN TRL 27317 PRIVATE DRIVE 668.11 P6685436 NICHOLS CRANFORD RD 27239 PRIVATE DRIVE 4,160.71 C0001626 NICKI ST 27205 CITY STREET 142.99 P7723534 NIGHTHAWK RD 27205 PRIVATE DRIVE 947.58 S2339 NIGHTWOOD DR 27317 STATE ROAD 2,774.47 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-56 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7747088 NINA COLTRANE LN 27317 PRIVATE DRIVE 828.68 P7775294 NIXON FARM RD 27248 PRIVATE DRIVE 3,398.08 P8712104 NOAH RD 27316 PRIVATE DRIVE 592.78 P7725345 NOAHS TRL 27350 PRIVATE DRIVE 455.36 S1825 NOLA ST 27370 STATE ROAD 441.00 S1826 NOLA ST EXT 27370 STATE ROAD 662.36 S2813 NOLEN AVE 27205 STATE ROAD 1,189.22 S2921 NOLEN AVE EXT 27205 STATE ROAD 526.25 C0002119 NORMAN AVE 27370 CITY STREET 1,495.42 S1438 NORMAN ST 27205 STATE ROAD 867.92 C0003053 NORRIS ST 27248 CITY STREET 632.63 C0001451 NORTH ASHEBORO SCHOOL RD 27203 CITY STREET 3,899.54 P7722455 NORTH CLUB DR 27205 PRIVATE DRIVE 1,476.54 P7669532 NORTH LAKE DR 27205 PRIVATE DRIVE 742.53 S2972 NORTH LAKE DR 27205 STATE ROAD 988.76 C0001544 NORTH MEADOWS LOOP 27317 CITY STREET 4,616.47 P7765263 NORTH PIN OAK DR 27317 PRIVATE DRIVE 823.61 S2978 NORTH POINTE DR 27205 STATE ROAD 765.66 C0001235 NORTH ST 27203 CITY STREET 818.44 C0007015 NORTH ST 27341 CITY STREET 436.55 S2947 NORTHAMPTON DR 27205 STATE ROAD 2,463.70 C0002120 NORTHEAST DR 27263 CITY STREET 1,734.10 S2041 NORTHLAND DR 27263 STATE ROAD 1,265.49 S3196 NORTHMONT DR 27205 STATE ROAD 5,228.74 P7752575 NORTHMONT LAKE DR 27205 PRIVATE DRIVE 1,900.86 C0001236 NORTHRIDGE DR 27205 CITY STREET 690.63 C0001605 NORTHSHORE DR 27203 CITY STREET 2,080.24 C0001237 NORTHSIDE TER 27203 CITY STREET 3,758.65 S2214 NORTHVIEW DR 27203 STATE ROAD 1,852.86 C0002117 NORTHVIEW PL 27263 CITY STREET 397.09 C0001238 NORTHWOOD DR 27203 CITY STREET 3,204.82 C0006124 NORTHWOODS CT 27317 CITY STREET 329.30 P7714109 NORWOOD CT 27370 PRIVATE DRIVE 240.67 P7781292 NORWOOD LN 27205 PRIVATE DRIVE 262.35 C0001239 NOTTINGHAM ST 27203 CITY STREET 1,810.24 S2938 NUBY PURVIS RD 27325 STATE ROAD 1,512.26 P6797104 NUGGETT CT 27360 PRIVATE DRIVE 461.65 S2632 O H STALEY RD 27316 STATE ROAD 8,468.45 C0001586 OAK BEND DR 27203 CITY STREET 928.04 S3229 OAK BROOK CT 27370 STATE ROAD 586.03 S3208 OAK BUCKET RD 27360 STATE ROAD 767.25 S1893 OAK CT 27370 STATE ROAD 258.60 C0001240 OAK DR 27205 CITY STREET 1,098.43 C0002121 OAK FOREST LN 27370 CITY STREET 1,612.39 S1175 OAK GROVE CHURCH RD 27205 STATE ROAD 21,986.96 S1895 OAK HAVEN CT 27370 STATE ROAD 156.59 S1894 OAK HAVEN DR 27370 STATE ROAD 1,720.89 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-57 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7796299 OAK HILL DR 27233 PRIVATE DRIVE 2,131.99 S1367 OAK HOLLOW DR 27205 STATE ROAD 1,845.26 P7794293 OAK HOLLOW TRL 27248 PRIVATE DRIVE 1,942.98 S1842 OAK KNOLL CT 27360 STATE ROAD 611.01 S1683 OAK KNOLL DR 27370 STATE ROAD 1,651.81 P7765265 OAK LEAF PL 27317 PRIVATE DRIVE 308.45 S1323 OAK LEAF RD 27205 STATE ROAD 1,829.25 C0001532 OAK LEAF RD 27205 CITY STREET 2,337.67 C0006050 OAK LN 27317 CITY STREET 1,714.95 C0002269 OAK RIDGE DR 27263 CITY STREET 1,261.58 C0003020 OAK ST 27248 CITY STREET 478.11 C0005035 OAK ST 27316 CITY STREET 1,073.83 P7646563 OAK TREE RD 27205 PRIVATE DRIVE 1,930.96 S2910 OAK VIEW LN 27205 STATE ROAD 4,873.17 C0002262 OAK WAY 27263 CITY STREET 656.99 C0004050 OAKDALE AVE 27298 CITY STREET 301.46 P7648137 OAKDALE DR 27205 PRIVATE DRIVE 903.67 C0001241 OAKDALE ST 27203 CITY STREET 777.89 S1428 OAKGROVE RD 27205 STATE ROAD 5,135.63 C0001242 OAKHURST DR 27205 CITY STREET 703.20 S2982 OAKHURST RD 27205 STATE ROAD 1,644.35 P7659406 OAKHURST RD 27205 PRIVATE DRIVE 2,834.89 S1483 OAKLAND AVE 27203 STATE ROAD 2,509.04 S2533 OAKLAND CHURCH RD 27316 STATE ROAD 176.10 C0002183 OAKLEY CT 27263 CITY STREET 413.87 S2514 OAKLEY RD 27248 STATE ROAD 987.33 C0002235 OAKMONT CIR 27263 CITY STREET 764.02 C0001243 OAKMONT DR 27205 CITY STREET 5,294.40 S1870 OAKMONT DR 27205 STATE ROAD 1,154.57 S1628 OAKMONT VIEW RD 27260 STATE ROAD 759.83 P7777572 OAKRIDGE LN 27317 PRIVATE DRIVE 678.79 C0002189 OAKSPRING LN 27263 CITY STREET 1,061.12 S1861 OAKVIEW DR 27370 STATE ROAD 2,610.43 S1200 OAKWOOD ACRES RD 27205 STATE ROAD 3,005.38 S3185 OAKWOOD CT 27360 STATE ROAD 356.05 S1824 OAKWOOD DR 27370 STATE ROAD 1,138.26 P7707520 OAKWOOD DR 27370 PRIVATE DRIVE 294.35 P7766461 OAKWOOD TRL 27317 PRIVATE DRIVE 1,830.50 C0001244 OCCONEECHEE AVE 27203 CITY STREET 993.32 P7689126 ODAT TRL 27205 PRIVATE DRIVE 640.38 C0002195 OFFICE PKWY 27370 CITY STREET 916.84 C0003052 OGLES CREEK ST 27316 CITY STREET 829.37 S1006 OLD 421 RD 27298 STATE ROAD 33,856.24 S1006 OLD 421 RD 27283 STATE ROAD 4,662.92 S1006 OLD 421 RD 27355 STATE ROAD 3,294.93 S2673 OLD ASHEBORO RD 27205 STATE ROAD 2,005.23 P7790420 OLD ASHEBORO RD EXT 27205 PRIVATE DRIVE 507.64 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-58 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2904 OLD BACHELOR CREEK RD 27341 STATE ROAD 3,387.49 S1964 OLD BELL RD 27317 STATE ROAD 542.45 S2454 OLD BROWER MILL RD 27248 STATE ROAD 2,138.55 S2602 OLD BUFFALO FORD RD 27205 STATE ROAD 2,331.05 C0001558 OLD CASTLE DR 27317 CITY STREET 4,240.14 S2216 OLD CEDAR FALLS RD 27317 STATE ROAD 5,770.89 S2216 OLD CEDAR FALLS RD 27203 STATE ROAD 18,198.49 S2054 OLD CEDAR SQUARE RD 27263 STATE ROAD 1,998.71 S2107 OLD CLIMAX RD 27313 STATE ROAD 4,358.19 S2634 OLD COLERIDGE RD 27344 STATE ROAD 31,838.13 S2634 OLD COLERIDGE RD 27316 STATE ROAD 4,712.60 S1415 OLD COUNTY FARM RD 27350 STATE ROAD 14,728.85 S1513 OLD COURTHOUSE RD 27350 STATE ROAD 3,786.04 S2834 OLD COX RD 27205 STATE ROAD 29,491.37 P7773449 OLD CROSSING DR 27317 PRIVATE DRIVE 1,437.30 P7658157 OLD DEPOT DR 27205 PRIVATE DRIVE 992.88 S1528 OLD EDGAR RD 27350 STATE ROAD 8,680.01 C0002064 OLD ENGLISH FARM RD 27370 CITY STREET 5,163.62 S3152 OLD FARM RD 27360 STATE ROAD 800.19 S3255 OLD FARMER RD 27205 STATE ROAD 6,820.31 C0001245 OLD FARMER RD 27203 CITY STREET 345.67 S1538 OLD FLINT HILL RD 27350 STATE ROAD 1,593.49 P7725402 OLD FLINT HILL RD EXT 27350 PRIVATE DRIVE 1,707.76 S1384 OLD FOREST CT 27205 STATE ROAD 738.21 S1571 OLD GLENOLA RD 27263 STATE ROAD 2,696.39 S1571 OLD GLENOLA RD 27370 STATE ROAD 5,465.44 S2115 OLD GREENSBORO RD 27317 STATE ROAD 9,911.58 S1952 OLD HIGH POINT ST 27317 STATE ROAD 4,427.19 S2024 OLD HOCKETT LN 27317 STATE ROAD 593.65 P7758310 OLD HOCKETT LN EXT 27317 PRIVATE DRIVE 340.47 S1883 OLD HOPEWELL CHURCH RD 27370 STATE ROAD 1,300.29 S2830 OLD HUMBLE MILL RD 27205 STATE ROAD 12,190.26 S1004 OLD LEXINGTON RD 27205 STATE ROAD 16,103.90 S1411 OLD LEXINGTON RD 27205 STATE ROAD 159.63 S1416 OLD LEXINGTON RD 27205 STATE ROAD 16,993.96 S2261 OLD LIBERTY RD 27298 STATE ROAD 23,582.31 S2261 OLD LIBERTY RD 27355 STATE ROAD 4,677.04 S2261 OLD LIBERTY RD 27233 STATE ROAD 1,709.20 C0001246 OLD LIBERTY RD 27203 CITY STREET 14,992.79 S2261 OLD LIBERTY RD 27248 STATE ROAD 31,033.53 S2261 OLD LIBERTY RD 27317 STATE ROAD 11,169.20 S1255 OLD MAPLE SPRINGS RD 27341 STATE ROAD 565.10 S1858 OLD MARLBORO RD 27350 STATE ROAD 12,743.27 S1881 OLD MEADOWBROOK RD 27370 STATE ROAD 707.04 S1616 OLD MENDENHALL RD 27263 STATE ROAD 7,178.30 P7790425 OLD MILL FORD TRL 27205 PRIVATE DRIVE 2,552.35 S1165 OLD MILL RD 27205 STATE ROAD 1,184.31 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-59 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2899 OLD MOFFITT RD 27341 STATE ROAD 5,279.62 S1553 OLD MOUNTAIN RD 27370 STATE ROAD 14,687.04 S1553 OLD MOUNTAIN RD 27360 STATE ROAD 4,409.96 S2845 OLD NC HWY 13 27205 STATE ROAD 45,361.21 S1193 OLD NC HWY 49 27205 STATE ROAD 42,482.97 S1193 OLD NC HWY 49 27239 STATE ROAD 10,803.98 P7715215 OLD PARK RD 27370 PRIVATE DRIVE 1,754.42 S1305 OLD PLACE RD 27239 STATE ROAD 2,573.45 C0007016 OLD PLANK RD 27341 CITY STREET 3,938.07 C0007016 OLD PLANK RD 27205 CITY STREET 313.29 S1949 OLD PLANK RD 27350 STATE ROAD 3,563.24 S1919 OLD POOLE RD 27263 STATE ROAD 2,985.21 S1400 OLD POST OFFICE RD 27360 STATE ROAD 5,066.72 S2297 OLD PROVIDENCE RD 27317 STATE ROAD 1,125.40 S2403 OLD RED CROSS RD 27233 STATE ROAD 9,343.65 S2403 OLD RED CROSS RD 27283 STATE ROAD 1,364.99 P7712407 OLD ROAD DR 27205 PRIVATE DRIVE 425.61 S2016 OLD ROCKETT RD 27317 STATE ROAD 3,300.22 C0002122 OLD SCHOOL RD 27370 CITY STREET 2,248.03 8888 OLD SECOND ST 27283 OUT OF COUNTY DRIVE 62.76 P7774446 OLD SETTLEMENT RD 27248 PRIVATE DRIVE 1,394.04 S2642 OLD SILER CITY RD 27316 STATE ROAD 25,220.38 S2077 OLD SPENCER RD 27263 STATE ROAD 1,999.37 P7771107 OLD SPRUCE DR 27203 PRIVATE DRIVE 603.61 S2663 OLD STAGECOACH RD 27205 STATE ROAD 4,204.53 S2470 OLD STALEY RD 27355 STATE ROAD 12,976.27 S1148 OLD STATE HWY 27205 STATE ROAD 2,976.90 S1627 OLD THOMASVILLE RD 27260 STATE ROAD 3,135.83 S1627 OLD THOMASVILLE RD 27263 STATE ROAD 3,996.29 S1627 OLD THOMASVILLE RD 27360 STATE ROAD 36.58 P7726275 OLD TOBACCO RD 27370 PRIVATE DRIVE 2,683.01 P6689530 OLD TREE RD 27239 PRIVATE DRIVE 1,769.97 S1188 OLD TROY RD 27205 STATE ROAD 7,034.05 S1882 OLD TURNPIKE RD 27263 STATE ROAD 1,014.03 S1882 OLD TURNPIKE RD 27370 STATE ROAD 751.97 S2859 OLD US 220 HWY 27341 STATE ROAD 7,921.30 S1344 OLD US HWY 64 27370 STATE ROAD 13,847.40 S1344 OLD US HWY 64 27292 STATE ROAD 2,476.78 S1186 OLD UWHARRIE RD 27205 STATE ROAD 2,855.19 S1939 OLD WALKER MILL RD 27317 STATE ROAD 14,374.25 P7745493 OLD WAY RD 27350 PRIVATE DRIVE 885.18 S1514 OLD WAY RD 27350 STATE ROAD 1,399.50 C0001613 OLDE MAIN TERRACE DR 27203 CITY STREET 419.91 C0001599 OLDE TOWNE PKWY 27205 CITY STREET 1,511.70 C0006051 OLIVER ST 27317 CITY STREET 775.21 C0005036 OLIVER ST 27316 CITY STREET 1,871.92 S2461 OLIVERS CHAPEL RD 27355 STATE ROAD 2,732.20 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-60 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7783327 OLIVERS LN 27317 PRIVATE DRIVE 317.38 P7717333 ONEAL FARM RD 27370 PRIVATE DRIVE 2,396.17 P7703521 ORA LN 27370 PRIVATE DRIVE 960.81 P6785001 ORCHARD TRL 27360 PRIVATE DRIVE 439.52 C0001623 ORIOLE DR 27203 CITY STREET 493.24 S2263 ORLENDO DR 27203 STATE ROAD 1,246.51 S2903 OSBORN MILL RD 27341 STATE ROAD 17,750.53 S2903 OSBORN MILL RD 27205 STATE ROAD 10,353.71 C0011040 OSBORN ST 27370 CITY STREET 1,532.19 P7770219 OSPREY DR 27205 PRIVATE DRIVE 670.98 P8615398 OSSIE HAYES RD 27341 PRIVATE DRIVE 1,759.00 P7741599 OTIS RD 27205 PRIVATE DRIVE 1,113.05 S1633 OTIS RD 27205 STATE ROAD 1,162.63 S3301 OVERLOOK DR 27239 STATE ROAD 1,661.99 P8735135 OVERMAN RD 27298 PRIVATE DRIVE 3,615.70 P7767283 OXENDINE RD 27317 PRIVATE DRIVE 3,112.39 C0008029 OXFORD DR 27355 CITY STREET 1,317.69 S2983 PAIGE CT 27205 STATE ROAD 490.82 S2840 PAINTER RD 27205 STATE ROAD 1,197.10 S1245 PALOMINO DR 27205 STATE ROAD 1,224.56 C0001543 PAMPASS PL 27317 CITY STREET 633.22 S2833 PANTHER CREEK RD 27205 STATE ROAD 4,319.86 P7636352 PANTHER MTN RD 27205 PRIVATE DRIVE 5,574.81 P8714310 PAR DR 27355 PRIVATE DRIVE 557.31 S3184 PARINNA DR 27370 STATE ROAD 1,356.87 S3184 PARINNA RD 27370 STATE ROAD 2,306.55 C0002123 PARK DR 27263 CITY STREET 1,813.64 C0001249 PARK DR 27205 CITY STREET 2,033.43 S1462 PARK DR 27205 STATE ROAD 700.23 S2710 PARK RD 27316 STATE ROAD 1,873.06 C0008017 PARK ST 27355 CITY STREET 1,197.33 C0006052 PARK ST 27317 CITY STREET 750.34 C0007017 PARK ST 27341 CITY STREET 987.14 C0005037 PARK ST 27316 CITY STREET 545.25 P7763513 PARK TRL 27317 PRIVATE DRIVE 402.37 P7648258 PARKER DR 27205 PRIVATE DRIVE 1,710.38 S1316 PARKER MILL RD 27239 STATE ROAD 3,330.16 P7710 PARKER MILL RD 27239 PRIVATE DRIVE 233.18 S3241 PARKER ST 27263 STATE ROAD 821.24 S2628 PARKS CROSSRDS CHURCH RD 27316 STATE ROAD 28,960.95 S2415 PARKS PALMER RD 27298 STATE ROAD 4,358.75 C0003021 PARKS ST 27248 CITY STREET 1,369.07 P8712342 PARKSFIELD TRL 27316 PRIVATE DRIVE 1,285.88 C0001250 PARKSIDE DR 27203 CITY STREET 494.98 C0002253 PARKVIEW CT 27263 CITY STREET 507.40 C0001251 PARKVIEW ST 27203 CITY STREET 3,385.11 S1801 PARKWAY DR 27370 STATE ROAD 1,343.39 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-61 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2737 PARKWOOD RD 27316 STATE ROAD 2,096.83 C0006101 PARRISH DR 27317 CITY STREET 920.17 P6795155 PARRISH FARM RD 27370 PRIVATE DRIVE 2,882.14 P7794387 PARRISH HAMPTON TRL 27248 PRIVATE DRIVE 1,640.57 S1815 PARTRIDGE LN 27350 STATE ROAD 621.61 S2987 PASTUREVIEW RD 27205 STATE ROAD 2,356.39 S2303 PATRICIA DR 27313 STATE ROAD 1,128.94 S2081 PATRIOT WOODS DR 27205 STATE ROAD 1,608.40 S2491 PATTERSON GROVE RD 27316 STATE ROAD 15,719.45 S2192 PATTON AVE 27203 STATE ROAD 2,269.07 P6781229 PAUL DR 27292 PRIVATE DRIVE 535.96 O8888 PAULS AIRPORT RD 27360 OUT OF COUNTY DRIVE 300.69 C0002172 PAWNEE CT 27263 CITY STREET 459.62 C0011031 PAYNE ST 27370 CITY STREET 637.37 S2391 PEACE FOREST LN 27233 STATE ROAD 1,067.60 S2691 PEACE HAVEN RD 27316 STATE ROAD 4,691.38 S1704 PEACE RD 27370 STATE ROAD 4,463.82 P7716495 PEACEFUL LN 27370 PRIVATE DRIVE 414.18 P7798346 PEACH ST 27233 PRIVATE DRIVE 377.37 S1484 PEACHTREE ST 27203 STATE ROAD 1,049.52 C0001252 PEACHTREE ST 27203 CITY STREET 3,912.62 P7717334 PEACOCK LN 27370 PRIVATE DRIVE 2,132.98 S1837 PEARL AVE 27350 STATE ROAD 4,317.67 S2374 PEARL CT 27317 STATE ROAD 1,237.61 P7658481 PEARL LN 27350 PRIVATE DRIVE 2,630.00 P8717283 PEARL FERGUSON RD 27298 PRIVATE DRIVE 2,249.16 P7606368 PEBBLE RDG 27205 PRIVATE DRIVE 3,742.58 P7767481 PEELER DR 27317 PRIVATE DRIVE 413.43 P7755282 PENNS DR 27317 PRIVATE DRIVE 433.01 C0001253 PENNSYLVANIA AVE 27203 CITY STREET 1,780.55 C0001254 PENNWOOD DR 27203 CITY STREET 540.07 C0006053 PENNY ST 27317 CITY STREET 658.31 S2228 PENTECOSTAL CHURCH RD 27248 STATE ROAD 1,582.76 S2228 PENTECOSTAL CHURCH RD 27203 STATE ROAD 333.59 C0001255 PEPPERIDGE RD 27205 CITY STREET 4,168.43 S2532 PEPPERIDGE WAY 27233 STATE ROAD 956.39 P7783529 PEPPERSTONE DR 27248 PRIVATE DRIVE 1,135.54 C0001559 PEPPERTREE RDG 27317 CITY STREET 908.80 P7784221 PERRY BLVD 27248 PRIVATE DRIVE 571.09 C0001256 PERRY ST 27205 CITY STREET 345.85 P7698068 PERRYMAN RD 27316 PRIVATE DRIVE 1,831.58 C0001257 PERSHING ST 27203 CITY STREET 798.69 P7717431 PETE LN 27370 PRIVATE DRIVE 1,099.30 C0002124 PETTY ST 27263 CITY STREET 685.41 S1814 PHEASANT RIDGE DR 27350 STATE ROAD 1,432.08 P8716403 PHILLIPPIE LN 27355 PRIVATE DRIVE 1,249.07 P7740124 PHILLIPS CTRY TRL 27205 PRIVATE DRIVE 708.44 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-62 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2148 PHILLIPS RD 27317 STATE ROAD 1,175.07 C0004052 PICKETT CIR 27298 CITY STREET 671.08 S2896 PICKETTS MILL RD 27341 STATE ROAD 15,487.43 S2896 PICKETTS MILL RD 27316 STATE ROAD 3,069.90 S3109 PIEDMONT DAIRY RD 27350 STATE ROAD 746.26 S2400 PIEDMONT ESTATES RD 27233 STATE ROAD 3,281.62 P7798423 PIEDMONT ESTATES RD 27233 PRIVATE DRIVE 1,190.78 S2529 PIEDMONT ST 27233 STATE ROAD 385.13 C0001258 PIEDMONT ST 27203 CITY STREET 337.09 P7714354 PIERCE LN 27370 PRIVATE DRIVE 632.93 S1308 PIERCE MEADOW RD 27239 STATE ROAD 2,947.94 S2464 PIKE FARM RD 27355 STATE ROAD 2,461.92 S2464 PIKE FARM RD 27355 STATE ROAD 2,745.98 S1648 PIKE ST 27263 STATE ROAD 1,296.68 P6797211 PIKE ST EXT 27263 PRIVATE DRIVE 555.32 P6797102 PIKE VIEW DR 27360 PRIVATE DRIVE 2,750.94 P7790421 PILOT CT 27205 PRIVATE DRIVE 2,042.27 S2674 PILOT MOUNTAIN RD 27205 STATE ROAD 3,109.51 S1197 PILOTS VIEW RD 27205 STATE ROAD 2,279.62 P6795526 PIN OAK CT 27360 PRIVATE DRIVE 221.72 S3112 PINE CONE CT 27370 STATE ROAD 466.12 S2734 PINE CREEK RDG 27205 STATE ROAD 1,418.54 P7781565 PINE CREEK RDG 27205 PRIVATE DRIVE 1,326.98 S2718 PINE CT 27205 STATE ROAD 1,073.60 C0001259 PINE GROVE DR 27205 CITY STREET 1,515.16 S2824 PINE HILL RD 27205 STATE ROAD 8,258.13 P7773107 PINE HOLLOW DR 27317 PRIVATE DRIVE 783.31 C0001555 PINE KNOLL CT 27203 CITY STREET 492.02 S2728 PINE LAKES DR 27205 STATE ROAD 1,909.36 P7721447 PINE LN 27205 PRIVATE DRIVE 1,114.38 S3146 PINE NEEDLE LN 27350 STATE ROAD 594.37 P7736340 PINE NEEDLE LN EXT 27350 PRIVATE DRIVE 624.57 P6793144 PINE NEEDLE TRL 27360 PRIVATE DRIVE 995.70 S3211 PINE NEEDLES DR 27205 STATE ROAD 629.30 S1725 PINE RIDGE DR 27370 STATE ROAD 1,928.36 S2717 PINE RIDGE RD 27205 STATE ROAD 1,514.76 C0003022 PINE ST 27248 CITY STREET 941.11 C0001260 PINE ST 27205 CITY STREET 704.02 P7781552 PINE TOP LN 27205 PRIVATE DRIVE 259.06 C0004093 PINE VALLEY CT 27298 CITY STREET 349.85 P7714108 PINE VALLEY DR 27370 PRIVATE DRIVE 1,759.94 S2014 PINEBROOK DR 27263 STATE ROAD 2,359.21 C0002125 PINECREST DR 27263 CITY STREET 1,327.17 P7705205 PINECREST DR 27370 PRIVATE DRIVE 771.09 P7744429 PINEFIELD DR 27350 PRIVATE DRIVE 1,204.55 P7764167 PINEHURST DR 27317 PRIVATE DRIVE 1,199.05 C0004053 PINEKNOLL ST 27298 CITY STREET 1,049.76 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-63 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S3261 PINEVIEW AVE 27260 STATE ROAD 1,320.75 S1862 PINEVIEW DR 27370 STATE ROAD 1,757.02 S1712 PINEVIEW RD 27317 STATE ROAD 8,159.11 S1712 PINEVIEW RD 27203 STATE ROAD 1,940.87 C0001261 PINEVIEW ST 27203 CITY STREET 3,212.12 C0005038 PINEWOOD CIR 27316 CITY STREET 239.76 S2004 PINEWOOD DR 27263 STATE ROAD 500.06 P7658477 PINEWOOD FOREST DR 27205 PRIVATE DRIVE 4,005.81 S2958 PINEWOOD RD 27205 STATE ROAD 3,633.78 S2907 PINEY RIDGE CHURCH RD 27341 STATE ROAD 2,669.63 C0006122 PINNACLE DR 27317 CITY STREET 844.05 P7766470 PINTAIL CT 27317 PRIVATE DRIVE 130.78 S1113 PISGAH CHURCH RD 27205 STATE ROAD 5,265.32 S1114 PISGAH COVERED BRIDGE RD 27205 STATE ROAD 66,136.17 S1109 PISGAH RD 27205 STATE ROAD 11,785.15 C0008018 PITTSBORO ST 27355 CITY STREET 2,232.58 S1518 PLAINFIELD RD 27350 STATE ROAD 17,263.93 C0001262 PLANTATION CIR 27205 CITY STREET 2,655.75 P7776542 PLANTATION CT 27317 PRIVATE DRIVE 669.04 P7703178 PLANTATION DR 27370 PRIVATE DRIVE 917.22 P7776541 PLANTATION MANOR DR 27317 PRIVATE DRIVE 1,258.24 P7703524 PLANTATION WAY 27370 PRIVATE DRIVE 1,563.39 S2057 PLANTERS PL 27360 STATE ROAD 472.65 C0002126 PLAYGROUND RD 27263 CITY STREET 3,350.53 S2224 PLEASANT CROSS RD 27248 STATE ROAD 2,325.17 S2224 PLEASANT CROSS RD 27203 STATE ROAD 8,445.36 S2876 PLEASANT GROVE CHURCH RD 27208 STATE ROAD 2,802.45 S2876 PLEASANT GROVE CHURCH RD 27208 STATE ROAD 14,388.08 S2902 PLEASANT HILL RD 27341 STATE ROAD 10,042.52 S1720 PLEASANT LOOP 27360 STATE ROAD 1,773.83 S2618 PLEASANT RIDGE CHURCH RD 27316 STATE ROAD 7,179.76 S1003 PLEASANT RIDGE RD 27248 STATE ROAD 9,171.19 S1003 PLEASANT RIDGE RD 27316 STATE ROAD 11,538.55 C0001263 PLEASANT ST 27203 CITY STREET 2,099.11 S1336 PLEASANT UNION RD 27370 STATE ROAD 9,862.77 S1336 PLEASANT UNION RD 27239 STATE ROAD 6,448.12 S1533 PLINEY FARLOW RD 27370 STATE ROAD 6,744.40 P7734022 PLOTT HOUND TRL 27350 PRIVATE DRIVE 6,580.78 S2140 PLUM TREE RD 27233 STATE ROAD 8,440.82 C0002127 PLUMMER DR 27263 CITY STREET 1,781.17 S1486 PLUMMER ST 27203 STATE ROAD 1,296.61 S2335 PLYMOUTH DR 27313 STATE ROAD 1,053.40 C0002128 PLYMOUTH ST 27263 CITY STREET 521.53 S2435 POE RD 27355 STATE ROAD 1,320.24 C0006054 POINTE SOUTH DR 27317 CITY STREET 4,208.86 S3271 POINTER LN 27350 STATE ROAD 456.40 S2890 POLLYFIELD RD 27341 STATE ROAD 7,026.67 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-64 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0001612 POLO CROWNE AVE 27203 CITY STREET 390.92 C0003023 POND CIR 27248 CITY STREET 765.14 P7625550 POND SIDE DR 27205 PRIVATE DRIVE 1,972.93 S2715 PONDEROSA HEIGHTS PL 27205 STATE ROAD 2,129.60 P7770218 PONDEROSA HEIGHTS PL 27205 PRIVATE DRIVE 2,168.61 P7777138 PONDEROSA RD 27317 PRIVATE DRIVE 1,855.28 S2053 POOLE RD 27263 STATE ROAD 9,964.24 S2055 POOLE RD EXT 27263 STATE ROAD 429.33 S1422 POOLE TOWN RD 27205 STATE ROAD 7,509.83 P7767485 POPLAR BEND CT 27317 PRIVATE DRIVE 444.15 P7721419 POPLAR FOREST LN 27205 PRIVATE DRIVE 1,387.23 S3160 POPLAR RIDGE RD 27370 STATE ROAD 6,856.75 C0006055 POPLAR ST 27317 CITY STREET 1,654.47 C0001265 POPLAR ST 27203 CITY STREET 805.50 P7679223 PORSCHE WAY 27205 PRIVATE DRIVE 1,934.99 C0001266 PORTAGE PKWY 27203 CITY STREET 748.64 P7792451 POST OAK RD 27248 PRIVATE DRIVE 343.79 S1552 POST RD 27360 STATE ROAD 8,819.57 P7727348 POTOMAC DR 27370 PRIVATE DRIVE 640.66 S2860 POTTERS WAY RD 27341 STATE ROAD 2,307.23 S2865 POTTERY RD 27341 STATE ROAD 1,530.30 C0002208 POWELL WAY 27263 CITY STREET 2,535.70 P7758525 POWER LINE RD 27317 PRIVATE DRIVE 1,028.54 C0001267 POWHATAN AVE 27203 CITY STREET 1,521.79 P7781261 PRAIRIE TRL 27205 PRIVATE DRIVE 643.19 C0006056 PRESNELL ST 27317 CITY STREET 2,194.82 C0002202 PRESTON CT 27263 CITY STREET 299.43 S1969 PRICE NOBLE RD 27317 STATE ROAD 1,585.97 P8722285 PRIMROSE LN 27316 PRIVATE DRIVE 520.44 P7781294 PRINCETON CT 27205 PRIVATE DRIVE 422.75 P7754508 PRISTINE VALLEY RD 27317 PRIVATE DRIVE 410.98 S1631 PROSPECT CHURCH RD 27360 STATE ROAD 2,729.20 P6798499 PROSPECT CT 27263 PRIVATE DRIVE 820.79 S1619 PROSPECT ST 27263 STATE ROAD 7,392.77 C0009003 PROSPECT ST 27260 CITY STREET 1,478.53 S1619 PROSPECT ST 27260 STATE ROAD 467.76 S1619 PROSPECT ST 27360 STATE ROAD 3,595.80 S2114 PROVIDENCE CHURCH RD 27317 STATE ROAD 12,821.82 S2114 PROVIDENCE CHURCH RD 27313 STATE ROAD 9,606.26 S2114 PROVIDENCE CHURCH RD 27233 STATE ROAD 8,670.22 S2336 PROVIDENCE DR 27313 STATE ROAD 1,684.01 P7777443 PROVIDENCE FARM DR 27313 PRIVATE DRIVE 2,473.37 P7784338 PUGH DR 27248 PRIVATE DRIVE 1,213.60 C0002129 PURVIS LN 27263 CITY STREET 879.79 P8713420 QUAIL CORNER RD 27316 PRIVATE DRIVE 430.79 P7783502 QUAIL CREEK DR 27248 PRIVATE DRIVE 589.49 P6786485 QUAIL CT 27360 PRIVATE DRIVE 377.89 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-65 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2320 QUAIL HOLLOW DR 27313 STATE ROAD 2,107.24 S1817 QUAIL MEADOW DR 27350 STATE ROAD 1,006.00 P7736017 QUAIL MEADOW ESTATES RD 27350 PRIVATE DRIVE 1,560.46 P7646536 QUAIL ROOST DR 27205 PRIVATE DRIVE 1,009.32 S1855 QUAIL WAY 27360 STATE ROAD 414.02 C0001268 QUAKER DR 27203 CITY STREET 1,502.60 S2334 QUAKER DR 27313 STATE ROAD 3,379.74 C0002216 QUAKER LAKE DR 27263 CITY STREET 1,040.16 C0002130 QUAKERWOOD DR 27263 CITY STREET 1,119.36 C0011048 QUARTER HORSE DR 27370 CITY STREET 1,306.24 P7791353 QUARTZ ST 27248 PRIVATE DRIVE 633.14 C0001552 QUEENS MEADOW CT 27205 CITY STREET 348.39 S1480 QUEENS RD 27203 STATE ROAD 201.62 C0001269 QUEENS RD 27203 CITY STREET 277.23 S2278 QUEENS WAY 27317 STATE ROAD 1,456.89 P7698333 QUENTIN DR 27205 PRIVATE DRIVE 1,024.40 P7626430 R H DR 27205 PRIVATE DRIVE 4,373.30 P7785578 R L ROUTH DR 27248 PRIVATE DRIVE 952.55 S3156 RACE TRACK RD 27350 STATE ROAD 2,803.42 P7733457 RACE TRACK RD EXT 27350 PRIVATE DRIVE 416.16 S2106 RACINE RD 27313 STATE ROAD 13,490.68 S2106 RACINE RD 27317 STATE ROAD 10,039.44 S2106 RACINE RD 27233 STATE ROAD 6,976.83 C0002264 RADIANT PATH 27370 CITY STREET 1,113.77 P7761483 RAGSDALE RD 27203 PRIVATE DRIVE 2,300.64 C0006057 RAILROAD AVE 27317 CITY STREET 3,719.00 C0001270 RAILROAD ST 27203 CITY STREET 1,756.68 C0001271 RAINBOW DR 27203 CITY STREET 489.15 S2914 RAINBOW LOOP 27205 STATE ROAD 1,995.29 P8700111 RAINBOW TRL 27316 PRIVATE DRIVE 1,623.87 P8724403 RAINEY RD 27355 PRIVATE DRIVE 1,827.63 C0001560 RAINTREE CT 27317 CITY STREET 1,046.66 P7784440 RALEIGH DR 27248 PRIVATE DRIVE 1,700.21 S2862 RALPH LAWRENCE RD 27341 STATE ROAD 12,648.24 S1716 RAMBLEWOOD RD 27350 STATE ROAD 1,358.70 S2319 RAMBLING RD 27317 STATE ROAD 1,717.11 C0001272 RAMP 27205 CITY STREET 298.81 C0001272 RAMP 27203 CITY STREET 613.63 C0011032 RAMPEY ST 27370 CITY STREET 687.87 S2442 RAMSEUR JULIAN RD 27298 STATE ROAD 39,200.81 S2442 RAMSEUR JULIAN RD 27316 STATE ROAD 12,196.76 S2492 RAMSEUR LAKE RD 27316 STATE ROAD 1,487.57 S2669 RAMTEX DR 27316 STATE ROAD 458.39 C0002131 RAND BLVD 27263 CITY STREET 2,948.65 S1110 RANDALL HURLEY RD 27371 STATE ROAD 7,979.21 C0001273 RANDALL ST 27203 CITY STREET 436.37 P7763514 RANDLEBORO RD 27317 PRIVATE DRIVE 363.84 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-66 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1961 RANDLEMAN LAKE RD 27317 STATE ROAD 4,767.57 S1007 RANDLEMAN RD 27317 STATE ROAD 8,340.90 S2443 RANDOLPH CHURCH RD 27298 STATE ROAD 11,309.84 S2443 RANDOLPH CHURCH RD 27233 STATE ROAD 5,752.59 S2527 RANDOLPH MEADOW RD 27233 STATE ROAD 929.66 C0006058 RANDOLPH ST 27317 CITY STREET 2,092.98 S2217 RANDOLPH TABERNACLE RD 27203 STATE ROAD 5,510.65 P8708414 RANDOM WOODS RD 27298 PRIVATE DRIVE 1,117.56 P7755281 RATTLERS RUN 27317 PRIVATE DRIVE 357.91 S2323 RAVEN CT 27313 STATE ROAD 436.29 C0001513 RAVENWOOD DR 27203 CITY STREET 1,069.85 C0002132 RAY AVE 27370 CITY STREET 612.24 P7667337 RAY DR 27205 PRIVATE DRIVE 740.40 C0001275 RAYBURN ST 27203 CITY STREET 1,028.96 S2376 RAYLE FARM CT 27313 STATE ROAD 673.55 S2375 RAYLE FARM RD 27313 STATE ROAD 3,018.07 P7738382 RAYMOND GRAY LN 27263 PRIVATE DRIVE 1,797.61 P7717101 REAVIS ST 27370 PRIVATE DRIVE 1,023.76 S2348 RED BIRD CT 27317 STATE ROAD 564.73 P7767487 RED CEDAR CT 27317 PRIVATE DRIVE 734.77 S2338 RED CROSS CT 27233 STATE ROAD 661.16 S1891 RED FOX RD 27370 STATE ROAD 4,332.52 S3115 RED FOX TRL 27205 STATE ROAD 1,808.85 S2241 RED LANE RD 27313 STATE ROAD 3,182.19 P7798421 RED MAPLE TRL 27233 PRIVATE DRIVE 3,380.75 P7765262 RED OAK CT 27317 PRIVATE DRIVE 215.72 P7765261 RED OAK DR 27317 PRIVATE DRIVE 640.66 P7748085 RED OAK LN 27317 PRIVATE DRIVE 592.86 P7738181 RED ROBIN LN 27263 PRIVATE DRIVE 2,143.21 P7792457 RED ROCK RD 27248 PRIVATE DRIVE 580.90 S3007 RED WOLF LN 27205 STATE ROAD 1,564.93 C0006059 REDBUD LN 27317 CITY STREET 821.50 P8737157 REDBUD LN 27298 PRIVATE DRIVE 2,144.64 P8737466 REDBUD LN EXT 27298 PRIVATE DRIVE 1,442.17 S1561 REDDICK ST 27263 STATE ROAD 751.93 P7707201 REDDICK VIEW ST 27370 PRIVATE DRIVE 233.48 S1813 REDDING CT 27370 STATE ROAD 781.42 S1812 REDDING CTRY RD 27370 STATE ROAD 1,613.26 C0001276 REDDING RD 27203 CITY STREET 3,890.49 S3172 REDDY FOXX LN 27360 STATE ROAD 3,327.97 S1237 REDWOOD DR 27205 STATE ROAD 1,599.06 C0006060 REECE AVE 27317 CITY STREET 1,057.72 C0006106 REECE CT 27317 CITY STREET 443.79 P8712343 REED CREEK CT 27316 PRIVATE DRIVE 761.73 S2668 REED CREEK RD 27316 STATE ROAD 4,920.08 S1122 REEDER RD 27205 STATE ROAD 5,815.00 P7655402 REEDER RD EXT 27205 PRIVATE DRIVE 2,567.27 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-67 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P8713370 REEVES TRL 27316 PRIVATE DRIVE 487.67 S1493 REFLECTION LN 27205 STATE ROAD 333.10 P6795157 REFUGE CHURCH DR 27370 PRIVATE DRIVE 2,834.11 P7767482 REGAL DR 27317 PRIVATE DRIVE 923.00 S1886 REGALWOOD CT 27360 STATE ROAD 174.46 P6797301 REGALWOOD CT 27360 PRIVATE DRIVE 675.34 S1887 REGALWOOD DR 27360 STATE ROAD 433.18 C0001562 REGENCY DR 27317 CITY STREET 4,721.34 S1733 REGINA ST 27370 STATE ROAD 500.14 P7795337 REGINALD RD 27248 PRIVATE DRIVE 916.59 C0001582 REGINAS WAY 27317 CITY STREET 539.74 S1430 REGISTER ST 27205 STATE ROAD 1,175.20 C0004055 REITZEL ST 27298 CITY STREET 522.25 C0002133 RENOLA DR 27263 CITY STREET 2,677.50 P7740327 REVELLE TRL 27205 PRIVATE DRIVE 1,683.04 C0006061 REYNOLDS RD 27317 CITY STREET 693.97 S1780 RHONDA DR 27370 STATE ROAD 2,165.37 P7646558 RICE DR 27205 PRIVATE DRIVE 1,582.62 C0003024 RICE ST 27248 CITY STREET 356.05 C0001277 RICH AVE 27203 CITY STREET 1,204.62 P7712454 RICH CTRY DR 27205 PRIVATE DRIVE 655.91 P7744430 RICH FARM TRL 27350 PRIVATE DRIVE 1,048.35 S1377 RICHARDS CIR 27205 STATE ROAD 882.14 P7742197 RICHARDSON FARM RD 27350 PRIVATE DRIVE 713.23 P7695569 RICHARDSON LN 27341 PRIVATE DRIVE 2,003.91 S1531 RICHARDSON RD 27263 STATE ROAD 1,619.72 P7765154 RICHARDSON RD 27317 PRIVATE DRIVE 431.74 C0006062 RICHARDSON RD 27317 CITY STREET 400.23 C0005039 RICHARDSON ST 27316 CITY STREET 1,456.08 S1306 RICHEY RD 27239 STATE ROAD 9,916.68 S2068 RICHFIELDS RD 27350 STATE ROAD 1,966.80 S2418 RICHLAND CHURCH RD 27298 STATE ROAD 14,348.35 S2847 RICHLAND PARK DR 27205 STATE ROAD 1,225.00 C0001505 RICHLAND PL 27205 CITY STREET 263.64 S1640 RIDGE DR 27370 STATE ROAD 1,548.10 C0002257 RIDGE LNDG 27263 CITY STREET 673.43 C0007018 RIDGE RD 27341 CITY STREET 1,070.57 S2853 RIDGE RD 27341 STATE ROAD 12,413.85 S2915 RIDGE ST 27205 STATE ROAD 1,092.14 C0001278 RIDGE ST 27205 CITY STREET 1,209.52 S3187 RIDGE TOP CT 27370 STATE ROAD 931.20 P7636353 RIDGEBACK RD 27205 PRIVATE DRIVE 2,760.52 C0002134 RIDGECREEK DR 27370 CITY STREET 2,051.71 S2973 RIDGECREST LN 27205 STATE ROAD 1,203.15 C0001279 RIDGECREST RD 27203 CITY STREET 1,855.22 S1331 RIDGES MTN RD 27205 STATE ROAD 11,593.63 S1372 RIDGES MTN TRL 27205 STATE ROAD 3,691.91 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-68 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P8700192 RIDGETOP RD 27316 PRIVATE DRIVE 930.66 S1669 RIDGEVIEW RD 27263 STATE ROAD 1,194.89 S1432 RIDGEWAY CIR 27205 STATE ROAD 798.40 S1431 RIDGEWAY DR 27205 STATE ROAD 1,282.74 C0001568 RIDGEWOOD CIR 27203 CITY STREET 2,558.70 P6795160 RIDGEWOOD CT 27370 PRIVATE DRIVE 724.55 P8703190 RIDGEWOOD RD 27248 PRIVATE DRIVE 3,944.35 S3284 RIDGEWORTH CT 27350 STATE ROAD 549.39 S2682 RILLA ST 27205 STATE ROAD 1,623.44 C0003054 RISING SUN WAY 27248 CITY STREET 2,727.04 S1202 RISING VIEW WAY 27205 STATE ROAD 4,861.00 S3300 RIVER BLUFF DR 27239 STATE ROAD 1,393.88 P7646560 RIVER CT 27205 PRIVATE DRIVE 405.59 P7646414 RIVER ESTATES DR 27205 PRIVATE DRIVE 2,018.25 P7773368 RIVER FLOW DR 27317 PRIVATE DRIVE 315.34 P6796594 RIVER GATE CT 27360 PRIVATE DRIVE 266.67 S2991 RIVER HEIGHTS DR 27316 STATE ROAD 1,133.88 S2039 RIVER MILL RD 27317 STATE ROAD 6,440.35 C0006063 RIVER PARK RD 27317 CITY STREET 321.69 C0006113 RIVER PARK RD EXT 27317 CITY STREET 754.87 C0006064 RIVER POINTE DR 27317 CITY STREET 624.34 P7783328 RIVER RAT RD 27248 PRIVATE DRIVE 1,217.52 P6796592 RIVER RIDGE LN 27360 PRIVATE DRIVE 1,292.76 C0006127 RIVER WALK DR 27317 CITY STREET 463.93 P7656313 RIVER RUN DR 27205 PRIVATE DRIVE 1,472.62 P6784443 RIVERCHASE DR 27360 PRIVATE DRIVE 1,410.49 C0002136 RIVERMEADE DR 27263 CITY STREET 1,103.18 P7776538 RIVEROAKS CT 27317 PRIVATE DRIVE 434.50 S2386 RIVEROAKS DR 27317 STATE ROAD 2,799.89 C0006066 RIVERS BEND DR 27317 CITY STREET 705.72 S3186 RIVERSIDE ACRES CT 27370 STATE ROAD 1,103.63 S2873 RIVERSIDE RD 27316 STATE ROAD 16,562.13 S2873 RIVERSIDE RD 27341 STATE ROAD 34,685.00 S2062 RIVERVIEW CT 27370 STATE ROAD 228.67 S1804 RIVERVIEW DR 27370 STATE ROAD 1,798.57 S1940 RIVERWOOD RD 27317 STATE ROAD 4,196.11 P7757105 RIVERWOOD RD EXT 27317 PRIVATE DRIVE 126.97 P7741309 ROADRUNNER DR 27205 PRIVATE DRIVE 1,079.83 S1978 ROB CRUTHIS RD 27263 STATE ROAD 2,185.51 P7738383 ROB CRUTHIS RD 27263 PRIVATE DRIVE 1,167.23 S1333 ROBBINS CIR 27205 STATE ROAD 2,604.14 S1567 ROBBINS CTRY RD 27370 STATE ROAD 8,267.88 S1567 ROBBINS CTRY RD 27370 STATE ROAD 3,899.90 P7706373 ROBBINS FARM DR 27370 PRIVATE DRIVE 2,968.48 P7774185 ROBBINS SCOTT RD 27317 PRIVATE DRIVE 816.98 C0001280 ROBBINS ST 27203 CITY STREET 1,175.22 P7765155 ROBERT HINSHAW DR 27317 PRIVATE DRIVE 563.87 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-69 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0002137 ROBERT LN 27263 CITY STREET 467.44 P8616288 ROBERT MACON RD 27341 PRIVATE DRIVE 2,673.84 S1273 ROBERT WAY 27205 STATE ROAD 975.04 P7728549 ROBERTS RANCH LN 27263 PRIVATE DRIVE 562.70 C0002138 ROBIN CIR 27263 CITY STREET 2,040.07 C0002139 ROBIN CT 27263 CITY STREET 310.54 C0002140 ROBIN LN 27263 CITY STREET 4,460.79 S2354 ROBIN LN 27317 STATE ROAD 1,398.17 P7766363 ROBIN VIEW RD 27317 PRIVATE DRIVE 716.64 C0011043 ROBIN WAY 27370 CITY STREET 193.32 C0001588 ROBINS NEST DR 27203 CITY STREET 2,636.35 S2627 ROBY COE RD 27316 STATE ROAD 12,256.80 C0002141 ROBY DR 27263 CITY STREET 2,796.54 S2191 ROCK CRUSHER RD 27203 STATE ROAD 3,982.76 S1892 ROCK DAM CT 27370 STATE ROAD 776.39 S1506 ROCK QUARRY RD 27203 STATE ROAD 2,686.96 S1429 ROCK SPRING RD 27205 STATE ROAD 1,144.96 C0006067 ROCK ST 27317 CITY STREET 796.75 P7780339 ROCK WRENN TRL 27205 PRIVATE DRIVE 615.69 S3268 ROCKAWAY DR 27317 STATE ROAD 806.79 C0001419 ROCKCLIFF CT 27205 CITY STREET 253.19 C0001418 ROCKCLIFF TER 27205 CITY STREET 2,117.38 S1937 ROCKETT RD 27317 STATE ROAD 3,413.06 S1597 ROCKFORD DR 27370 STATE ROAD 3,765.97 P7708267 ROCKFORD DR EXT 27370 PRIVATE DRIVE 512.73 P7792456 ROCKIE RIVER ST 27316 PRIVATE DRIVE 2,257.28 C0002142 ROCKLANE DR 27263 CITY STREET 1,447.05 P7740228 ROCKLANE DR 27205 PRIVATE DRIVE 626.59 P6797524 ROCKLEDGE LN 27360 PRIVATE DRIVE 721.93 P7775324 ROCKOW RD 27317 PRIVATE DRIVE 932.49 S1775 ROCKRIDGE CT 27370 STATE ROAD 732.95 C0001281 ROCKRIDGE RD 27205 CITY STREET 1,161.26 P7753370 ROCKWOOD RD 27205 PRIVATE DRIVE 651.33 S2666 ROCKY KNOLL RD 27205 STATE ROAD 465.90 P7771231 ROCKY KNOLL RD EXT 27205 PRIVATE DRIVE 2,303.83 C0001282 ROCKY LN 27205 CITY STREET 1,211.98 S2943 ROCWOOD DR 27205 STATE ROAD 2,116.48 O9999 RODEO DR 27292 OUT OF COUNTY 355.67 C0002143 ROELEE ST 27370 CITY STREET 1,725.68 P7658315 ROLAND LN 27205 PRIVATE DRIVE 749.15 P7755406 ROLIS RD 27317 PRIVATE DRIVE 281.30 P7684195 ROLLIN HILLS RD 27341 PRIVATE DRIVE 3,429.78 P7776229 ROLLING FARM RD 27317 PRIVATE DRIVE 5,021.92 S2349 ROLLING MEADOWS RD 27317 STATE ROAD 5,699.40 C0011028 ROLLING RD 27370 CITY STREET 1,385.96 P7751303 ROLLING RD 27205 PRIVATE DRIVE 1,188.77 C0001283 ROLLING RD 27205 CITY STREET 1,038.61 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-70 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1853 ROLLINGWOOD CT 27370 STATE ROAD 397.93 S1850 ROLLINGWOOD DR 27370 STATE ROAD 2,776.92 P7679426 ROLLS LN 27205 PRIVATE DRIVE 124.79 P7771435 ROMAN RD 27205 PRIVATE DRIVE 1,650.43 S1565 RONNIEDALE RD 27370 STATE ROAD 6,554.38 S1426 ROOSEVELT RD 27205 STATE ROAD 472.80 S1212 ROSCOE RD 27239 STATE ROAD 2,260.52 P7657485 ROSE AVE 27205 PRIVATE DRIVE 1,369.54 S1353 ROSE GARDEN TRL 27205 STATE ROAD 254.61 P7780437 ROSE HILL RD 27205 PRIVATE DRIVE 1,613.94 C0001284 ROSE LN 27203 CITY STREET 506.09 C0003025 ROSE ST 27248 CITY STREET 1,018.93 C0001285 ROSEBORO DR 27203 CITY STREET 1,529.70 P7708469 ROSEDALE ST 27370 PRIVATE DRIVE 899.35 P7717332 ROSELEE DR 27370 PRIVATE DRIVE 3,283.59 P7763268 ROSEMARY DR 27317 PRIVATE DRIVE 2,527.06 C0002144 ROSEMARY ST 27263 CITY STREET 1,132.00 P7761482 ROSEMONT RD 27203 PRIVATE DRIVE 1,854.12 S1782 ROSEWAY RD 27370 STATE ROAD 1,283.98 S3127 ROSEWOOD DR 27370 STATE ROAD 590.55 P7736342 ROSIN RUN 27350 PRIVATE DRIVE 472.28 S2835 ROSS HARRIS RD 27205 STATE ROAD 15,271.02 C0001286 ROSS ST 27203 CITY STREET 2,471.04 S1339 ROSS WOOD RD 27292 STATE ROAD 4,785.16 S1339 ROSS WOOD RD 27370 STATE ROAD 17,330.67 S1393 ROUNDCLIFF DR 27205 STATE ROAD 212.97 C0005040 ROUNDLEAF RD 27316 CITY STREET 181.92 S2619 ROUNDLEAF RD 27316 STATE ROAD 1,906.66 P8701223 ROUNDLEAF RD 27316 PRIVATE DRIVE 549.17 P7774287 ROUTH COX DR 27248 PRIVATE DRIVE 554.32 S2448 ROUTH RD 27248 STATE ROAD 14,561.22 S1534 ROY FARLOW RD 27350 STATE ROAD 5,287.54 S1534 ROY FARLOW RD 27370 STATE ROAD 4,696.63 S2332 ROYAL DR 27317 STATE ROAD 988.33 C0002501 ROYAL PINES DR 27370 CITY STREET 287.19 S2638 ROYAL RIDGE RD 27316 STATE ROAD 4,022.16 P7659549 ROYALSHIRE LN 27205 PRIVATE DRIVE 272.27 P7679427 ROYCE LN 27205 PRIVATE DRIVE 201.26 P7764170 RUMBLEY PINE ST 27317 PRIVATE DRIVE 757.57 P7721322 RUNNING CEDAR RD 27205 PRIVATE DRIVE 1,959.93 S1833 RUNWAY DR 27350 STATE ROAD 1,829.25 S1335 RUSH MTN RD 27370 STATE ROAD 8,788.80 S1335 RUSH MTN RD EXT 27205 STATE ROAD 1,797.32 S1436 RUSHWOOD RD 27205 STATE ROAD 871.11 P6782253 RUSSELL DR 27292 PRIVATE DRIVE 342.12 S1437 RUSSELL ST 27205 STATE ROAD 829.39 P6783241 RUSSELL SUMMEY DR 27360 PRIVATE DRIVE 683.48 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-71 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0006068 RUSSELL WALKER AVE 27317 CITY STREET 2,016.43 S2331 RYAN DR 27317 STATE ROAD 1,486.82 P7763511 RYAN DR 27317 PRIVATE DRIVE 241.26 C0004001 S ALLISON ST 27298 CITY STREET 397.20 S2433 S ALLISON ST 27298 STATE ROAD 900.43 C0004057 S ASHEBORO ST 27298 CITY STREET 3,245.79 C0005001 S BRADY ST 27316 CITY STREET 444.28 U220ALT S BROAD ST 27341 US HIGHWAY 2,844.65 C0004003 S CAROLINA ST 27298 CITY STREET 1,033.39 C0004004 S CARTER ST 27298 CITY STREET 1,409.68 O9999 S CHAPEL HILL CHURCH RD 27239 OUT OF COUNTY 1,549.20 C0001287 S CHERRY ST 27203 CITY STREET 645.62 C0001288 S CHURCH ST 27203 CITY STREET 5,508.36 C0004005 S COOK ST 27298 CITY STREET 1,847.42 C0001289 S COX ST 27203 CITY STREET 6,613.86 C0001290 S ELM ST 27203 CITY STREET 1,428.04 C0004026 S FAIRVIEW ST 27298 CITY STREET 1,034.92 N 49N S FAYETTEVILLE ST 27298 NC HIGHWAY 5,853.30 U220BUS S FAYETTEVILLE ST 27203 US HIGHWAY 6,515.15 U220BUS S FAYETTEVILLE ST 27205 US HIGHWAY 6,966.60 C0004059 S FOSTER ST 27298 CITY STREET 2,361.73 C0004030 S GARDEN ST 27298 CITY STREET 615.38 C0004060 S GREENSBORO ST 27298 CITY STREET 5,808.37 C0004061 S GREGG ST 27298 CITY STREET 563.95 C0001292 S HIGH ST 27203 CITY STREET 1,243.47 C0004062 S KIRKMAN ST 27298 CITY STREET 3,662.11 C0008019 S MAIN ST 27355 CITY STREET 4,076.60 U220BUS S MAIN ST 27317 US HIGHWAY 12,156.92 C0001293 S MAIN ST 27203 CITY STREET 3,484.86 S1009 S MAIN ST 27263 STATE ROAD 6,905.54 C0004039 S MARTIN ST 27298 CITY STREET 1,298.21 C0001294 S MCCRARY ST 27203 CITY STREET 2,848.72 C0004040 S MURPHY ST 27298 CITY STREET 1,311.66 C0004049 S NEW ST 27298 CITY STREET 1,511.18 C0001295 S PARK ST 27203 CITY STREET 6,539.99 C0001295 S PARK ST 27205 CITY STREET 428.08 C0001296 S RANDOLPH AVE 27203 CITY STREET 1,208.47 C0004063 S SMITH ST 27298 CITY STREET 735.11 C0008020 S STALEY ST 27355 CITY STREET 3,343.76 C0006071 S STOUT ST 27317 CITY STREET 3,225.14 C0001297 S TREMONT DR 27203 CITY STREET 717.22 C0004097 S VALLEY ST 27298 CITY STREET 4,209.06 C0011030 SABINE ST 27370 CITY STREET 757.75 C0011011 SADDLE BROOK DR 27370 CITY STREET 2,812.18 C0011017 SADDLE CLUB DR 27370 CITY STREET 704.77 C0001299 SADDLEWOOD CT 27203 CITY STREET 598.43 P8616379 SADIE RD 27341 PRIVATE DRIVE 3,281.15 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-72 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P6688100 SAGEBRUSH TRL 27239 PRIVATE DRIVE 4,068.10 C0002222 SAGEWOOD LN 27263 CITY STREET 2,512.83 S1304 SALEM CHURCH RD 27239 STATE ROAD 10,699.96 C0001298 SALEM CT 27205 CITY STREET 428.75 C0006110 SALEM CT 27317 CITY STREET 293.23 P7766460 SALEM FOREST ST 27317 PRIVATE DRIVE 1,039.02 P7766364 SALEM HEIGHTS AVE 27317 PRIVATE DRIVE 605.19 P7766462 SALEM RIDGE DR 27317 PRIVATE DRIVE 2,194.57 S2329 SALEM ST 27317 STATE ROAD 2,078.92 C0005041 SALISBURY ST 27316 CITY STREET 2,007.83 C0002146 SALISBURY ST 27263 CITY STREET 935.27 P7730464 SALMONS DR 27205 PRIVATE DRIVE 239.77 S1347 SAM JACKSON RD 27205 STATE ROAD 1,633.46 S2883 SAM LEONARD RD 27208 STATE ROAD 5,403.14 P7606367 SANDALWOOD DR 27239 PRIVATE DRIVE 1,294.71 P8625006 SANDERS RD 27341 PRIVATE DRIVE 1,255.66 P6698222 SANDSTONE TRL 27239 PRIVATE DRIVE 774.65 P7658469 SANDTRAP LN 27205 PRIVATE DRIVE 1,033.29 S2459 SANDY CREEK CHURCH RD 27355 STATE ROAD 20,744.47 S2459 SANDY CREEK CHURCH RD 27298 STATE ROAD 2,941.39 S2524 SANDY CREEK DR 27298 STATE ROAD 1,196.17 P8704175 SANDY LAKE DR 27248 PRIVATE DRIVE 1,459.88 S2550 SANDY RIDGE DR 27298 STATE ROAD 3,133.16 P7728273 SANFORD CT 27263 PRIVATE DRIVE 510.43 C0001300 SANFORD ST 27203 CITY STREET 977.14 P7776548 SAPLING WAY 27317 PRIVATE DRIVE 636.81 P6795517 SARAH LN 27360 PRIVATE DRIVE 931.94 C0001563 SARINA DR 27317 CITY STREET 502.26 S1992 SARTIN RD 27317 STATE ROAD 236.02 C0001301 SAUNDERS DR 27203 CITY STREET 1,864.81 P7730570 SAUNDERS TRL 27205 PRIVATE DRIVE 1,766.92 P7723156 SAVANNAH DR 27205 PRIVATE DRIVE 850.85 S1521 SAWYER RD 27350 STATE ROAD 3,205.45 P7734502 SAWYER RD EXT 27350 PRIVATE DRIVE 3,250.27 S1328 SAWYERSVILLE RD 27205 STATE ROAD 9,225.45 P7639234 SCALEYBARK LN 27205 PRIVATE DRIVE 1,018.06 S1251 SCALEYBARK LN 27205 STATE ROAD 1,499.96 C0001302 SCARBORO ST 27203 CITY STREET 643.52 P6686437 SCARLET OAK DR 27239 PRIVATE DRIVE 2,101.36 C0001303 SCENIC DR 27203 CITY STREET 386.15 S1397 SCENIC POINT DR 27205 STATE ROAD 1,389.23 P7712455 SCENIC POINT DR 27205 PRIVATE DRIVE 652.70 C0002025 SCHOOL RD 27370 CITY STREET 3,818.14 C0003026 SCHOOL RD 27248 CITY STREET 344.76 C0008021 SCHOOL ST 27355 CITY STREET 1,045.85 S1163 SCIENCE HILL RD 27205 STATE ROAD 1,566.16 S1130 SCOTT FARM RD 27205 STATE ROAD 4,728.49 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-73 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7625549 SCOTT MCDOWELL DR 27205 PRIVATE DRIVE 3,894.04 S1235 SCOTT MTN RD 27205 STATE ROAD 1,249.73 P7638202 SCOTT MTN RD EXT 27205 PRIVATE DRIVE 1,809.97 P7664503 SCOTT RD 27341 PRIVATE DRIVE 1,115.06 P8734305 SCOTTON RD 27355 PRIVATE DRIVE 2,895.76 C0007029 SEAGROVE PARK VIEW DR 27205 CITY STREET 1,305.26 S2846 SEAGROVE PLANK RD 27205 STATE ROAD 9,824.85 S2850 SEAGROVE PLANK RD EXT 27205 STATE ROAD 1,059.73 C0002048 SEALY DR 27370 CITY STREET 4,210.02 S2888 SEARCY RD 27341 STATE ROAD 2,275.18 P8625101 SEARCY RD EXT 27341 PRIVATE DRIVE 746.32 S2478 SEAYS RD 27298 STATE ROAD 1,830.03 S1560 SECOND HEIGHTS DR 27263 STATE ROAD 432.07 S3280 SECOND PARK AVE 27317 STATE ROAD 1,521.50 C0002148 SEMINOLE DR 27263 CITY STREET 1,302.13 P7740233 SEMINOLE DR 27205 PRIVATE DRIVE 443.46 P7758527 SENEPOLE RD 27317 PRIVATE DRIVE 682.95 C0001304 SEQUOIA AVE 27205 CITY STREET 1,392.22 P7776550 SERENITY TRL 27248 PRIVATE DRIVE 1,129.18 C0001305 SEWELL DR 27203 CITY STREET 979.52 P7794386 SHADY BROOK DR 27248 PRIVATE DRIVE 4,513.34 C0001306 SHADY DR 27203 CITY STREET 857.60 C0005042 SHADY DR 27316 CITY STREET 499.66 S2126 SHADY FOREST RD 27317 STATE ROAD 1,693.70 P7764262 SHADY FOREST RD EXT 27317 PRIVATE DRIVE 541.97 S2472 SHADY GROVE CHURCH RD 27355 STATE ROAD 23,966.46 S2543 SHADY HOLLOW RD 27355 STATE ROAD 3,656.11 P7790340 SHADY KNOLL DR 27205 PRIVATE DRIVE 2,472.44 S1739 SHADY LAWN CT 27263 STATE ROAD 469.29 C0002239 SHADY OAK LN 27263 CITY STREET 912.49 P7658368 SHADY WILLIAMS DR 27205 PRIVATE DRIVE 633.62 S1734 SHADYDALE ACRES LN 27370 STATE ROAD 1,386.13 P7716493 SHAGBARK DR 27370 PRIVATE DRIVE 902.82 S3176 SHALLOW RIVER DR 27360 STATE ROAD 1,612.20 C0002223 SHAMROCK CT 27263 CITY STREET 625.40 C0001307 SHAMROCK RD 27203 CITY STREET 5,253.82 C0001307 SHAMROCK RD 27205 CITY STREET 2,302.27 C0001507 SHANA LN 27205 CITY STREET 807.05 S3223 SHANNON DR 27370 STATE ROAD 1,379.42 C0001308 SHANNON RD 27203 CITY STREET 3,334.35 S3222 SHARON ACRES DR 27350 STATE ROAD 826.60 C0001309 SHARON AVE 27203 CITY STREET 2,992.43 S2017 SHARON DALE DR 27263 STATE ROAD 722.87 C0006072 SHARON LN 27317 CITY STREET 456.74 S2304 SHARON LN 27313 STATE ROAD 1,109.46 S2681 SHARRON DR 27205 STATE ROAD 1,865.58 P6695560 SHAW REEDER RD 27239 PRIVATE DRIVE 1,321.09 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-74 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0006073 SHAW ST 27317 CITY STREET 3,888.92 S1380 SHAW ST 27205 STATE ROAD 2,308.45 C0008022 SHAW ST 27355 CITY STREET 594.24 S3170 SHAWNEE TRL 27350 STATE ROAD 1,450.98 C0002149 SHEAN DR 27263 CITY STREET 658.18 S2307 SHEFFIELD AVE 27317 STATE ROAD 1,777.36 C0001310 SHEFFIELD ST 27203 CITY STREET 484.55 P8706481 SHELAR DR 27298 PRIVATE DRIVE 1,845.45 S2444 SHELTON CTRY RD 27298 STATE ROAD 4,825.24 P8706122 SHELTON CTRY RD EXT 27298 PRIVATE DRIVE 1,045.70 P6795513 SHEPHERDS VIEW RD 27360 PRIVATE DRIVE 1,954.13 C0001311 SHEPHERDS WAY 27205 CITY STREET 920.12 S1210 SHERIDAN DR 27205 STATE ROAD 1,360.16 P7773480 SHERON CTRY DR 27317 PRIVATE DRIVE 485.38 S3150 SHERRIE DR 27263 STATE ROAD 818.38 S1204 SHERWOOD AVE 27205 STATE ROAD 2,733.03 S1651 SHERWOOD FOREST DR 27370 STATE ROAD 1,944.33 P6796001 SHERWOOD FOREST DR EXT 27370 PRIVATE DRIVE 235.18 C0001569 SHERWOOD OAKS DR 27205 CITY STREET 1,162.76 C0001312 SHERWOOD RD 27205 CITY STREET 1,376.30 S2407 SHILOH RD 27298 STATE ROAD 4,243.62 S2407 SHILOH RD 27298 STATE ROAD 7,071.93 S2407 SHILOH RD 27283 STATE ROAD 2,276.14 C0002266 SHINING WAY 27370 CITY STREET 456.18 P7716176 SHIRLEY JEAN DR 27370 PRIVATE DRIVE 1,944.49 P8708412 SHOOTING STAR DR 27298 PRIVATE DRIVE 1,134.72 C0009002 SHORE ST 27263 CITY STREET 2,246.16 S2880 SHORT CUT RD 27208 STATE ROAD 1,846.47 P8714309 SHORT GRASS DR 27355 PRIVATE DRIVE 2,153.09 C0006074 SIBBETT ST 27317 CITY STREET 693.47 S2875 SIDE CHURCH RD 27341 STATE ROAD 6,400.03 C0010002 SIGNET CT 27360 CITY STREET 393.24 C0011047 SILER ST 27370 CITY STREET 1,473.38 S2424 SILK HOPE RD 27298 STATE ROAD 5,043.76 P8702232 SILKWOOD DR 27316 PRIVATE DRIVE 1,644.08 C0001313 SILVER AVE 27203 CITY STREET 1,790.64 C0006119 SILVER FOX LN 27317 CITY STREET 296.82 P7736339 SILVER MAPLE RD 27350 PRIVATE DRIVE 692.26 P7733412 SILVER MTN TRL 27350 PRIVATE DRIVE 2,701.08 S1520 SILVER SPRINGS RD 27350 STATE ROAD 1,951.65 S2298 SILVERWOOD LN 27317 STATE ROAD 1,081.78 C0002194 SIMMONS CREEK CT 27263 CITY STREET 797.55 P8628456 SIMMONS TRL 27208 PRIVATE DRIVE 296.01 C0001314 SIMPSON AVE 27203 CITY STREET 512.26 P6797199 SINK FARM RD 27360 PRIVATE DRIVE 3,603.79 P7708368 SISTERS LN 27263 PRIVATE DRIVE 2,076.38 P7763125 SIXTH PARK AVE 27317 PRIVATE DRIVE 915.65 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-75 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P8726416 SIZEMORE AVE EXT 27298 PRIVATE DRIVE 2,294.58 S1346 SKEEN VIEW RD 27205 STATE ROAD 3,176.39 S1550 SKEENS MILL RD 27370 STATE ROAD 4,444.71 C0001315 SKY DR 27203 CITY STREET 1,232.57 S1203 SKYCREST CTRY RD 27205 STATE ROAD 5,025.66 S2127 SKYHAVEN RD 27317 STATE ROAD 961.67 S2683 SKYLINE DR 27205 STATE ROAD 2,274.50 S1852 SKYVIEW CT 27370 STATE ROAD 338.63 S2946 SLATE AVE 27205 STATE ROAD 267.85 S1999 SLEEPY HOLLOW DR 27263 STATE ROAD 1,047.76 S1574 SLICK ROCK MTN RD 27205 STATE ROAD 2,485.10 S1574 SLICK ROCK MTN RD 27370 STATE ROAD 1,473.50 P7756286 SMALL CTRY RD 27317 PRIVATE DRIVE 384.57 S1963 SMALL RD 27317 STATE ROAD 4,820.45 S2457 SMITH ADKINS RD 27298 STATE ROAD 2,582.46 P8724111 SMITH ADKINS RD EXT 27298 PRIVATE DRIVE 1,268.93 C0006075 SMITH AVE 27317 CITY STREET 416.35 P7785135 SMITH HOLDEN RD 27248 PRIVATE DRIVE 796.83 C0002150 SMITH LN 27263 CITY STREET 771.40 C0003027 SMITH ST 27248 CITY STREET 613.52 S2285 SMOKE WOOD RD 27317 STATE ROAD 2,133.21 P7732427 SMYRNA GROVE DR 27205 PRIVATE DRIVE 1,514.02 P7733360 SNOWBERRY TRL 27350 PRIVATE DRIVE 2,853.23 C0001606 SNOWDON CT 27203 CITY STREET 765.51 S1548 SNYDER CTRY RD 27370 STATE ROAD 17,800.10 P6794249 SNYDERS RD 27370 PRIVATE DRIVE 1,200.99 S2558 SOAPSTONE DR 27355 STATE ROAD 761.88 S2458 SOAPSTONE MTN RD 27355 STATE ROAD 14,548.57 S2692 SOHOMEY DR 27205 STATE ROAD 1,105.12 C0002265 SOLITAIRE DR 27370 CITY STREET 487.27 P7734503 SONGBIRD LN 27350 PRIVATE DRIVE 809.46 P7764338 SONNETT DR 27317 PRIVATE DRIVE 1,109.69 P8713373 SONNYS DR 27316 PRIVATE DRIVE 352.62 P7669531 SONORA DR 27205 PRIVATE DRIVE 591.89 S1238 SOURWOOD DR 27205 STATE ROAD 976.82 P7740329 SOURWOOD DR 27205 PRIVATE DRIVE 346.86 S2975 SOUTH CREEK CT 27205 STATE ROAD 1,357.03 S3210 SOUTH CT 27370 STATE ROAD 265.26 P6794250 SOUTH FORK RD 27239 PRIVATE DRIVE 1,448.37 S2967 SOUTH LAKE DR 27205 STATE ROAD 5,205.86 P7765264 SOUTH PIN OAK DR 27317 PRIVATE DRIVE 461.07 S1625 SOUTH RD 27260 STATE ROAD 1,554.38 C0009008 SOUTH RD 27260 CITY STREET 868.42 C0007020 SOUTH ST 27341 CITY STREET 2,740.85 P8608208 SOUTHER RD 27316 PRIVATE DRIVE 1,509.64 C0001574 SOUTHERN DR 27317 CITY STREET 718.31 P7725403 SOUTHERN HILL RD 27350 PRIVATE DRIVE 852.99 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-76 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1719 SOUTHLAND DR 27263 STATE ROAD 974.71 S1274 SOUTHMONT DR 27205 STATE ROAD 5,950.59 S1252 SOUTHMONT HEIGHTS AVE 27205 STATE ROAD 989.52 S1145 SOUTHMONT SCHOOL RD 27205 STATE ROAD 9,686.73 S2856 SOUTHROCK ST 27341 STATE ROAD 1,343.56 C0001316 SOUTHWAY RD 27205 CITY STREET 2,024.00 P6799416 SOUTHWEST ST 27260 PRIVATE DRIVE 238.18 S2989 SOUTHWOOD DR 27205 STATE ROAD 1,631.41 S2526 SPAINHOUR ST 27233 STATE ROAD 1,678.89 S1228 SPANISH DR 27205 STATE ROAD 1,423.36 S1215 SPANISH LN 27205 STATE ROAD 541.67 S3125 SPARKY LN 27350 STATE ROAD 1,341.84 P7781153 SPARROW TRL 27205 PRIVATE DRIVE 1,688.95 S3169 SPARTA DR 27350 STATE ROAD 927.07 C0001317 SPENCER AVE 27203 CITY STREET 2,045.96 P7747302 SPENCER LAKE DR 27263 PRIVATE DRIVE 700.94 S1418 SPENCER MEADOW RD 27205 STATE ROAD 6,743.04 S1929 SPENCER RD 27263 STATE ROAD 8,022.62 C0006076 SPENCER ST 27317 CITY STREET 2,305.56 P7717411 SPENCER VIEW LN 27370 PRIVATE DRIVE 1,100.50 S1504 SPERO RD 27205 STATE ROAD 7,488.18 S1504 SPERO RD 27203 STATE ROAD 1,523.11 S1504 SPERO RD 27317 STATE ROAD 10,230.27 P8702435 SPICEWOOD LN 27316 PRIVATE DRIVE 961.40 S2664 SPINKS RD 27205 STATE ROAD 8,293.95 C0001318 SPINKS ST 27203 CITY STREET 679.00 P7717141 SPIVEY LN 27370 PRIVATE DRIVE 1,407.05 P7685273 SPIVEYS CORNER RD 27341 PRIVATE DRIVE 685.29 S2667 SPOONS CHAPEL CHURCH RD 27205 STATE ROAD 1,131.68 S2606 SPOONS CHAPEL RD 27205 STATE ROAD 11,094.22 S1220 SPRING DR 27205 STATE ROAD 1,522.56 S3155 SPRING FOREST RD 27205 STATE ROAD 1,200.53 S3164 SPRING GARDEN CT 27350 STATE ROAD 459.03 C0001319 SPRING GARDEN ST 27203 CITY STREET 1,168.56 P7764452 SPRING HAVEN DR 27317 PRIVATE DRIVE 1,711.05 C0007021 SPRING ST 27341 CITY STREET 731.32 C0002152 SPRING ST 27263 CITY STREET 555.56 C0001320 SPRING ST 27203 CITY STREET 2,127.50 C0006077 SPRING VALLEY DR 27317 CITY STREET 713.70 S1447 SPRING VALLEY RD 27205 STATE ROAD 601.93 P7648151 SPRING VILLAGE DR 27205 PRIVATE DRIVE 848.09 S2944 SPRINGDALE DR 27205 STATE ROAD 1,650.27 C0001321 SPRINGDALE LN 27205 CITY STREET 391.69 C0002151 SPRINGFIELD ST 27263 CITY STREET 476.22 S2451 SPRINGSIDE RD 27298 STATE ROAD 1,848.07 P8711176 SPRINGVIEW ST 27316 PRIVATE DRIVE 631.22 C0001617 SPRINGWOOD CT 27205 CITY STREET 472.56 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-77 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0002153 SPRINGWOOD LN 27263 CITY STREET 2,148.28 C0001322 SPRINGWOOD RD 27205 CITY STREET 2,650.78 P6795161 SPRUCE CT 27370 PRIVATE DRIVE 343.66 C0002247 SPRUCEWOOD CT 27263 CITY STREET 272.81 P7689533 SQUIRREL CREEK RD 27205 PRIVATE DRIVE 1,802.74 P7780534 SQUIRREL DEN RD 27205 PRIVATE DRIVE 1,227.37 P7781114 SQUIRREL HOLLOW LN 27205 PRIVATE DRIVE 420.91 S1965 ST PETER CHURCH RD 27317 STATE ROAD 6,238.76 P7638234 STABLE BROOK RD 27205 PRIVATE DRIVE 2,130.83 C0008027 STALEY COVE DR 27355 CITY STREET 1,355.91 C0008028 STALEY COVE TRL 27355 CITY STREET 656.20 S3011 STALEY FAMILY PL 27205 STATE ROAD 1,466.48 P7745395 STALEY HILL RD 27350 PRIVATE DRIVE 3,191.45 P8735354 STALEY VIEW TRL 27355 PRIVATE DRIVE 479.63 P8737463 STALEYS DAIRY RD 27298 PRIVATE DRIVE 2,956.23 S2839 STALEYS FARM RD 27205 STATE ROAD 19,927.53 S1246 STALLION TRL 27205 STATE ROAD 2,306.54 S1984 STANLEY RD 27263 STATE ROAD 1,943.32 S2038 STANTON FARM RD 27317 STATE ROAD 5,380.65 S3191 STANTON RD 27370 STATE ROAD 865.85 P7649442 STAR GAZER DR 27205 PRIVATE DRIVE 973.24 P6798110 STARFLOWER DR 27263 PRIVATE DRIVE 997.66 S3232 STARLETTE LN 27370 STATE ROAD 1,211.03 S2407 STARMOUNT RD 27298 STATE ROAD 18,308.55 C0001323 STARR CT 27203 CITY STREET 194.50 S1934 STEED RD 27317 STATE ROAD 6,856.01 S2918 STEELE ST 27205 STATE ROAD 1,109.04 C0005043 STEELE ST 27316 CITY STREET 514.28 S3173 STEEPLECHASE DR 27360 STATE ROAD 650.49 C0011009 STEEPLEGATE DR 27370 CITY STREET 2,464.51 P7731410 STEPPINGSTONE LN 27205 PRIVATE DRIVE 2,027.59 C0002192 STERLING RIDGE DR 27263 CITY STREET 1,471.03 C0001324 STERLING ST 27203 CITY STREET 627.30 C0006078 STEVENSON ST 27317 CITY STREET 637.56 S1689 STEWART ST 27350 STATE ROAD 2,768.62 P7735014 STEWART ST EXT 27350 PRIVATE DRIVE 764.75 P8724406 STILL MEADOWS LN 27355 PRIVATE DRIVE 3,838.94 C0011001 STIRRUP CT 27370 CITY STREET 499.20 C0001542 STONE ARBOR DR 27317 CITY STREET 487.83 P7638233 STONE BRIDGE RD 27205 PRIVATE DRIVE 3,676.61 P7731374 STONE CTRY LN 27205 PRIVATE DRIVE 781.85 P6797523 STONE GABLES DR 27360 PRIVATE DRIVE 1,421.99 S2295 STONE HAVEN DR 27203 STATE ROAD 876.90 S3133 STONE RIDGE DR 27370 STATE ROAD 1,541.84 S1362 STONECREST CT 27205 STATE ROAD 829.82 S3275 STONEHENGE PL 27360 STATE ROAD 796.96 S3273 STONEHENGE RD 27360 STATE ROAD 2,007.29 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-78 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S3274 STONESIDE CIR 27360 STATE ROAD 1,381.80 P7628528 STONEWALL CT 27205 PRIVATE DRIVE 161.43 C0001596 STONEY CREEK DR 27205 CITY STREET 778.56 P7737190 STONEY CREEK DR 27263 PRIVATE DRIVE 771.14 P7703525 STONEY RIVER DR 27370 PRIVATE DRIVE 830.45 S2623 STOUT ACRES RD 27316 STATE ROAD 3,263.92 P7657115 STOUT FARM RD 27205 PRIVATE DRIVE 1,120.78 C0006079 STOUT RD 27317 CITY STREET 4,971.51 C0005044 STOUT ST 27316 CITY STREET 377.15 P8711177 STOUT VIEW ST 27316 PRIVATE DRIVE 692.40 C0001325 STOWE AVE 27203 CITY STREET 2,177.63 C0001326 STRAIGHT ST 27203 CITY STREET 1,148.73 C0002154 STRATFORD RD 27263 CITY STREET 2,456.78 S2698 STRATFORD WAY 27205 STATE ROAD 1,463.36 C0001561 STRAWBERRY LN 27317 CITY STREET 825.07 P7689432 STREAM WATCH TRL 27205 PRIVATE DRIVE 1,185.70 S1114 STRIEBY CHURCH RD 27205 STATE ROAD 2,859.97 P7625127 STRIEBY CHURCH RD EXT 27205 PRIVATE DRIVE 1,403.25 C0005045 STUART ST 27316 CITY STREET 820.66 S1326 STUTTS RD 27205 STATE ROAD 16,091.99 S2394 SUBSTATION RD 27203 STATE ROAD 2,437.87 S2058 SUGAR CANE LN 27360 STATE ROAD 909.45 P7695567 SUGG DR 27341 PRIVATE DRIVE 2,494.59 P8605159 SUGG TEAGUE RD 27341 PRIVATE DRIVE 924.22 S1917 SUITS RD 27263 STATE ROAD 13,379.62 P6797496 SUMMER SHADE DR 27370 PRIVATE DRIVE 614.62 P7777265 SUMMER TRL 27313 PRIVATE DRIVE 532.25 S2287 SUMMERSET RD 27317 STATE ROAD 1,502.11 S1848 SUMMERVILLE DR 27370 STATE ROAD 1,924.06 P7717306 SUMMERVILLE DR EXT 27370 PRIVATE DRIVE 2,946.25 S1340 SUMMEY TOWN RD 27239 STATE ROAD 999.31 S1340 SUMMEY TOWN RD 27370 STATE ROAD 10,502.58 C0001327 SUMMIT AVE 27203 CITY STREET 1,813.89 P7711260 SUMMIT CT 27205 PRIVATE DRIVE 1,042.22 C0003028 SUMNER PL 27248 CITY STREET 161.05 S1546 SUMNER RD 27370 STATE ROAD 2,881.22 S3001 SUNBEAM CT 27205 STATE ROAD 356.35 S1243 SUNBURST RD 27205 STATE ROAD 214.39 S3250 SUNDANCE TRL 27370 STATE ROAD 993.78 P7743008 SUNDEW DR 27350 PRIVATE DRIVE 543.93 P7772469 SUNFLOWER DR 27203 PRIVATE DRIVE 2,132.06 C0001328 SUNNY LN 27205 CITY STREET 1,061.54 C0002155 SUNNY LN 27263 CITY STREET 639.60 S1229 SUNNY LN 27205 STATE ROAD 707.52 C0001329 SUNRISE AVE 27203 CITY STREET 3,049.79 C0003029 SUNRISE AVE 27248 CITY STREET 2,446.46 C0006080 SUNRISE CIR 27317 CITY STREET 1,259.56 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-79 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0001330 SUNSET AVE 27203 CITY STREET 4,944.72 P7751304 SUNSET AVE 27205 PRIVATE DRIVE 1,072.82 C0001330 SUNSET AVE 27205 CITY STREET 1,203.91 C0006081 SUNSET DR 27317 CITY STREET 3,491.42 C0001332 SUNSET DR 27205 CITY STREET 2,290.73 C0001334 SUNSET DR N 27205 CITY STREET 1,272.51 S3113 SUNSET KNOLL DR 27370 STATE ROAD 718.06 P7716292 SUNSET KNOLL DR EXT 27370 PRIVATE DRIVE 1,895.60 P8711178 SUNSET OAKS DR 27316 PRIVATE DRIVE 684.17 S1679 SUNSET VIEW DR 27263 STATE ROAD 1,517.52 S1679 SUNSET VIEW DR EXT 27263 STATE ROAD 323.03 P6798258 SUNSET VIEW DR EXT 27263 PRIVATE DRIVE 367.44 P8702230 SUNSHINE HEIGHTS RD 27316 PRIVATE DRIVE 609.76 S1184 SURRATT CTRY RD 27239 STATE ROAD 5,307.67 C0002156 SURRETT DR 27263 CITY STREET 5,561.40 S1595 SURRETT DR 27263 STATE ROAD 9,021.15 S2306 SURRIE TRL 27313 STATE ROAD 3,276.59 P7674193 SUSAN DR 27341 PRIVATE DRIVE 531.42 S2318 SUSSEX TRL 27313 STATE ROAD 1,006.81 C0006082 SWAIM ST 27317 CITY STREET 2,389.54 S1635 SWEETBRIAR RD 27350 STATE ROAD 3,422.85 P7618001 SWEETWATER TRL 27205 PRIVATE DRIVE 6,158.97 S2008 SYCAMORE DR 27317 STATE ROAD 1,027.04 P7791352 SYCAMORE TRL 27248 PRIVATE DRIVE 1,180.83 C0001595 SYKES FARM RD 27205 CITY STREET 2,589.46 C0001335 SYLVAN DR 27203 CITY STREET 434.43 C0001335 SYLVAN DR 27203 CITY STREET 395.84 S2687 SYLVAN DR 27205 STATE ROAD 797.10 P7786395 SYLVAN OAKS RD 27233 PRIVATE DRIVE 1,482.60 S3129 SYLVAN TRL 27370 STATE ROAD 1,372.26 P7776234 SYLVAN VIEW RD 27317 PRIVATE DRIVE 460.20 S3225 SYLVAN WAY 27205 STATE ROAD 1,345.42 P7649338 SYLVAN WOODS DR 27205 PRIVATE DRIVE 1,739.79 C0002157 SYLVIA ST 27263 CITY STREET 501.65 S1405 TABERNACLE CHURCH RD 27370 STATE ROAD 19,144.74 S1311 TABERNACLE CHURCH RD EXT 27370 STATE ROAD 1,282.06 S1382 TABERNACLE SCHOOL RD 27205 STATE ROAD 4,847.30 C0006083 TABERNACLE ST 27317 CITY STREET 672.18 C0001336 TABOR CT 27203 CITY STREET 399.22 S3130 TALL CEDAR LN 27370 STATE ROAD 2,411.30 S2840 TALL PINE ST 27205 STATE ROAD 5,840.92 P7658475 TALL PINE ST EXT 27205 PRIVATE DRIVE 373.12 S3239 TALLWOOD DR 27370 STATE ROAD 2,372.17 P6798153 TALLWOOD ESTATES DR 27360 PRIVATE DRIVE 1,080.81 P7679222 TALMER WRIGHT RD 27205 PRIVATE DRIVE 1,741.14 C0001338 TAMWORTH RD 27203 CITY STREET 1,042.10 S2686 TANGLEWOOD LN 27205 STATE ROAD 1,623.30 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-80 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0011015 TANNER CT 27370 CITY STREET 759.63 P7668173 TAR HEEL TRL 27205 PRIVATE DRIVE 259.53 C0002158 TARHEEL DR 27263 CITY STREET 2,543.97 P7725412 TARMAC DR 27350 PRIVATE DRIVE 1,996.01 C0005046 TATE ST 27316 CITY STREET 881.49 P7726543 TAXI WAY 27350 PRIVATE DRIVE 370.96 P7726276 TAYLOR CT 27370 PRIVATE DRIVE 447.59 C0005056 TAYLOR CT 27316 CITY STREET 305.92 P7753247 TAYLOR DR 27203 PRIVATE DRIVE 1,226.78 S2360 TAYLOR WOODS LN 27313 STATE ROAD 1,213.46 S1368 TAYLORS CREEK DR 27205 STATE ROAD 2,959.73 S2925 TEACHEY SCHOOL DR 27205 STATE ROAD 505.55 P7695566 TEAGUE FARM RD 27341 PRIVATE DRIVE 9,125.26 P7766469 TEAL CT 27317 PRIVATE DRIVE 280.15 C0001339 TELEPHONE AVE 27205 CITY STREET 1,409.25 S2487 TEMPLE VIEW RD 27316 STATE ROAD 660.85 S1259 TERESA WAY 27205 STATE ROAD 2,533.18 C0002211 TERRACE TRACE CT 27263 CITY STREET 315.19 C0001534 TERRY AVE 27203 CITY STREET 384.20 P6787100 TEXAS BLVD 27360 PRIVATE DRIVE 1,852.03 C0001341 THAYER DR 27205 CITY STREET 2,413.77 S1549 THAYER RD 27370 STATE ROAD 25,246.13 P8708304 THIRD B ST 27283 PRIVATE DRIVE 503.50 P7763122 THIRD PARK AVE 27317 PRIVATE DRIVE 890.10 C0001342 THIRD ST 27203 CITY STREET 428.88 C0001342 THIRD ST 27205 CITY STREET 1,995.41 C0006084 THIRD ST 27317 CITY STREET 714.50 S2195 THOMAS ST 27203 STATE ROAD 1,227.33 P7744011 THOMPSON HEATH RD 27350 PRIVATE DRIVE 3,168.20 S1620 THOMPSON RD 27263 STATE ROAD 842.31 P6798259 THOMPSON RD EXT 27263 PRIVATE DRIVE 1,037.14 S2483 THORNBROOK RD 27316 STATE ROAD 556.46 P7617259 THORNBURG FARM TRL 27205 PRIVATE DRIVE 3,478.09 S1350 THORNBURG RD 27205 STATE ROAD 844.80 C0001343 THORNSDALE DR 27203 CITY STREET 2,153.45 S1254 THOROUGHBRED RD 27205 STATE ROAD 2,021.29 S1425 THREE B RD 27205 STATE ROAD 477.81 C0008023 THRU ROAD 27355 CITY STREET 120.62 P6798155 TIA CT 27360 PRIVATE DRIVE 492.60 P7667239 TIGER FLOWER RD 27205 PRIVATE DRIVE 2,257.63 S1989 TIGERS DEN RD 27317 STATE ROAD 5,853.55 P7767480 TILLEY LN 27317 PRIVATE DRIVE 148.71 C0001551 TIMBAL CT 27205 CITY STREET 595.33 S2974 TIMBER LEA LN 27316 STATE ROAD 2,741.81 P7776547 TIMBER TRL 27317 PRIVATE DRIVE 1,914.64 C0001344 TIMBERLANE 27205 CITY STREET 3,395.12 P7668444 TIMBERWOLF TRL 27205 PRIVATE DRIVE 2,586.26 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-81 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) P7754507 TIMKEN PL 27317 PRIVATE DRIVE 1,050.40 S1310 TIP TOP RD 27239 STATE ROAD 2,415.06 S2245 TIPPETT RD 27248 STATE ROAD 1,321.18 C0001345 TIPTON DR 27203 CITY STREET 927.48 S1532 TOBACCO RD 27370 STATE ROAD 9,379.35 P7725020 TODD HAGERMAN TRL 27350 PRIVATE DRIVE 1,738.02 S1924 TOM BALL RD 27317 STATE ROAD 3,658.79 S1924 TOM BALL RD 27263 STATE ROAD 630.94 S2240 TOM BROWN RD 27248 STATE ROAD 7,488.53 S1570 TOM HILL RD 27263 STATE ROAD 2,582.25 S1570 TOM HILL RD 27370 STATE ROAD 3,571.61 S2655 TOMMY COX RD 27316 STATE ROAD 11,483.55 S1173 TOMS CREEK RD 27205 STATE ROAD 3,705.19 P7707224 TONY DR 27370 PRIVATE DRIVE 2,848.64 S3103 TONY DR 27370 STATE ROAD 927.41 P7772471 TONYS WAY 27203 PRIVATE DRIVE 1,259.37 P7658267 TOPAZ DR 27205 PRIVATE DRIVE 580.20 P7764172 TORCH DR 27317 PRIVATE DRIVE 962.16 C0001583 TORTOISE LN 27317 CITY STREET 318.42 S1515 TORY LN 27205 STATE ROAD 3,626.28 S1163 TOT HILL FARM RD 27205 STATE ROAD 24,417.18 P7628525 TOT HILL TRL 27205 PRIVATE DRIVE 1,254.58 C0009006 TOWER AVE 27260 CITY STREET 990.75 P7745430 TOWER VIEW LN 27350 PRIVATE DRIVE 618.18 S2501 TOWN CTRY RD 27298 STATE ROAD 4,018.08 P6790324 TOYES DR 27239 PRIVATE DRIVE 4,072.90 C0001346 TRACI ST 27203 CITY STREET 228.52 C0001347 TRADE ST 27203 CITY STREET 341.00 P8728303 TRAILS END RD 27298 PRIVATE DRIVE 2,313.41 P7782498 TRAINING CENTER DR 27317 PRIVATE DRIVE 974.66 S1494 TRANQUIL LN 27205 STATE ROAD 1,042.03 C0001572 TRANSFER STATION PL 27203 CITY STREET 1,554.41 C0011050 TRAVELER DR 27370 CITY STREET 542.79 S1795 TREE HOLLOW EXT 27360 STATE ROAD 1,070.07 S1794 TREE HOLLOW RD 27360 STATE ROAD 1,138.56 P6795163 TREE HOLLOW RD 27360 PRIVATE DRIVE 725.92 P7635288 TREE HOUSE LN 27205 PRIVATE DRIVE 1,104.50 P7725346 TREE SPARROW DR 27350 PRIVATE DRIVE 1,191.94 C0002159 TREETOP CT 27370 CITY STREET 728.19 C0001348 TREMONT DR 27203 CITY STREET 2,032.46 C0002209 TREY LN 27263 CITY STREET 987.18 N 62 TRINDALE RD 27263 NC HIGHWAY 3,737.56 N 62 TRINDALE RD 27370 NC HIGHWAY 2,531.26 C0002161 TRINDALE SCHOOL DR 27263 CITY STREET 1,120.49 S1606 TRINITY BLVD 27370 STATE ROAD 1,015.40 S1702 TRINITY BLVD 27370 STATE ROAD 1,806.88 S2870 TRINITY CHURCH RD 27341 STATE ROAD 15,614.59 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-82 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S1600 TRINITY COLLEGE RD 27370 STATE ROAD 404.05 S1831 TRINITY CT 27263 STATE ROAD 383.18 S1748 TRINITY HIGH SCHOOL DR 27370 STATE ROAD 3,616.66 S1004 TRINITY RD 27370 STATE ROAD 10,756.77 P7776336 TROGDON CTRY TRL 27317 PRIVATE DRIVE 2,213.56 S2713 TROGDON HILL RD 27205 STATE ROAD 4,042.68 P7772467 TROGDON POND RD 27203 PRIVATE DRIVE 2,698.35 C0001349 TROGDON ST 27205 CITY STREET 431.62 P7766467 TROGDON WAY TRL 27317 PRIVATE DRIVE 1,622.67 C0001350 TROLLINGER RD 27203 CITY STREET 1,679.48 C0006085 TROLLINGER ST 27317 CITY STREET 2,982.91 S1918 TROTTER CTRY RD 27263 STATE ROAD 3,105.28 P7750108 TROTTER LN 27205 PRIVATE DRIVE 606.10 S1169 TROTTER RD 27205 STATE ROAD 1,749.57 C0011006 TROTTERS RUN 27370 CITY STREET 2,034.68 S2639 TROY CAVENESS RD 27316 STATE ROAD 16,041.64 S2434 TROY ESTATE RD 27298 STATE ROAD 507.34 S2434 TROY ESTATE RD 27355 STATE ROAD 5,297.04 S2409 TROY SMITH RD 27298 STATE ROAD 11,114.28 C0002162 TRUMAN AVE 27263 CITY STREET 351.82 C0001351 TRYON ST 27203 CITY STREET 446.55 P7767289 TUCKER LN 27317 PRIVATE DRIVE 840.43 C0001352 TUCKER ST 27203 CITY STREET 2,004.61 P7752570 TUDOR DR 27205 PRIVATE DRIVE 494.46 S1512 TURNER DAIRY RD 27317 STATE ROAD 4,489.48 S2519 TURNER LAKE RD 27298 STATE ROAD 272.82 S1399 TURNING OAKS TRL 27205 STATE ROAD 1,662.15 P6797101 TURNPIKE CT 27360 PRIVATE DRIVE 1,351.79 S1558 TURNPIKE RD 27263 STATE ROAD 11,741.08 S1558 TURNPIKE RD 27360 STATE ROAD 2,348.51 C0001584 TURTLE LAKE BND 27317 CITY STREET 684.01 P7734504 TURTLEDOVE RD 27350 PRIVATE DRIVE 1,264.76 P7703522 TUTLOHR DR 27370 PRIVATE DRIVE 1,203.18 S1920 TUTTLE RD 27263 STATE ROAD 7,487.61 C0001603 TWAIN DR 27203 CITY STREET 767.30 S2249 TWAIN DR 27203 STATE ROAD 265.89 S2976 TWIN CREEK RD 27205 STATE ROAD 1,484.23 P7770308 TWIN CRYSTAL TRL 27205 PRIVATE DRIVE 1,718.11 P6795159 TWIN OAKS DR 27370 PRIVATE DRIVE 950.73 P8738101 TWIN TREE DR 27298 PRIVATE DRIVE 426.45 P7790311 TWINFLOWER RD 27205 PRIVATE DRIVE 800.95 P7733258 TWINLEAF DR 27350 PRIVATE DRIVE 636.34 S1764 TWINWOOD CT 27370 STATE ROAD 411.86 S1766 TWINWOOD DR 27370 STATE ROAD 404.49 P7767379 TWO POND DR 27317 PRIVATE DRIVE 2,989.47 P6785002 TY LN 27360 PRIVATE DRIVE 941.49 P7724061 UDELL DR 27350 PRIVATE DRIVE 931.74 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-83 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2981 ULAH CT 27205 STATE ROAD 1,077.02 S2513 UNDERWOOD RD 27233 STATE ROAD 2,335.41 C0001354 UNDERWOOD ST 27203 CITY STREET 1,368.78 S1163 UNION CHURCH RD 27205 STATE ROAD 3,460.03 S2863 UNION GROVE CHURCH RD 27341 STATE ROAD 20,060.85 S1547 UNITY ST 27360 STATE ROAD 5,914.19 C0006086 UPTON ST 27317 CITY STREET 654.65 S1987 US HWY 220 BUS N 27317 STATE ROAD 823.57 U 220BUS US HWY 220 BUS N 27317 US HIGHWAY 28,231.25 U 220BUS US HWY 220 BUS N 27203 US HIGHWAY 1,792.19 U 220BUS US HWY 220 BUS S 27205 US HIGHWAY 18,333.99 U 220ALT US HWY 220 S 27341 US HIGHWAY 8,311.74 U 220ALT US HWY 220 S 27205 US HIGHWAY 29,706.71 U 29 US HWY 29 27263 US HIGHWAY 17,103.61 U 311 US HWY 311 27317 US HIGHWAY 6,499.87 U 311 US HWY 311 27350 US HIGHWAY 22,025.59 U 311 US HWY 311 27263 US HIGHWAY 7,860.28 S1009 US HWY 311 27263 STATE ROAD 11,507.82 U 421S US HWY 421 27298 US HIGHWAY 21,733.93 U 421S US HWY 421 27355 US HIGHWAY 62,492.88 U 421S US HWY 421 27283 US HIGHWAY 21,466.98 U 64 BYPASS US HWY 64 27205 US HIGHWAY 135,052.61 U 64BUS US HWY 64 E 27355 US HIGHWAY 3,938.95 U 64E US HWY 64 E 27248 US HIGHWAY 8,858.16 U 64E US HWY 64 E 27203 US HIGHWAY 21,797.40 U 64E US HWY 64 E 27316 US HIGHWAY 31,187.29 U 64W US HWY 64 W 27205 US HIGHWAY 54,690.08 U 64W US HWY 64 W 27370 US HIGHWAY 15,065.41 U 64W US HWY 64 W 27360 US HIGHWAY 1,695.62 C0002163 UWHARRIE RD 27263 CITY STREET 3,444.77 S1612 UWHARRIE RD 27263 STATE ROAD 4,367.53 C0001357 UWHARRIE ST 27203 CITY STREET 6,058.64 S2689 VALEWOOD DR 27205 STATE ROAD 1,508.15 S1791 VALLEY CIR 27360 STATE ROAD 416.51 S2356 VALLEY DALE LN 27203 STATE ROAD 1,323.65 S1845 VALLEY DR 27350 STATE ROAD 2,240.02 S1301 VALLEY FARM RD 27239 STATE ROAD 9,729.84 S1746 VALLEY FORGE DR 27370 STATE ROAD 1,647.00 S1211 VALLEY GROVE RD 27205 STATE ROAD 949.53 C0001358 VALLEY RD 27203 CITY STREET 1,585.87 S1849 VALLEY RIDGE DR 27370 STATE ROAD 1,217.02 S3121 VALLEY RIDGE DR EXT 27370 STATE ROAD 503.70 S1790 VALLEY VIEW RD 27360 STATE ROAD 1,613.85 C0001359 VANCE ST 27203 CITY STREET 1,512.37 S1207 VANCROFT ST 27205 STATE ROAD 2,459.49 S1337 VARNER RD 27239 STATE ROAD 756.33 P7701413 VARNER RD EXT 27239 PRIVATE DRIVE 1,337.10 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-84 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0006088 VARNER ST 27317 CITY STREET 555.75 S2476 VAUGHN YORK RD 27355 STATE ROAD 8,245.44 S2010 VERMONT DR 27317 STATE ROAD 716.09 C0001360 VERNON ST 27203 CITY STREET 299.75 C0002164 VERTA AVE 27263 CITY STREET 1,360.87 P7780199 VESPER TRL 27205 PRIVATE DRIVE 826.74 C0001415 VESTAL CREEK CT 27205 CITY STREET 825.94 S1149 VETERANS LOOP RD 27205 STATE ROAD 3,301.72 P7703211 VICKREY DR 27370 PRIVATE DRIVE 624.79 C0006108 VICTORIAN CT 27317 CITY STREET 525.82 P7776544 VICTORY JUNCTION LN 27317 PRIVATE DRIVE 1,091.38 S2078 VIEWMONT CT 27205 STATE ROAD 381.40 S1875 VIEWMONT DR 27205 STATE ROAD 3,421.00 P7752396 VIEWMONT DR 27205 PRIVATE DRIVE 2,516.05 S3167 VILLA DR 27350 STATE ROAD 310.21 C0006089 VILLAGE AVE 27317 CITY STREET 1,174.37 S1567 VILLAGE DR 27370 STATE ROAD 2,553.32 P7726174 VILLAGE DR 27370 PRIVATE DRIVE 554.31 C0002165 VILLAGE LN 27263 CITY STREET 669.01 C0001361 VINCENT DR 27203 CITY STREET 752.14 P7784217 VINCENT OAKS DR 27248 PRIVATE DRIVE 256.17 P6782251 VIOLA DR 27292 PRIVATE DRIVE 1,096.43 S2015 VIOLET RIDGE RD 27317 STATE ROAD 548.78 P7679422 VIPER LN 27205 PRIVATE DRIVE 150.39 S1147 VIRGIL HILL RD 27205 STATE ROAD 2,590.64 P7689430 VIRGINIA ACRES DR 27205 PRIVATE DRIVE 408.63 C0001362 VIRGINIA AVE 27203 CITY STREET 1,907.59 S3181 VIRGINIA CT 27370 STATE ROAD 209.83 P7726172 VIRGINIA DR 27370 PRIVATE DRIVE 440.30 P8736357 VIRGINIA TRL 27298 PRIVATE DRIVE 1,943.30 C0001355 VISION DR 27203 CITY STREET 4,116.04 S2269 VISION DR 27203 STATE ROAD 3,629.71 S2706 VISTA PKWY 27205 STATE ROAD 1,754.50 S2706 VISTA PKWY EXT 27205 STATE ROAD 1,501.26 S1103 VOLUNTEER RESCUE RD 27239 STATE ROAD 17,231.50 P7636103 VONCANNON FARM RD 27205 PRIVATE DRIVE 5,230.32 P8604457 W A CRAVEN RD 27341 PRIVATE DRIVE 1,841.95 C0006090 W ACADEMY ST 27317 CITY STREET 7,679.91 C0001363 W ACADEMY ST 27203 CITY STREET 819.21 C0001364 W ALLRED ST 27203 CITY STREET 808.95 C0001365 W BAILEY ST 27203 CITY STREET 4,002.65 S1502 W BALFOUR AVE 27203 STATE ROAD 1,608.26 C0001366 W BALFOUR AVE 27203 CITY STREET 3,523.38 C0001367 W BEASLEY ST 27203 CITY STREET 1,974.28 C0004070 W BOWMAN AVE 27298 CITY STREET 3,043.49 C0004071 W BROOKWOOD AVE 27298 CITY STREET 1,804.82 C0004072 W BROWER AVE 27298 CITY STREET 3,366.00 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-85 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0006091 W BROWN ST 27317 CITY STREET 724.92 C0004073 W BUTLER AVE 27298 CITY STREET 1,189.48 P8727509 W BUTLER AVE EXT 27298 PRIVATE DRIVE 1,078.00 C0001368 W CENTRAL AVE 27203 CITY STREET 3,664.22 C0004074 W DAMERON AVE 27298 CITY STREET 2,725.25 U 64BUS W DIXIE DR 27205 US HIGHWAY 4,803.59 U 64BUS W DIXIE DR 27203 US HIGHWAY 1,180.95 P7664291 W E HUNT RD 27341 PRIVATE DRIVE 2,202.68 C0008024 W FRANKLINVILLE ST 27355 CITY STREET 2,135.09 C0004075 W FRAZIER AVE 27298 CITY STREET 734.73 C0004076 W HIGHFILL AVE 27298 CITY STREET 371.63 C0004077 W KIME AVE 27298 CITY STREET 1,686.83 C0007022 W KING AVE 27341 CITY STREET 519.07 C0001371 W KIVETT ST 27203 CITY STREET 3,378.68 C0004037 W LEWIS AVE 27298 CITY STREET 801.80 C0004078 W LUTHER AVE 27298 CITY STREET 1,694.38 N 22N W MAIN ST 27248 NC HIGHWAY 4,781.43 N 705 W MAIN ST 27341 NC HIGHWAY 1,528.73 C0001372 W MILLER ST 27203 CITY STREET 731.50 P7750388 W MINE ST 27205 PRIVATE DRIVE 615.34 C0004079 W MOFFITT AVE 27298 CITY STREET 2,850.86 C0006092 W NAOMI ST 27317 CITY STREET 1,162.34 C0004081 W NEWBERRY AVE 27298 CITY STREET 232.31 S2128 W O W RD 27317 STATE ROAD 14,344.60 S2128 W O W RD 27203 STATE ROAD 483.20 C0004051 W PATTERSON AVE 27298 CITY STREET 1,089.90 C0001373 W PRESNELL ST 27203 CITY STREET 5,004.43 C0001374 W PRITCHARD ST 27203 CITY STREET 621.60 C0008025 W RAILROAD ST 27355 CITY STREET 2,531.21 C0004083 W RALEIGH AVE 27298 CITY STREET 1,534.25 C0005048 W RIDGE ST 27316 CITY STREET 2,650.59 C0006093 W RIVER DR 27317 CITY STREET 1,632.18 S1889 W RIVER RUN 27205 STATE ROAD 2,447.71 N 42N W SALISBURY ST 27203 NC HIGHWAY 4,608.36 C0001375 W SALISBURY ST 27205 CITY STREET 767.59 C0004064 W SIZEMORE AVE 27298 CITY STREET 309.75 C0004084 W STARMOUNT AVE 27298 CITY STREET 3,194.96 C0001376 W STRIDER ST 27203 CITY STREET 806.31 C0004085 W SWANNANOA AVE 27298 CITY STREET 4,878.85 C0001337 W TAFT AVE 27203 CITY STREET 1,355.78 C0004069 W VANCE AVE 27298 CITY STREET 731.97 C0001377 W WAINMAN AVE 27203 CITY STREET 3,273.38 C0001379 W WALKER AVE 27203 CITY STREET 2,181.92 C0001378 W WARD ST 27203 CITY STREET 2,749.66 C0002168 W WHITE DR 27263 CITY STREET 1,654.49 S2874 WADDELLS FERRY RD 27341 STATE ROAD 6,080.25 P8624005 WADDELLS FERRY RD EXT 27341 PRIVATE DRIVE 1,098.48 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-86 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S3207 WAGON WHEEL RD 27360 STATE ROAD 800.09 S3123 WAGONER RD 27370 STATE ROAD 2,183.89 P7707421 WAGONER VIEW DR 27370 PRIVATE DRIVE 1,357.23 S2372 WAKETA DR 27203 STATE ROAD 1,910.80 P7738384 WALDEN LN 27263 PRIVATE DRIVE 1,155.59 P7778542 WALDEN POND RD 27313 PRIVATE DRIVE 2,080.66 S2931 WALDEN RD 27205 STATE ROAD 1,561.72 S1236 WALKER CIR 27205 STATE ROAD 1,151.89 P7731307 WALKER CTRY LN 27205 PRIVATE DRIVE 1,750.89 S1365 WALKER DR 27205 STATE ROAD 960.44 S1936 WALKER MILL RD 27350 STATE ROAD 7,785.94 S1936 WALKER MILL RD 27317 STATE ROAD 5,259.54 S1231 WALKER RD 27205 STATE ROAD 3,133.78 C0007024 WALKER ST 27341 CITY STREET 1,395.14 S2142 WALKER STORE RD 27248 STATE ROAD 9,729.94 P7706247 WALKING STICK DR 27370 PRIVATE DRIVE 785.78 S1941 WALL BROTHERS RD 27350 STATE ROAD 9,199.15 P7774203 WALL CTRY DR 27248 PRIVATE DRIVE 558.01 P8737461 WALL FARM DR 27298 PRIVATE DRIVE 1,536.55 P7715522 WALL LN 27370 PRIVATE DRIVE 807.83 S2436 WALL RD 27355 STATE ROAD 4,228.01 C0002169 WALL ST 27263 CITY STREET 1,927.80 C0003031 WALLACE ST 27248 CITY STREET 1,262.48 P7792282 WALLACE ST EXT 27248 PRIVATE DRIVE 827.33 S3000 WALNUT CREEK LN 27205 STATE ROAD 1,624.86 S2964 WALNUT DR 27205 STATE ROAD 2,123.66 C0002170 WALNUT GROVE RD 27263 CITY STREET 2,829.90 P7763117 WALNUT RIDGE RD 27317 PRIVATE DRIVE 1,446.60 S2314 WALNUT RIDGE RD 27317 STATE ROAD 1,938.78 C0001380 WALNUT ST 27203 CITY STREET 679.73 C0003032 WALNUT ST 27248 CITY STREET 423.39 P8628544 WALT BROWN RD 27208 PRIVATE DRIVE 1,558.34 S1962 WALTER MEADOWS RD 27317 STATE ROAD 2,081.57 P7772341 WALTER SAUNDERS DR 27203 PRIVATE DRIVE 761.73 C0001381 WALTON CT 27203 CITY STREET 502.60 P6797212 WANDA DR 27370 PRIVATE DRIVE 1,278.49 P8721011 WARD FARM RD 27316 PRIVATE DRIVE 1,031.86 O1367 WARD RD 27355 OUT OF COUNTY 5,057.55 P7763401 WARD VALLEY DR 27203 PRIVATE DRIVE 1,512.56 P8724107 WARREN DR 27355 PRIVATE DRIVE 803.70 C0011041 WARREN LN 27370 CITY STREET 890.44 C0008026 WARREN ST 27355 CITY STREET 1,079.41 C0001503 WASHINGTON AVE 27205 CITY STREET 503.21 P7765266 WATER OAK CT 27317 PRIVATE DRIVE 204.07 O9999 WATERBURY DR 27263 OUT OF COUNTY 300.90 P7713310 WATERCREST TRL 27205 PRIVATE DRIVE 1,086.66 P6796589 WATERFORD DR 27370 PRIVATE DRIVE 1,417.90 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-87 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0001622 WATERFRONT CT 27203 CITY STREET 547.70 P6794204 WATERLEAF LN 27360 PRIVATE DRIVE 351.94 P8701114 WATEROAK DR 27316 PRIVATE DRIVE 957.30 C0002252 WATERS EDGE DR 27263 CITY STREET 688.99 C0001593 WATERSIDE DR 27203 CITY STREET 749.95 C0001618 WATERVIEW CT 27203 CITY STREET 688.14 C0001382 WATKINS ST 27203 CITY STREET 1,792.35 C0005049 WATKINS ST 27316 CITY STREET 893.84 C0007025 WAYMON ST 27341 CITY STREET 1,563.15 S2908 WAYNE RD 27205 STATE ROAD 4,366.15 S2108 WAYNE WHITE RD 27313 STATE ROAD 8,557.11 S2108 WAYNE WHITE RD 27233 STATE ROAD 7,895.73 S1174 WAYNICK MEADOW RD 27205 STATE ROAD 19,126.22 S1916 WEANT RD 27263 STATE ROAD 9,975.76 C0003033 WEATHERLY DR 27248 CITY STREET 960.86 P7788501 WEATHERLY DR 27313 PRIVATE DRIVE 1,899.90 C0005055 WEATHERLY SQ 27316 CITY STREET 415.19 C0005050 WEATHERLY ST 27316 CITY STREET 1,692.50 C0006095 WEAVER ST 27317 CITY STREET 1,830.88 P7658470 WEDGE PL 27205 PRIVATE DRIVE 1,039.94 P7721421 WEDGEWOOD FOREST DR 27205 PRIVATE DRIVE 1,704.03 P7776537 WEDGEWOOD RD 27317 PRIVATE DRIVE 1,284.63 C0002171 WEDGEWOOD ST 27263 CITY STREET 1,277.44 S1761 WEDGEWOOD TER 27370 STATE ROAD 1,927.91 S2469 WEEDEN ST 27355 STATE ROAD 5,735.65 S2365 WEEPING WILLOW CT 27313 STATE ROAD 566.16 C0005051 WELBORN CIR 27316 CITY STREET 269.66 S1556 WELBORN RD 27370 STATE ROAD 13,020.52 P6794251 WELBORN RIDGE CT 27360 PRIVATE DRIVE 887.55 P7777576 WELCH LN 27205 PRIVATE DRIVE 254.95 S3276 WELLINGTON PL 27205 STATE ROAD 535.10 C0001383 WELLS CIR 27203 CITY STREET 261.97 S2275 WELLS LN 27317 STATE ROAD 1,066.20 C0001384 WESLEY CT 27203 CITY STREET 232.69 P7724277 WESLEY FARM LN 27350 PRIVATE DRIVE 1,197.91 S1630 WESLEYAN RD 27317 STATE ROAD 2,905.05 C0002190 WEST BROOK CT 27263 CITY STREET 1,432.77 P7778452 WEST CT 27313 PRIVATE DRIVE 276.18 S1128 WEST EDGEWOOD CIR 27205 STATE ROAD 1,103.72 P7721451 WEST FORK DR 27205 PRIVATE DRIVE 296.52 S3101 WEST LAKE DR 27205 STATE ROAD 2,245.85 C0003034 WEST ST 27248 CITY STREET 354.81 C0001385 WEST ST 27205 CITY STREET 1,909.37 S1352 WESTBURY DR 27205 STATE ROAD 2,699.72 S1424 WESTCHAPEL RD 27205 STATE ROAD 9,110.15 S1637 WESTFIELD CHURCH RD 27370 STATE ROAD 2,653.63 P7648256 WESTGATE RD 27205 PRIVATE DRIVE 2,344.29 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-88 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0002173 WESTHAVEN LN 27370 CITY STREET 4,477.07 P7741596 WESTMINSTER CT 27205 PRIVATE DRIVE 2,602.49 S2257 WESTMINSTER DR 27203 STATE ROAD 951.48 C0001386 WESTMONT CIR 27205 CITY STREET 369.01 C0001387 WESTMONT CT 27205 CITY STREET 717.13 C0001388 WESTMONT DR 27205 CITY STREET 4,151.55 C0002254 WESTON WOODS CIR 27370 CITY STREET 522.08 S3220 WESTOVER TER 27205 STATE ROAD 1,516.15 S3255 WESTSIDE CIR 27205 STATE ROAD 64.96 S3255 WESTSIDE CIR 27205 STATE ROAD 1,610.51 C0001390 WESTVIEW AVE 27205 CITY STREET 860.42 S3148 WESTWIND WAY 27350 STATE ROAD 1,197.73 S1233 WESTWOOD AVE 27205 STATE ROAD 1,211.45 C0007026 WESTWOOD DR 27341 CITY STREET 201.26 S1195 WESTWOOD DR 27341 STATE ROAD 4,974.12 C0001391 WESTWOOD DR 27205 CITY STREET 1,256.02 C0010003 WEXFORD CIR 27360 CITY STREET 1,460.17 P7628523 WHALE TAIL RD 27205 PRIVATE DRIVE 2,851.54 S3203 WHEATMORE CT 27370 STATE ROAD 927.01 S1877 WHIPPOORWILL DR 27205 STATE ROAD 1,749.04 C0001619 WHIRLWIND LN 27203 CITY STREET 1,160.46 C0002174 WHISPER OAK DR 27370 CITY STREET 2,058.57 P7774394 WHISPERING PINE DR 27317 PRIVATE DRIVE 1,095.25 P7736341 WHISPERING WAY 27350 PRIVATE DRIVE 3,360.37 P6794421 WHISPERING WOODS CT 27360 PRIVATE DRIVE 1,324.29 P7777573 WHITAKER CTRY RD 27233 PRIVATE DRIVE 1,225.19 S1132 WHITAKER RD 27205 STATE ROAD 2,695.85 C0011049 WHITE HORSE DR 27370 CITY STREET 339.41 P8722284 WHITE LAKE DR 27316 PRIVATE DRIVE 757.54 S2042 WHITE LN 27263 STATE ROAD 1,607.76 P7765260 WHITE OAK DR 27317 PRIVATE DRIVE 884.16 S3262 WHITE OAK ST 27203 STATE ROAD 3,000.51 P8725112 WHITE OAK WAY 27355 PRIVATE DRIVE 449.32 P7644280 WHITE PINES LN 27205 PRIVATE DRIVE 2,576.66 S2555 WHITE POPLAR ST 27316 STATE ROAD 618.76 C0006096 WHITE ST 27317 CITY STREET 472.31 S2456 WHITES CHAPEL RD 27355 STATE ROAD 15,478.86 S2141 WHITES MEMORIAL RD 27248 STATE ROAD 21,023.30 S3260 WHITETAIL DR 27370 STATE ROAD 633.90 P7780497 WHITLEY CTRY RD 27205 PRIVATE DRIVE 1,243.95 C0001624 WHITLEY ST 27205 CITY STREET 672.65 S2103 WHITT HUNT RD 27313 STATE ROAD 7,463.86 S2144 WICKER LOVELL RD 27317 STATE ROAD 14,533.86 P7745492 WILD ROSE DR 27350 PRIVATE DRIVE 976.37 P7703523 WILDERNESS TRL 27370 PRIVATE DRIVE 3,701.44 S2732 WILDFLOWER CT 27205 STATE ROAD 840.27 WILDlIFE WAY 27205 STATE ROAD 743.96 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-89 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2343 WILDWOOD LN 27205 STATE ROAD 1,437.21 S3256 WILDWOOD RD 27370 STATE ROAD 2,999.29 P6797519 WILDWOOD TRL 27360 PRIVATE DRIVE 4,228.67 S1185 WILKES SNIDER RD 27239 STATE ROAD 5,750.86 S1942 WILL COLTRANE RD 27350 STATE ROAD 2,315.60 S2438 WILLARD RD 27355 STATE ROAD 18,635.94 C0001393 WILLIAM AVE 27203 CITY STREET 1,106.95 P8711384 WILLIAM BURGESS RD 27316 PRIVATE DRIVE 2,122.03 S1232 WILLIAM DR 27205 STATE ROAD 304.82 S3215 WILLIAM HENLEY PL 27350 STATE ROAD 895.33 S2064 WILLIAM LEE PL 27263 STATE ROAD 1,718.87 P7773209 WILLIAM PENN DR 27317 PRIVATE DRIVE 660.62 P7768562 WILLIAMS CT 27313 PRIVATE DRIVE 2,469.45 S2559 WILLIAMS CTRY RD 27355 STATE ROAD 790.21 S2450 WILLIAMS DAIRY RD 27298 STATE ROAD 6,353.08 S2450 WILLIAMS DAIRY RD 27248 STATE ROAD 2,954.48 S1133 WILLIAMS FARM RD 27205 STATE ROAD 4,685.56 P8701519 WILLIAMS RD 27316 PRIVATE DRIVE 1,081.23 C0005052 WILLIAMS ST 27316 CITY STREET 1,267.61 P7727347 WILLIAMSBURG DR 27370 PRIVATE DRIVE 1,328.70 S2662 WILLIE WRIGHT RD 27316 STATE ROAD 17,926.93 S2662 WILLIE WRIGHT RD 27344 STATE ROAD 5,963.50 P7707522 WILLOW BEND RD 27370 PRIVATE DRIVE 1,548.45 P7788510 WILLOW CHAPEL CT 27313 PRIVATE DRIVE 1,536.47 C0001394 WILLOW CREEK CT 27203 CITY STREET 147.95 S2993 WILLOW DOWNS CT 27205 STATE ROAD 1,050.44 P7608465 WILLOW GROVE TRL 27205 PRIVATE DRIVE 3,445.67 S2389 WILLOW HILL CT 27313 STATE ROAD 567.37 S2264 WILLOW LAKE RD 27203 STATE ROAD 435.29 S2388 WILLOW MEADOWS DR 27313 STATE ROAD 1,082.03 P6795524 WILLOW OAK DR 27360 PRIVATE DRIVE 3,360.96 C0001395 WILLOW RD 27203 CITY STREET 1,417.12 S2364 WILLOW SPRINGS DR 27313 STATE ROAD 1,086.19 C0002260 WILLOW TER 27263 CITY STREET 788.91 P7788509 WILLOW TOWER CT 27313 PRIVATE DRIVE 247.74 S1839 WILLOW WOOD RD 27205 STATE ROAD 890.43 C0001541 WILLOWOOD DR 27317 CITY STREET 2,653.01 P7752301 WILSON CT 27205 PRIVATE DRIVE 333.08 P7752399 WILSON DR 27205 PRIVATE DRIVE 1,241.81 S1234 WILSON LN 27205 STATE ROAD 836.99 S1461 WILSON ST 27205 STATE ROAD 750.59 S1560 WILSON VIEW DR 27263 STATE ROAD 396.29 S1560 WILSON VIEW DR 27263 STATE ROAD 325.30 C0002175 WINCHESTER CT 27370 CITY STREET 1,019.14 S2736 WINCHESTER HEIGHTS DR 27205 STATE ROAD 1,357.03 S1997 WINCREST DR 27263 STATE ROAD 423.42 P7698469 WINCY RD 27316 PRIVATE DRIVE 396.07 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-90 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) C0001585 WINDCREST RD 27203 CITY STREET 445.01 P7727354 WINDEMERE CIR 27370 PRIVATE DRIVE 1,728.81 S1726 WINDEMERE CIR 27370 STATE ROAD 3,070.89 C0001531 WINDERMERE CT 27203 CITY STREET 713.45 S2733 WINDFLOWER LN 27205 STATE ROAD 894.49 P7767284 WINDING CEDAR RD 27317 PRIVATE DRIVE 705.41 P7786133 WINDING TREE TRL 27317 PRIVATE DRIVE 1,564.28 S1360 WINDING WOODS LN 27205 STATE ROAD 3,201.29 P7763512 WINDOVER RD 27317 PRIVATE DRIVE 1,042.07 S3134 WINDRIDGE CT 27370 STATE ROAD 333.27 P7646564 WINDRIVER RD 27205 PRIVATE DRIVE 3,102.88 P7724170 WINDSONG RD 27350 PRIVATE DRIVE 3,450.39 S2259 WINDSOR DR 27203 STATE ROAD 828.54 C0006117 WINDSOR PLACE CIR 27317 CITY STREET 1,330.79 S2308 WINDSOR TRL 27203 STATE ROAD 1,468.47 C0001621 WINDSTONE CT 27203 CITY STREET 578.27 P7783325 WINDY DR 27248 PRIVATE DRIVE 1,619.76 P7724272 WINN DEE REST LN 27350 PRIVATE DRIVE 2,503.85 C0011016 WINNERS CIR 27370 CITY STREET 688.17 C0001607 WINNETKA CT 27203 CITY STREET 356.17 C0001397 WINSLOW AVE 27205 CITY STREET 1,967.39 C0001398 WINTER ST 27203 CITY STREET 752.53 P7713153 WISCHUM WAY 27370 PRIVATE DRIVE 637.01 P7639447 WISTERIA LN 27205 PRIVATE DRIVE 332.13 C0002249 WOOD AVE 27263 CITY STREET 4,367.12 S1268 WOOD BLUFF TRL 27205 STATE ROAD 750.42 P8715101 WOOD MEADOWS RD 27355 PRIVATE DRIVE 2,009.11 P7667336 WOOD MINT RD 27205 PRIVATE DRIVE 618.59 P7624232 WOOD SAGE DR 27371 PRIVATE DRIVE 3,039.31 S3230 WOOD VILLAGE DR 27370 STATE ROAD 1,491.01 S3277 WOODALE CT 27360 STATE ROAD 1,027.70 S2945 WOODALE DR 27205 STATE ROAD 615.41 S3278 WOODALE FOREST LN 27360 STATE ROAD 779.30 P7763118 WOODBREEZE DR 27317 PRIVATE DRIVE 1,031.74 C0001399 WOODBURY ST 27203 CITY STREET 708.32 S2928 WOODCREST DR 27205 STATE ROAD 1,414.40 C0001400 WOODCREST RD 27203 CITY STREET 827.78 S2065 WOODCREST RD 27203 STATE ROAD 1,465.99 S1819 WOODCREST ST 27370 STATE ROAD 1,687.02 C0005053 WOODELL AVE 27316 CITY STREET 729.13 P7679323 WOODELL CTRY RD 27205 PRIVATE DRIVE 2,497.16 S2909 WOODFERN RD 27205 STATE ROAD 5,991.72 S2909 WOODFERN RD 27341 STATE ROAD 6,487.36 S3163 WOODFIELD CT 27350 STATE ROAD 553.96 P7743002 WOODFIELD CT EXT 27350 PRIVATE DRIVE 473.34 S3162 WOODFIELD DR 27350 STATE ROAD 5,003.90 P7712352 WOODFIELD SCOUT TRL 27205 PRIVATE DRIVE 1,913.51 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-91 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2720 WOODGLO DR 27205 STATE ROAD 1,933.80 S2997 WOODHAVEN DR 27205 STATE ROAD 1,258.81 C0001401 WOODLAND CIR 27203 CITY STREET 2,482.73 S2324 WOODLAND TRL 27203 STATE ROAD 1,108.73 P7790238 WOODLAND VIEW PL 27205 PRIVATE DRIVE 1,774.31 S1381 WOODLANE CT 27205 STATE ROAD 832.35 C0001402 WOODLAWN ST 27203 CITY STREET 556.51 S2186 WOODLAWN ST 27203 STATE ROAD 941.77 P7726542 WOODLYN WAY 27370 PRIVATE DRIVE 205.17 S1799 WOODLYN WAY 27370 STATE ROAD 362.72 P7764448 WOODMEN CAMP TRL 27317 PRIVATE DRIVE 3,192.69 S2548 WOODMONT DR 27316 STATE ROAD 905.91 P8702191 WOODMONT PL 27316 PRIVATE DRIVE 262.42 S2012 WOODOAK TRL 27317 STATE ROAD 1,777.37 S2333 WOODRIDGE DR 27205 STATE ROAD 1,980.34 P8714308 WOODROW JULIAN RD 27355 PRIVATE DRIVE 1,635.25 S1314 WOODS DAIRY RD 27239 STATE ROAD 7,373.29 C0006123 WOODS DR 27317 CITY STREET 672.73 S2729 WOODS STREAM LN 27205 STATE ROAD 2,813.40 P7781561 WOODS STREAM LN 27205 PRIVATE DRIVE 1,554.46 P7752394 WOODSIDE PL 27205 PRIVATE DRIVE 522.67 S2378 WOODSTREAM RD 27317 STATE ROAD 2,545.70 S2515 WOODVERY DR 27298 STATE ROAD 3,292.78 P6795522 WOODVIEW DR 27360 PRIVATE DRIVE 270.35 P7766150 WOOLLEN DR 27317 PRIVATE DRIVE 408.11 C0006098 WORTH ST 27317 CITY STREET 997.87 C0001403 WORTH ST 27203 CITY STREET 5,455.25 S2122 WORTHVILLE RD 27317 STATE ROAD 14,159.39 C0006099 WORTHVILLE ST 27317 CITY STREET 6,289.54 O9999 WRENN SMITH RD 27344 OUT OF COUNTY 1,435.44 C0001594 WRENWOOD CT 27203 CITY STREET 194.64 S2477 WRIGHT CTRY RD 27316 STATE ROAD 13,522.19 P7791246 WRIGHT FARM LN 27248 PRIVATE DRIVE 2,603.43 S1554 WRIGHT RD 27360 STATE ROAD 7,045.93 C0007027 WRIGHT ST 27341 CITY STREET 1,906.06 C0005060 WRIGHT ST 27316 CITY STREET 1,220.65 C0002181 WYNNEWOOD DR 27263 CITY STREET 423.94 C0011034 WYOMING CT 27360 CITY STREET 419.31 C0001404 YANCEY AVE 27203 CITY STREET 429.10 S1388 YESTEROAKS CT 27205 STATE ROAD 531.31 P8704481 YORK ACRES DR 27298 PRIVATE DRIVE 592.76 P8723397 YORK CTRY DR 27355 PRIVATE DRIVE 1,596.93 C0003035 YORK LN 27248 CITY STREET 989.67 S2410 YORK MARTIN RD 27298 STATE ROAD 12,376.22 P8701316 YORK RIVER RD 27316 PRIVATE DRIVE 4,216.73 C0005054 YORK ST 27316 CITY STREET 828.65 C0001405 YORK ST 27203 CITY STREET 442.40 APPENDIX E: ROAD ID NUMBER, NAME, ZIP CODE, TYPE AND LENGTH Revised: 5/25/2022 Appendix E-92 of 92 ROAD ID ROAD NAME ZIP ROAD TYPE LENGTH (FT) S2371 YORKMONT CT 27203 STATE ROAD 425.07 P7727346 YORKTOWN DR 27370 PRIVATE DRIVE 1,716.90 C0001406 YORKTOWN LN 27203 CITY STREET 466.06 P6796388 YOUNG OAK DR 27360 PRIVATE DRIVE 966.37 S2613 YOUNG RD 27205 STATE ROAD 4,064.59 S2613 YOUNG RD 27316 STATE ROAD 3,594.32 C0011026 YOUNTS ST 27370 CITY STREET 1,243.62 P7708470 YOUNTS VIEW DR 27370 PRIVATE DRIVE 457.49 S1701 YOUTH CAMP RD 27350 STATE ROAD 931.14 P7734505 YOUTH UNLIMITED DR 27350 PRIVATE DRIVE 3,648.62 C0007028 YOW DR 27341 CITY STREET 2,418.40 O8888 YOW RD 27341 OUT OF COUNTY DRIVE 59.92 C0001407 YZEX ST 27203 CITY STREET 1,435.75 C0002187 ZACHARY KENT DR 27263 CITY STREET 261.88 S1685 ZELMA BLVD 27263 STATE ROAD 1,751.02 S2468 ZION CHURCH RD 27355 STATE ROAD 4,140.18 ZOO CONNECTOR 27205 STATE ROAD 6,201.91 N 159EXT ZOO PKWY 27205 NC HIGHWAY 3,707.87 N 159 ZOO PKWY 27205 NC HIGHWAY 38,445.95 S3006 ZOO PKWY 27205 STATE ROAD 6,512.21 APPENDIX F: RESERVED ROAD NAME LIST Revised: 5/25/2022 These road names may or may not be used in future.Appendix F-1 of 2 ROAD NAME SUBDIVISION ZIP DATE RESERVED ADRIANA WAY THOMAS ESTATES 27203 2/10/2022 ALEXIA WAY THOMAS ESTATES 27203 2/10/2022 ALLEY ST CENTRAL 27203 ANGELA WAY THOMAS ESTATES 27203 2/10/2022 ARABLE ST COVINGTON RIDGE 27370 9/9/2021 AUGUSTA DR VILLAS AT PINEWOOD 27205 1/20/2022 AVERY DR 27370 BALER WAY COVINGTON RIDGE 27370 9/9/2021 BERKSHIRE DR TRINITY MEADOWS 27370 2/3/2022 BONN CT TRINITY MEADOWS 27370 2/4/2022 BROOKSTONE CT BUCK ST TRINITY MEADOWS 27370 2/3/2022 CANE CREEK LN CANE CREEK TOWNHOMES 27203 9/8/2021 COMBINE ST COVINGTON RIDGE 27370 9/9/2021 CRESTVIEW PKWY 27370 CRYSTAL CREEK CT CRYSTAL CREEK 27317 3/10/2021 DEER CREEK TRL TIMBERIDGE 2723 3/24/2022 DERBYSHIRE DR TRINITY MEADOWS 27370 2/3/2022 DIAMOND CIR ROYAL PINES PH5 27370 2/11/2021 DORSET CIR TRINITY MEADOWS 27370 2/4/2022 EDGEWATER CIR CRYSTAL CREEK 27317 3/10/2021 FAIRY FIRE CT FIREFOX 27205 6/8/2016 FOX LAUREL CT WINDCREST 27203 5/23/2022 FREST GLOW DR FIREFOX 27205 6/8/2016 FURROW ST COVINGTON RIDGE 27370 9/9/2021 GRANARY ST COVINGTON RIDGE 27370 9/9/2021 HAYRICK ST COVINGTON RIDGE 27370 9/9/2021 HENSON ST TRINITY MEADOWS 27370 2/3/2022 HUXLEY ST TRINITY MEADOWS 27370 2/3/2022 KENT DR TRINITY MEADOWS 27370 2/3/2022 LEGEND VILLAGE DR 27316 LISA FIRE LN FIREFOX 27205 6/8/2016 MERION CT VILLAS AT PINEWOOD 27205 1/20/2022 MONCLAIR DR 27370 MUIRFIELD LN VILLAS AT PINEWOOD 27205 1/20/2022 OAK MEADOW DR WINDCREST 27203 5/23/2022 OLIVER BRANCH RD TIMBERIDGE 27203 3/824/2022 ORCHARD KNOB DR OXON CT TRINITY MEADOWS 27370 2/3/2022 PEN OAK DR WINDCREST 27205 5/23/2022 PIERCE ESTATES DR PIERCE ESTATES 27350 1/21/2021 PLENISH ST COVINGTON RIDGE 27370 9/9/2021 SILVER MOON LN 27370 APPENDIX F: RESERVED ROAD NAME LIST Revised: 5/25/2022 These road names may or may not be used in future.Appendix F-2 of 2 ROAD NAME SUBDIVISION ZIP DATE RESERVED THOMAS ESTATES LN THOMAS ESTATES 27203 2/11/2022 THRESH WAY COVINGTON RIDGE 27370 9/9/2021 TIMBERLAND LOOP TIMBERIDGE 27203 3/24/2022 YORK BRANCH TRL TIMBERIDGE 27203 3/28/2022 Randolph County Official Road Name List Revised: 5/25/2022 Page 1 of 100 ROAD ID ROAD NAME POSTAL DISTRICT P7741395 ABBY LN ASHEBORO S3245 ABIGAIL DR TRINITY S1112 ABNER RD ASHEBORO S1112 ABNER RD TROY S2500 ACADEMY RD EXT FRANKLINVILLE C0003001 ACADEMY ST FRANKLINVILLE S2495 ACADEMY ST FRANKLINVILLE C0006001 ACCESS RD RANDLEMAN P7776546 ACORN DR RANDLEMAN P7782496 ACORN RDG FRANKLINVILLE P7767388 ACTS TEMPLE DR RANDLEMAN S1936 ADAMS FARM RD RANDLEMAN P7767385 ADAMS RD RANDLEMAN P7767386 ADAMS RD EXT RANDLEMAN P7776543 ADAMS WAY RANDLEMAN C0005062 ADMIRAL DR RAMSEUR P7778543 AILEEN DR PLEASANT GARDEN S3158 AKINS ST ASHEBORO O9999 ALAMANCE LINE DR LIBERTY S1898 ALAMO CT TRINITY S1897 ALAMO DR TRINITY S1713 ALBEMARLE RD ASHEBORO S1713 ALBEMARLE RD ASHEBORO P7791143 ALBERT MARTIN RD FRANKLINVILLE P7707521 ALBERTSON FARM RD TRINITY S1665 ALBERTSON RD ARCHDALE P6798157 ALBERTSON RD EXT ARCHDALE S3212 ALBERTSON VIEW ST TRINITY C0002001 ALDRIDGE RD ARCHDALE S1912 ALDRIDGE RD ARCHDALE S2988 ALEXANDER CT ASHEBORO P7717546 ALEXANDRIA DR TRINITY S1654 ALFORD ST TRINITY C0002184 ALISON LN ARCHDALE P7639445 ALLEN CT ASHEBORO S2028 ALLEN DR SOPHIA P7774310 ALLEN VESTAL RD RANDLEMAN C0002244 ALLENDALE DR ARCHDALE P7791144 ALLIE LN FRANKLINVILLE P8726458 ALLISON ST EXT LIBERTY P7755363 ALLRED CIR RANDLEMAN S3272 ALLRED HEIGHTS DR SOPHIA C0003002 ALLRED ST FRANKLINVILLE Randolph County Official Road Name List Revised: 5/25/2022 Page 2 of 100 ROAD ID ROAD NAME POSTAL DISTRICT S2290 ALLRED WAY RANDLEMAN P8702247 ALLREDVIEW AVE RAMSEUR S1770 ALLWOOD DR TRINITY S1823 ALPINE DR TRINITY P7795391 ALTON DR FRANKLINVILLE P7728548 AMBER WAY ARCHDALE C0001002 AMELIA CT ASHEBORO P8704210 AMICK LN LIBERTY C0001003 AMITY RD ASHEBORO S2917 ANCHOR DR ASHEBORO P7763510 ANDERSON DR RANDLEMAN P7796417 ANDREW CTRY LN CLIMAX C0003015 ANDREW HUNTER RD FRANKLINVILLE S2235 ANDREW HUNTER RD FRANKLINVILLE S2235 ANDREW HUNTER RD ASHEBORO P7782472 ANDREW JACKSON TRL FRANKLINVILLE P7675389 ANGEL FIRE TRL SEAGROVE P7763312 ANGUS TRL RANDLEMAN C0002238 ANNA CT ARCHDALE P7708391 ANNE ST ARCHDALE C0001597 ANNS CT ASHEBORO S2949 ANTHONY CT ASHEBORO S2887 ANTIOCH CHURCH RD SEAGROVE C0002003 APACHE RD ARCHDALE P7734086 APACHE TRL SOPHIA C0002004 APOLLO CIR ARCHDALE S1223 APPALOOSA TRL ASHEBORO S1120 APPLE TREE RD ASHEBORO S3136 APPLEGATE LN ASHEBORO S2133 APPLEWOOD RD RANDLEMAN S2934 APRIL LN ASHEBORO S1222 ARABIAN DR ASHEBORO S1727 ARBOR DR TRINITY S2284 ARCADIA RD RANDLEMAN C0002005 ARCHDALE BLVD ARCHDALE C0002006 ARCHDALE RD ARCHDALE C0002006 ARCHDALE RD TRINITY S1004 ARCHDALE RD TRINITY S2836 ARCHIE NEWSOM RD ASHEBORO P8712341 ARDEN CT RAMSEUR S1785 ARDEN RD THOMASVILLE S2702 ARLINGTON DR ASHEBORO S2702 ARLINGTON DR EXT ASHEBORO Randolph County Official Road Name List Revised: 5/25/2022 Page 3 of 100 ROAD ID ROAD NAME POSTAL DISTRICT S1230 ARMADILLO DR ASHEBORO C0001004 ARMFIELD AVE ASHEBORO C0002007 ARMSTRONG CT ARCHDALE S1810 ARNETTE DR ARCHDALE C0001005 ARNOLD ST ASHEBORO S2486 ARROW HEAD RD RAMSEUR C0003051 ARROW ST RAMSEUR C0001006 ARROW WOOD RD ASHEBORO S1386 ARROWSTONE DR ASHEBORO C0001007 ART BRYAN DR ASHEBORO C0001008 ARTHUR ST ASHEBORO P7791350 ARTHURS CT FRANKLINVILLE S1626 ARTISAN AVE ARCHDALE P8606258 ASBILL LN SEAGROVE C0011007 ASCOT DR TRINITY C0004092 ASH AVE LIBERTY S1995 ASHBROOK CIR ARCHDALE P7648255 ASHBROOK VIEW LN ASHEBORO C0001009 ASHDOL ST ASHEBORO C0008001 ASHEBORO ST STALEY C0001579 ASHEFORD CT ASHEBORO S3193 ASHETON DR TRINITY C0001515 ASHEWOOD CIR ASHEBORO C0002008 ASHLAND ST ARCHDALE C0001010 ASHLEY ST ASHEBORO C0001580 ASHMONT CT ASHEBORO C0002009 ASHWORTH CT TRINITY C0002010 ASHWORTH DR TRINITY S1161 ASHWORTH RD ASHEBORO P7730408 ASHWORTH RD EXT ASHEBORO P7649245 ASHWORTH VIEW DR ASHEBORO C0001510 ASPEN CT ASHEBORO S1330 ASTEROID RD ASHEBORO C0001011 ATLANTIC AVE ASHEBORO S2387 ATLAS DR RANDLEMAN S1663 AUCTION RD ARCHDALE S2913 AUMAN AVE ASHEBORO S2844 AUMAN CLAY RD ASHEBORO P7664189 AUMAN FARM RD SEAGROVE C0007001 AUMAN ST SEAGROVE P6796596 AUTUMN ACRES LN TRINITY C0002214 AUTUMN HILL CT ARCHDALE S2990 AUTUMN LN ASHEBORO Randolph County Official Road Name List Revised: 5/25/2022 Page 4 of 100 ROAD ID ROAD NAME POSTAL DISTRICT P8720101 AUTUMN RIDGE DR RAMSEUR P7649177 AUTUMN WOOD LN ASHEBORO P6796595 AUTUMN WOODS CT TRINITY P7679421 AVANTI DR ASHEBORO C0001012 AVONDALE AVE ASHEBORO P7765258 AVONLEA LN RANDLEMAN C0001013 AYCOCK ST ASHEBORO C0006002 AZALEA DR RANDLEMAN S1821 AZALEA LN TRINITY P7745393 AZEL DR SOPHIA C0002011 AZTEC DR ARCHDALE P7669216 B B TRL ASHEBORO S2849 BACHELOR CREEK RD ASHEBORO S2849 BACHELOR CREEK RD SEAGROVE S1327 BACK CREEK CHURCH RD ASHEBORO S1873 BACK CREEK CT ASHEBORO S1420 BACK CREEK RD ASHEBORO S1374 BACK CREEK TER ASHEBORO C0006003 BACK ST RANDLEMAN P7639448 BADIN LN ASHEBORO S1140 BAILEY RD ASHEBORO C0002245 BAILEYS WAY ARCHDALE C0002012 BAINBRIDGE ST ARCHDALE P7736013 BAKER FARM RD SOPHIA C0002013 BAKER RD ARCHDALE S2124 BALDWIN DR RANDLEMAN C0002014 BALFOUR DR ARCHDALE S2705 BALSAM ST ASHEBORO C0001014 BANK ST ASHEBORO S1931 BANNER WHITEHEAD RD SOPHIA S2102 BANTAM RD PLEASANT GARDEN P6796490 BARBARA LN TRINITY C0004099 BARBER DR LIBERTY C0001015 BARBER ST ASHEBORO P7781564 BARBERRY CT ASHEBORO C0001016 BARCLAY PL RANDLEMAN S2359 BARKER DR RANDLEMAN C0006020 BARKER ST RANDLEMAN P7717338 BARKLEY ST TRINITY S2219 BARKWOOD RD RANDLEMAN C0002015 BARRETT DR ARCHDALE C0002016 BARWOOD TER TRINITY P7792455 BAY DOE ST RAMSEUR Randolph County Official Road Name List Revised: 5/25/2022 Page 5 of 100 ROAD ID ROAD NAME POSTAL DISTRICT C0001017 BAY LEAF CT ASHEBORO P7725409 BAYBERRY DR SOPHIA S1117 BEANE CTRY RD ASHEBORO O9999 BEANE RD ARCHDALE S2707 BEANE ST ASHEBORO C0002017 BEARD AVE ARCHDALE P7713384 BEAU CT TRINITY S1778 BEAUMONT DR SOPHIA C0004087 BEAVER DAM CT LIBERTY C0004086 BEAVER DAM RD LIBERTY S2121 BEAVERCREEK RD RANDLEMAN P7774146 BECK CTRY DR RANDLEMAN P8605160 BECK FARM RD SEAGROVE S1524 BECKERDITE RD SOPHIA S1863 BEECH CIR TRINITY S2031 BEECH TREE CT SOPHIA P7797216 BEECH TREE DR CLIMAX S2357 BEECH TREE PL ASHEBORO S1387 BEECHWOOD CT ASHEBORO P7732428 BEECHWOOD DR ASHEBORO S2047 BEESON CT SOPHIA S1525 BEESON FARM RD SOPHIA C0002219 BELGIAN DR ARCHDALE C0006004 BELL AVE RANDLEMAN S1146 BELL SIMMONS RD ASHEBORO C0011036 BELLAWOOD DR TRINITY S1100 BELLS GROVE RD DENTON C0009005 BELMAR ST HIGH POINT C0011004 BELMONT DR TRINITY P7737341 BELO RUSH DR ARCHDALE C0002018 BELVA CT ARCHDALE S1319 BEN LAMBETH RD ASHEBORO P8614280 BENJAMIN RD SEAGROVE S2848 BENNETT FARM RD ASHEBORO S1002 BENNETT RD BENNETT S1002 BENNETT RD SEAGROVE C0001018 BENNETT ST ASHEBORO S2445 BENNY LINEBERRY RD CLIMAX P7666198 BENSON FOX DR ASHEBORO S2540 BENT OAK AVE RAMSEUR P8713418 BENT OAK AVE EXT RAMSEUR S2889 BENT RIDGE RD SEAGROVE P7755485 BENTLEY DR RANDLEMAN Randolph County Official Road Name List Revised: 5/25/2022 Page 6 of 100 ROAD ID ROAD NAME POSTAL DISTRICT S3144 BENTON RD SOPHIA P7743006 BENTON RD EXT SOPHIA C0001630 BERG ST ASHEBORO S1876 BERKLEY LN ASHEBORO S3190 BERKLEY PL ASHEBORO C0009007 BERKLEY ST HIGH POINT P7752302 BERRIE PL ASHEBORO S2230 BERRY LN PLEASANT GARDEN S1311 BESCHER CHAPEL RD TRINITY S1311 BESCHER CHAPEL RD DENTON S1167 BESSIE BELL RD ASHEBORO S2132 BETHANY CHURCH RD FRANKLINVILLE P8726309 BETHANY WAY STALEY S2112 BETHEL CHURCH RD PLEASANT GARDEN S2112 BETHEL CHURCH RD CLIMAX S1621 BETHEL DR HIGH POINT P6798500 BETHEL DR EXT HIGH POINT S2056 BETHEL DR EXT HIGH POINT S2660 BETHEL FRIENDS RD ASHEBORO S1118 BETHEL LUCAS RD ASHEBORO P6798102 BETHEL PARK DR HIGH POINT S3244 BETSY LN RANDLEMAN C0001019 BETTS ST ASHEBORO S1270 BETTY MCGEE DR ASHEBORO S2879 BEULAH CHURCH RD BENNETT P6795364 BEVAN DR TRINITY P6798197 BEVERLY HILLS DR HIGH POINT P8708416 BIG BUCK RD JULIAN P7608468 BIG CTRY DR ASHEBORO P7624296 BIG LEAF RD TROY P7767486 BIG OAK WAY RANDLEMAN P8737465 BIG TREE RD LIBERTY C0002019 BILLY AVE ARCHDALE P8627361 BILLY BRADY RD BENNETT P7782495 BILLY COLTRANE DR FRANKLINVILLE P7659391 BILLY CRANFORD LN ASHEBORO P7717301 BILLY LEE RD TRINITY S1160 BILLY WALKER RD ASHEBORO S1168 BINGHAM LOFLIN RD ASHEBORO C0001548 BIRCH BARK LN RANDLEMAN S2007 BIRCH DR RANDLEMAN C0002020 BIRCHWOOD CT TRINITY P7658472 BIRDIE PL ASHEBORO Randolph County Official Road Name List Revised: 5/25/2022 Page 7 of 100 ROAD ID ROAD NAME POSTAL DISTRICT P7777445 BIRDS VIEW RD RANDLEMAN C0001020 BIRKHEAD ST ASHEBORO P7616357 BLACK MTN RD ASHEBORO P6795527 BLACK OAK CT THOMASVILLE C0002021 BLAIR CT ARCHDALE C0002022 BLAIR DR ARCHDALE P6798361 BLAIR FARM RD ARCHDALE P6799415 BLAZING STAR DR ARCHDALE P7776540 BLUE HERON LN RANDLEMAN P6793146 BLUE QUARTZ DR THOMASVILLE S2321 BLUE RIDGE RD PLEASANT GARDEN P7754278 BLUE VIOLET DR RANDLEMAN S1643 BLUEBERRY CT TRINITY P7723155 BLUEBILL LN ASHEBORO S3226 BLUEBIRD LN ASHEBORO S2223 BOB KIVETT RD ASHEBORO O9999 BOBBY JEAN RD JULIAN P7666196 BOBBY MORAN DR ASHEBORO P7753171 BOBCAT TRL RANDLEMAN C0001625 BOBWHITE LN ASHEBORO C0001614 BOGEY LN ASHEBORO P8704479 BOGGS TRL LIBERTY P6799417 BOLES AVE HIGH POINT C0001506 BOLING DR ASHEBORO S1624 BOLIVAR AVE HIGH POINT S1178 BOMBAY SCHOOL RD DENTON S1139 BONDURANT RD ASHEBORO S1227 BONITA LN ASHEBORO S1242 BONITA ST ASHEBORO P7763340 BONKEMEYER CTRY TRL RANDLEMAN C0001519 BONKEMEYER DR RANDLEMAN P7763316 BONKEMEYER DR RANDLEMAN O8888 BONNIE DEWEESE RD THOMASVILLE C0002197 BONNIE PL ARCHDALE S2187 BOOKER T WASHINGTON AVE ASHEBORO C0006115 BOOKER T WOMBLE RD RANDLEMAN P7664100 BOONE FARM RD ASHEBORO C0007002 BOONE ST SEAGROVE C0011035 BORDEAUX DR TRINITY S1124 BOROUGH AVE SEAGROVE C0007003 BOROUGH AVE SEAGROVE C0001022 BOSSONG DR ASHEBORO P7737287 BOULDER CT ARCHDALE Randolph County Official Road Name List Revised: 5/25/2022 Page 8 of 100 ROAD ID ROAD NAME POSTAL DISTRICT P7737289 BOULDER DR ARCHDALE C0002255 BOULDIN CT TRINITY P7763119 BOUNDARY DR RANDLEMAN C0002023 BOWEN DR ARCHDALE P7764451 BOWERS CREEK RD RANDLEMAN S2125 BOWERS LN RANDLEMAN P7764263 BOWERS MEADOW DR RANDLEMAN S1954 BOWMAN AVE RANDLEMAN C0006005 BOWMAN AVE RANDLEMAN S2413 BOWMAN DAIRY RD LIBERTY P7737345 BOWMAN LOOP DR ARCHDALE S2811 BOYD AVE ASHEBORO S2855 BOYD DR SEAGROVE C0007004 BOYD DR SEAGROVE P7656212 BOYLES DR ASHEBORO S3105 BRAD RD SOPHIA C0002213 BRADFORD LN ARCHDALE C0006006 BRADSHER CT RANDLEMAN C0001023 BRADY AVE ASHEBORO S2489 BRADY ST EXT RAMSEUR S1370 BRANCHVIEW WAY DENTON S1359 BRANCHWATER RD ASHEBORO P7639235 BRANCHWOOD DR ASHEBORO C0002024 BRANDON LN TRINITY C0002240 BRANIFF PL ARCHDALE S1944 BRANSON DAVIS RD SOPHIA S1944 BRANSON DAVIS RD RANDLEMAN P7748087 BRANSON MEADOWS RD ARCHDALE S2101 BRANSON MILL RD RANDLEMAN S2101 BRANSON MILL RD PLEASANT GARDEN S2985 BRANTLEY DR ASHEBORO S1303 BRANTLEY GORDON RD DENTON P7658471 BRASSIE CT ASHEBORO S1603 BRAXTON CRAVEN RD TRINITY S2816 BRAY BLVD ASHEBORO S3012 BRAY BLVD ASHEBORO P7750445 BRAY BLVD ASHEBORO C0010001 BRECKENRIDGE DR THOMASVILLE S2377 BRECKENWOOD CT ASHEBORO C0001024 BREEZE HILL RD ASHEBORO C0001025 BREEZEWAY CT ASHEBORO C0001026 BRENTWOOD CT ASHEBORO S3171 BREVARD DR ASHEBORO Randolph County Official Road Name List Revised: 5/25/2022 Page 9 of 100 ROAD ID ROAD NAME POSTAL DISTRICT C0001027 BREWER ST ASHEBORO C0011044 BRIANNA PL TRINITY S3174 BRIAR PATCH LN THOMASVILLE S2600 BRIARCLIFF DR ASHEBORO S1789 BRIARCLIFF RD THOMASVILLE S2368 BRIAROAK DR CLIMAX S2046 BRIDGE POINT DR SOPHIA C0011014 BRIDLEWOOD DR TRINITY P7617458 BRIGHT STAR LN ASHEBORO C0002210 BRIGHTLEAF CT ARCHDALE S1214 BRILES DR ASHEBORO S1357 BRILES MEADOW RD TRINITY P8737364 BRINKLEY CTRY LN LIBERTY S2549 BRINTON PL RAMSEUR S2276 BRISTOL LN RANDLEMAN C0001029 BRITT AVE ASHEBORO C0001028 BRITTAIN ST ASHEBORO C0006105 BRITTANY LN RANDLEMAN S2273 BRITTANY TRL PLEASANT GARDEN C0002227 BRITTANY WAY ARCHDALE P7782473 BROAD OAKS ST ASHEBORO C0005002 BROAD ST RAMSEUR S1888 BROKAW DR TRINITY S1760 BROKEN OAK RD TRINITY S1930 BRONZIE LAWSON RD ARCHDALE S1829 BROOK CIR ARCHDALE C0011029 BROOK CIR EXT ARCHDALE C0001031 BROOK DR ASHEBORO S2810 BROOK DR ASHEBORO P7764166 BROOK ESTATES RD RANDLEMAN S1828 BROOK ST ARCHDALE C0002256 BROOKBANK CT TRINITY S1606 BROOKDALE DR TRINITY S1724 BROOKDALE DR TRINITY C0001032 BROOKDALE DR ASHEBORO S2384 BROOKDALE RD ASHEBORO S2485 BROOKGREEN RD RAMSEUR P8711343 BROOKHAVEN RD RAMSEUR C0002026 BROOKHOLLOW LN ARCHDALE C0002027 BROOKLEIGH CT TRINITY C0005003 BROOKLYN AVE RAMSEUR S2615 BROOKLYN AVE EXT RAMSEUR S2460 BROOKSDALE RD STALEY Randolph County Official Road Name List Revised: 5/25/2022 Page 10 of 100 ROAD ID ROAD NAME POSTAL DISTRICT S3281 BROOKSHIRE CT SOPHIA C0006007 BROOKSHIRE RD RANDLEMAN S1389 BROOKSIDE CT ASHEBORO C0001033 BROOKSIDE DR ASHEBORO C0005004 BROOKVIEW CIR RAMSEUR S1450 BROOKWAY RD ASHEBORO S2072 BROOKWOOD ACRES DR RANDLEMAN C0002178 BROOKWOOD CIR ARCHDALE S2246 BROOKWOOD DR ASHEBORO C0001604 BROOKWOOD DR ASHEBORO P7736336 BROOKWOOD ESTATES RD SOPHIA S2440 BROWER MEADOW RD STALEY S2866 BROWER MILL RD SEAGROVE S2635 BROWERDALE RD SILER CITY S2826 BROWERS CHAPEL RD ASHEBORO P7706201 BROWN HOUSE RD TRINITY S1953 BROWN LOOP RANDLEMAN S2118 BROWN OAKS RD RANDLEMAN P7707228 BROWN ST TRINITY C0001413 BROWN TRL ASHEBORO P7634001 BROWNLOW LN TROY S2941 BROWNMIRE DR ASHEBORO S2469 BROWNS CROSSROADS RD STALEY S2408 BROWNS MEADOW RD LIBERTY S2724 BROWNSTONE HILLS DR ASHEBORO P7797215 BROWNWOOD DR CLIMAX P7730571 BRUBAKER LN ASHEBORO S2132 BRUCE PUGH RD FRANKLINVILLE S2643 BRUSH CREEK RD BENNETT C0001034 BRYAN AVE ASHEBORO P7646561 BUCK FORD RD ASHEBORO S2070 BUCK LN SOPHIA P7733460 BUCK MOUNTAIN TRL SOPHIA C0001565 BUCKHORN DR RANDLEMAN S2607 BUFFALO FORD RD ASHEBORO S2607 BUFFALO FORD RD RAMSEUR P8710183 BUFFALO TRL RAMSEUR P7679428 BUGATTI AVE ASHEBORO C0003003 BUIE LN FRANKLINVILLE C0003004 BUIE LN EXT FRANKLINVILLE P6796386 BUILDERS DR THOMASVILLE S2412 BULB RD JULIAN S2111 BULL RUN CREEK RD FRANKLINVILLE Randolph County Official Road Name List Revised: 5/25/2022 Page 11 of 100 ROAD ID ROAD NAME POSTAL DISTRICT S2111 BULL RUN CREEK RD RANDLEMAN C0001035 BULLA ST ASHEBORO P7666197 BULLINS LN ASHEBORO S2437 BUMPAS RD STALEY S1698 BUNDY DR ARCHDALE S1433 BUNTING RD ASHEBORO S2411 BUNTON SWAIM RD LIBERTY C0002028 BURGEMERE ST ARCHDALE P8720102 BURGESS CATTLE DR SILER CITY S2723 BURGESS FARM DR RAMSEUR S2629 BURGESS KIVETT RD RAMSEUR C0001036 BURGESS ST ASHEBORO C0006008 BURGESS ST RANDLEMAN C0001037 BURMIL RD ASHEBORO S1105 BURNEY MILL RD TROY S1105 BURNEY MILL RD DENTON S1127 BURNEY RD ASHEBORO P7781449 BURNS FARM RD ASHEBORO C0001038 BURNS ST ASHEBORO S1176 BURRELL ALLEN RD DENTON S2517 BURROW RD JULIAN S2000 BURRWOOD DR ARCHDALE P7783229 BUSH CREEK DR FRANKLINVILLE C0005005 BUSH ST RAMSEUR S2419 BUTLER RD LIBERTY S2499 BUTLERS CHAPEL RD FRANKLINVILLE C0001566 BUTTERFLY TRL RANDLEMAN P7756301 BUTTKE DAIRY LOOP RANDLEMAN P8725110 BYRD HOUSE RD STALEY S3243 BYRD LN SOPHIA C0002243 BYRON LN ARCHDALE P8712129 C C SQUARE RD RAMSEUR S2553 C C SQUARE RD RAMSEUR S1320 CABLE CREEK RD ASHEBORO P7768156 CABLE FARM TRL RANDLEMAN S2861 CAGLE LOOP RD SEAGROVE C0006009 CAGLE ST RANDLEMAN S1880 CAIN CT TRINITY S2523 CALHOUN DR LIBERTY C0002029 CALLAHAN ST ARCHDALE S2193 CALLICUT ST ASHEBORO S1141 CALLICUTT HENLEY RD ASHEBORO P7664422 CALLIE DR SEAGROVE Randolph County Official Road Name List Revised: 5/25/2022 Page 12 of 100 ROAD ID ROAD NAME POSTAL DISTRICT S2059 CALVARY WAY THOMASVILLE S1847 CALVERT ST TRINITY P7717335 CALVERT ST TRINITY S2367 CAMDEN CT ASHEBORO P7764445 CAMELLIA LN RANDLEMAN S2289 CAMELOT DR ASHEBORO S1843 CAMERON CIR ASHEBORO C0002030 CAMERON CT TRINITY S3224 CAMERON DR ASHEBORO P7712388 CAMERON PL ASHEBORO P7733343 CAMP MUNDO VISTA TRL SOPHIA S2120 CAMP NAWAKA RD RANDLEMAN P7775126 CAMP NAWAKA RD EXT RANDLEMAN P8702319 CAMP ST RAMSEUR P7778391 CAMPBELL RD PLEASANT GARDEN P7775115 CAMPFIRE RD RANDLEMAN S1307 CANAAN CHURCH RD DENTON P7665295 CANDLEBROOK DR ASHEBORO C0004002 CANDLEWOOD DR LIBERTY S2832 CANE MILL RD ASHEBORO C0001557 CANNON CT ASHEBORO S1206 CANNON HEIGHTS DR ASHEBORO C0001039 CANOY DR ASHEBORO S2625 CANOY FARM RD RAMSEUR C0011002 CANTER DR TRINITY S1983 CANTER LN ARCHDALE S1927 CANTER RD ARCHDALE S2696 CANTERBURY TRL ASHEBORO P7760540 CANTERBURY TRL ASHEBORO C0005006 CAPEL ST RAMSEUR P7743005 CARAWAY CT SOPHIA S3143 CARAWAY DR SOPHIA S1004 CARAWAY MTN RD ASHEBORO S1004 CARAWAY MTN RD SOPHIA P7733458 CARAWAY SPRINGS TRL SOPHIA S1730 CARAWAY TRL SOPHIA P8736258 CARDINAL CT LIBERTY C0002258 CARDINAL PL ARCHDALE S1221 CARDINAL ST ASHEBORO P8736257 CARDINAL VIEW DR LIBERTY S2143 CARL ALLRED RD FRANKLINVILLE S2885 CARL BRADY RD BENNETT S2882 CARL COX RD BENNETT Randolph County Official Road Name List Revised: 5/25/2022 Page 13 of 100 ROAD ID ROAD NAME POSTAL DISTRICT C0001040 CARL DR ASHEBORO P6782250 CARL LEE DR LEXINGTON C0006010 CARLISLE AVE RANDLEMAN C0006011 CARLISLE AVE EXT RANDLEMAN S1838 CARLTON DR SOPHIA S1834 CAROLE DR SOPHIA C0001041 CAROLINA AVE ASHEBORO C0002031 CAROLINA CT ARCHDALE S1269 CAROWOOD DR ASHEBORO S2366 CARRIAGE CROSSING DR PLEASANT GARDEN P6796281 CARRIAGE HOUSE CIR TRINITY S2697 CARRIAGE LN ASHEBORO C0011